Reise › Reisen Safari Individualreisen Österreich

Reise


Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 Herr Markus Karner Reisen

9462
Bad st. Leonhard
Die Vorfreude ist die schönste Freude, so sagt der Volksmund. Das trifft sicher auch auf die schönste Zeit des Jahres..
urlaubmarkus.markus-karner.com Zeit Urlaub Markus Urlaubmarkus Urlaubsreisen Urlaubsziele Gratis Preisen Reise Price Saison Garantie Wer Reisebüro Kurzreisen
2 SFA Sprachreisen Sprachreisen

5020
Salzburg
SFA Sprachreisen in Salzburg und Wien bieten Sprachreisen und Sprachferien in England, Frankreich und den USA in Englisch, Französisch, Italienisch..
sfa-sprachreisen.at/ Sprachreisen Jugendliche Erwachsene Sprachferien Wien Salzburg Ausland Schulklassen Angebote Katalog Sprache Reise St San Unterbringung
3 Hagleitner Touristik – Genuss Reisebüro

5700
Zell am See
Wer auf der Suche nach Genussurlaub oder Gourmetreisen ist, ist beim Profi für Genussreisen Marion Hagleitner Touristik genau richtig. Hagleitner..
hagleitner-touristik.at/ Gtgtgt Radreisen Genussreise Touristik Buchen Hagleitner Italien österreich Gourmetreisen Entdecken Deutschland Genussreisen Genuss Genussurlaub Datenleitung Sicherer Finden Adria
4 PromoMasters Online Marketing Wien Suchmaschinenoptimierung

1110
Wien
PromoMasters Wien ist Spezialist für Suchmaschinenmarketing, Suchmaschinenoptimierung SEO, Suchmaschinenwerbung SEA und AdWords sowie Analytics. Die Agentur mit Sitz in Wien..
promomasters.at/ Google Promomasters Suchmaschinenoptimierung Blog Website Media Social Adwords Responsive Seo Tipps Schulung Open Relaunch Salzburg Reise Assistent Graph Tablets Suchmaschinenmarketing Tourismus
5 Gutscheine Gewinnspiele sowie Online-Shops aller Art Gutscheine Gewinnspiele sowie Online-Shops Werbeagentur

8741
Weißkirchen in Steiermark
Discount Portal bietet seriöse, geprüfte Gutscheine und Gewinnspiele an, die täglich aktualisiert und ergänzt werden. Nebenbei werden Online-Shopping sehr leicht gemacht..
discountportal.at Gewinnspiele Gutscheine Discount Besten Urlaubsportale Portal Reise Gratis Testenz Produte
6 Flughafentaxi Wien Taxiunternehmen

1110
Wien
Flughafentaxi Wien - Der kostengünstigste Reise ohne Stress Flughafentaxi Wien bedient seit über 5 Jahren den Transportbedarf des Flughafen in Wien...
flughafentaxi-in-wien.at/ Flughafen Wien Reise Flughafentaxi Passagiere Kunden Schritt Handgepäck Koffer Fahrer Stk Faq Taxi Fahrt Bestellen Meeting Bustransferherumschlagen Transfer
7 Reisebus mieten Reise


Naderer bietet ein breitgefächertes Angebot von individuellen Tagesausflügen über organisierte Mehrtagesfahrten bis hin zu längeren Urlauben. Als Reisedienstleister plant..
naderer-reisen.at/bus-mieten/ Reise Bus Mieten Busreise Linz Naderer Reisebus Reisekalender Rückfahrt Kleinbus Anfrage Zusätzliche Angebot Preis Versicherungen Pauschalreisen Zeit Einzelzimmer Fahrzeiten Browser
8 REISEIMPRESSIONEN Reise

1230
Wien
Portugal-Rundreise, Das Matterhorn Erlebnis, Best Highlights of Muenchen, Schweizer Bahnerlebnis, STOCKHOLM - Was fuer eine Stadt!, Die besten Innsbrucker Hotspots..
oswald-walser.bplaced.net/reise_impressionen.htm Heimat Datei Link Webmaster Einwohner Internet Gehe Gefunden Unseren Rechte Leider Hauptseite Wende Auskünfte Antrag]
9 Individualpädagogik Projekt Kanu bauen Kanutrekking Individualpädagogik Projekt Kanu bauen Individualpädagogik Sozialpädagogik

2700
Wiener Neustadt
Eine erlebnispädagogische Reise mit dem Kanu - vom Selbstbau bis zur Ausfahrt Ich biete erlebnispädagogische Kanu Bau Workshops an, in welchen..
kanubauen-kanutrekking.at Kanu Kanus Kanubauen Bauen Angebot Trekking Pixeliode Kanutrekking Kinder Behinderung Erlebnispdagogik Stunde Stunden Jugendlichen Schiffsbau Sperrholz Zeta Preisanbotes Reise
10 Private Rundreisen auf Sri Reise


Individuelle Rundreisen und Ausflüge auf Sri Lanka - angeboten von Ihrem privaten Fahrer Kapila Bandara..
srilanka-holidaytours.com/ Lanka Holiday Kapila Bandara Tours Driver Sri Private Contact Reviews Culture Nature Kotalawala Kapila@hotmailcom Y
11 Reisesuchmaschine Reisevermittlung

4942
Gurten
Reisepreisvergleich, online Buchung und Beratung quer durch den Bereich Tourismus. Neben den Pauschalreisen, Flüge und Hotels gehören auch Rundreisen, Kreuzfahrten..
reise-suchmaschine.at/ Reise Urlaub Anreise Eigene Flug Reisen Buchen Pauschalreisen Sommerurlaub Minute Italien Reisesuchmaschine Last Hotel Günstig Schweiz Paris
12 Ristorante il Cavallino Baden Italienisches Restaurant

2500
Baden
… im Ristorante il Cavallino, dem neuen Badener Treffpunkt für alle Freunde der feinen italienischen Küche. Begeben Sie sich mit..
ilcavallino.at Ristorante Cavallino Zutaten Baden Restaurant Fotos Speisekarte Cucina Italienische Atmospäre Begeben Freunde Muss– Reise Welt
13 Christina Gritsch Altwaren Räumungen

7574
Burgauberg
Zeitreise, Historische Möbel, Antike Möbel, Räumungen, 50er, 60er, 70er, 80er, Schallplatten, Bücher, Teppiche, Antiquitäten, Gritsch, Puppen, Tische, Möbel, Regale, Verlassenschaften..
zeitreise45.at Zeitreise Herzlichst Platz Christina Spezialistin Glas Porzellan Möbel Mich Geschäft Reise Musik Angebot Gebrauchtwaren Schnitzelklopfer Verlassenschaft Epochen Lassen Ostern Möbel Kleinteile
14 Vorarlberg-Hotels Reise


Vorarlberg-Hotels ist ein unabhängiger Blog. Wir stellen Ihnen hier regelmässig Hotels im Ländle vor, die wir selbst getestet haben...
vorarlberg-hotels.at Hotel Hotels Leave Posted Vorarlberg Kleinwalsertal Zimmer Hirschegg Montafon Dornbirn Schruns Bezau Silbertal Tagged Scesaplana
15 La Vida Bella - Lebensberatung

4560
Kirchdorf
Ich nehme mir bewusst Zeit, für Sie hier zu sein, um Sie und Ihre Themen kennen zu lernen. Mit diversen..
vidabella.at Text Bitte Eingabefeld Mail Vinothchandar Schritt Reise Nachricht Entscheidung Vida Bella Unterstützt Name Webnode Ecke Reiki Mein Ch
16 Ferienwohnung Galtür Reise


Ferienwohnung Paznaun..
perjen.com Tirol Urlaub Galtür Ferienwohnungen Oostenrijk Vakantiewoning Reizen Schönen Land Ferienwohnung Unser Ferienhäuser Ferienwohnungs Winterurlaubtirol Y
17 Koffer und Taschen Lederwaren

1020
Wien
Ein Fachgeschäft für praktische Reisekoffer, Trollys, Reisetaschen und Reisebedarf für sicheres und bequemes reisen.Modische Taschen und Geldbörsen. Aktuell-Billig-Chick. Seit 25..
abclederwaren.at Lederwaren Wien Reise Taschen Reisetasche Geldtaschen Abc Koffer Freizeit Kabinengrösse Reisen Shopping Angebote Businessschule Reisegepäck Aktuell Billig Chic Lederbörsen Qualität
18 Koffer und Taschen Lederwaren

1020
Wien
Ein Fachgeschäft für praktische Reisekoffer, Trollys, Reisetaschen und Reisebedarf für sicheres und bequemes reisen.Modische Taschen und Geldbörsen. Große Auswahl an..
abclederwaren.at Lederwaren Wien Reise Geldtaschen Taschen Abc Reisetasche Koffer Reiseaccesoires Reisekoffer Shopping Kabinengrösse Reisegepäck Angebote Reisen Modische Lederbörsen Laptoptaschen
19 Marokko Reisen vom Spezialisten Reiseveranstalter

8127
Forch
Erleben Sie die Vielfalt und Gastfreundlichkeit Marokkos auf einer Individual- oder Gruppenreise. Seit 39 Jahren sind wir darauf spezialisiert, Ihren..
ritz-reisen.de Reisen Marokko Ritz Land Katalog Golfreisen Individuelle Leute Reise Golf Marokkoreisen Städtereisen Golfplätze Kontaktformular Vertragsbedingungen Reiseziel
20 Urlaub am Klopeinersee Reise

9111
Haimburg
Wir von Einfach Klopeinersee bieten ausgewählte Unterkünfte in verschiedenen Preiskategorien am Klopeinersee an. Ob ein einfaches Zimmer im Zentrum..
einfachklopeinersee.at Klopeinersee Einfach Klopeiner Deine Unterkünfte Urlaub Zimmer Pension Unterkunft Badesteg Funktionierts Google+ Hotel Faqs Unterkünften Sende
21 Satur reisen Satur

Satur reisen ... Satur reisen AKTUELL INDIVIDUELL UND GRUPPENREISEN Hohen Tatra Zipser Land Holzkirchen UNESCO
satur.at Satur Reisen
22 KrennReisen krenn
8344
Bad Gleichenberg
Krenn Reisen ... Krenn-Reisen Gesellig Aktiv Gourmet Busse mieten Suche Busse mieten? +
krenn-reisen.at Krenn Reise Reisen Gourmet Pilgern Wallfahrt Bus Shuttle
23 Individuelle Reisen weltweit | Reisen

Weltweite Reisen individuell zusammenstellen. MESO Reisen Ihr Reiseveranstalter für Fernreisen. ... oder infomeso-berlin Alternativ Tours GmbH MESO Reisen GmbH Reisebüro Berlin Otto-Suhr-Allee
alternativ-tours.at Reisen Individuell MESO Reisen MESO Reisen Berlin Weltweit
24 ClubReisen: Hier finden Sie ClubReisen

ClubReisen: Finden Sie aktuelle Angebote zu ClubReisen. Viele Infos und alle Angebote. Sparen Sie bis ...  Club-Reisen Hier finden Sie alles zu Club-Reisen Club-Reisen Club Aldiana Club Robinson Club
club-reisen.at ClubReisen
25 IslandReisen Ihr Islandreise Spezialist Island

IslandReisen Ihr Islandreise Spezialist Agentur für Reisen nach Island ... + - Kontakt Katalog Menu Pauschalreisen Minigruppen Reisen
island.at Island Reise Islandreise Islandreisen Island
26 Reisen Restplatz billig Urlaub traviaNET GmbH Urlaub
94469
Deggendorf
Urlaub Reisen Restplatz Italien Restplätze Reisen billig Günstige Reisen Portugal ... Restplätze Cancun Reisen Spanien Restplatz Türkei Billige Reisen Griechenland billig Reisen Kreta
hitreisen.at Urlaub Reisen Spanien Restplatz
27 Strohmeier Reisen Ihr Reisen

Mit Strohmeier Reisen reisen. Ihr Partner für entspanntes Reisen. ...  Strohmeier Reisen - Ihr Partner für entspanntes Reisen Ihr Partner für entspanntes Reisen
strohmeier-reisen.at Reisen Busfahrten Steiermark Wettmannstätten
28 ReiseInsider das österreichische Reise

Reise Insider ... Ein Roadtrip auf dem südlichsten Abschnitt des Highway in Florida - hier heißt es reisen statt... weiterlesen
reiseinsider.at Reise Insider Reiseportal Reiseblog
29 GOSCH reisen Tagesfahrten Michaela und Franz Gosch OG GOSCH
8570
Voitsberg
GOSCH Reisen. Tagesfahrten. ... Highlights Reise-Highlights Reiseeindrücke Reisen Tagesfahrten Mehrtagesfahrten
gosch-reisen.at GOSCH Reisen Tagesfahrten
30 Reisebausteine Reisen weltweit reisebausteine

Auf Reisebausteine.de finden Sie mehr als 6000 Angebote und Reise Ideen weltweit preiswert und mit ... ..... gleich geht es weiter zu den Reise Angeboten auf reisebausteine
reisebausteine.at Reisebausteine Reisen Reise Urlaub
31 Besser REISEN das Besser

besser REISEN Das Österreichische Reiseportal ... Home Reise News Auf Tour Österreich City-Trip Service Lifestyle Angebote besser REISEN-Tipps
besser-reisen-online.at Besser Reisen Reisetipps LastMinute Kreuzfahrten
32 Homepage Hietz Reisen Hietz

Hietz Bus Reisen ... . WILLKOMMEN auf unserer Homepage von Hietz Reisen Gerne
hietz-reisen.at Hietz Bus Reisen Autobus Ausflug
33 Hermann und Susanne auf Hermann

Hermann und Susanne auf Reisen ... Hermann und Susanne auf Reisen Main menu About Home Meta Log in Entries RSS Comments RSS
nz.derstern.at Hermann Und Susanne Auf Reisen
34 Lastminute Reise lastminute

Last Minute Urlaub zu Schnaeppchen Preisen reisedirekt: Direkt buchen direkt sparen. Grosser Reise und ... Minute Flüge Cluburlaub Kreuzfahrten » Hochseekreuzfahrten » Flusskreuzfahrten Lastminute Reise Über
lastminute-reise.at Lastminute Reise
35 Lastminute Reisen lastminute

Last Minute Urlaub zu Schnaeppchen Preisen reisedirekt: Direkt buchen direkt sparen. Grosser Reise und ... Minute Flüge Cluburlaub Kreuzfahrten » Hochseekreuzfahrten » Flusskreuzfahrten Lastminute Reisen Über
lastminute-reisen.at Lastminute Reisen
36 Besser REISEN das Besser

besser REISEN Das Österreichische Reiseportal ... Home Auf Tour Österreich City-Trip Service Lifestyle Angebote besser REISEN-Tipps Printausgabe
besser-reisen.co.at Besser Reisen Reisetipps LastMinute Kreuzfahrten
37 Reiseidee.at Günstig Reisen Reisen
1140
Wien
Reiseidee.at Günstig Reisen nah und fern Reisen für jedes Budget und Alter ... Reiseidee - Reisen weltweit Günstig Reisen nah und fern Asien Baden Tauchen Asien Indien Reisen Indonesien
reiseidee.at Reisen Reise Rundreisen Rundreise
38 Willkommen bei mit Reisen mit Reisen GmbH mit
4020
Linz
mit Reisen bietet Ihnen Urlaubs Geschäfts und IncentiveReisen aus einer Hand. Bei uns stehen ... Sie Javascript und laden Sie die Seite neu! Home Was wir machen Reiseziele Team Kontakt Willkommen bei mit Reisen
mit-reisen.at Mit Reisen Sommerurlaub Urlaub Linz
39 Reisebüro Kerschner Reisen Kerschner Reisen GmbH Reisebüro
3250
Wieselburg
Webauftritt des Reisebüro Kerschner Reisen. ... Navigation überspringen Start Kerschner Reisen Ski-Express Reiseangebote Event-Bus Kataloge
kerschner-reisen.at Reisebüro Busunternehmen TUI Reise Center
40 RISA Reisen | Reisen gruppenreise
40233
Düsseldorf
RISA Reisen ? Ihr Reiseveranstalter für Südamerika! Hier finden Sie Ideen für Reisen im Mietwagen ... + - inforisa-reisen RISA Reisen Reisen in Südamerika
risa-reisen.at Gruppenreise Rundreise Reiseveranstalter Suedamerika Reisen Mietwagen Klei
41 Herzlich Willkommen bei Ratzenböck Reisebüro

Ratzenboeck Reisen stellt Sich das Reisebuero und die Reisen vor... Mit Freunden reisen! ... Sie über interessante Reisen informieren zu dürfen. Herzlich Willkommen bei Ratzenböck Reisen! Willkommen Wir freuen
ratzenboeck-reisen.at Reisebüro Autobus Reisebus Busreisen
42 Im Seekajak auf Reisen seekajak

Seekajak Reisen sind Aktiv Reisen mit einem Schuss Abenteuer. Im Seekajak kommt ihr an entlegene ... Seekajaktouren - Europa weltweit Start Im Kajak reisen? Seekajakreisen ? für wen? Seekajak
fjord-travel.at Seekajak Seekajakreisen Aktiv Reisen Aktives
43 Mare Baltikum Reisen Christine Salten & Andres Vainumäe GbR reise
20259
Hamburg
Mare Baltikum Reisen bietet Reisen nach Estland Lettland Litauen Skandinavien mit Finnland ... Lettland Litauen Finnland Polen Russland Norwegen Schweden Dänemark Reisen Gruppenreisen Kulturreisen
mare-baltikum-reisen.at Reise Baltikum Baltikum Reisen Reisen Im
44 Onlineweg.de Last Minute onlineweg.de Touristik GmbH last
81373
München
Last Minute Reisen mit persönlicher Beratung buchen ? günstige Reisen buchen ? Pauschalreisen mit Bestpreisgarantie ... Kreuzfahrten Ausflüge Kurzreisen Last Minute Last-Minute Reisen Reisen bis EUR - Pauschalreisen Günstige
onlineweg.at Last Minute Reisen Last Minute Urlaub
45 Jedek Reisen: Jedek Reisen jedek
2483
Ebreichsdorf
JedekReisen: Ihr Spezialist für den etwas anderen Urlaub ... Pauschalreisen Mexico Home AGB Links Newsletter Jedek Reisen GmbH
jedek-reisen.at Jedek Reisen Jedekreisen Urlaub
46 NESS Reisen Ness

Wir sind gerne für Sie da: NESS Reisen GmbH. Dammstr. 6 1200 Wien ... NESS Reisen Menü Kontakt Kataloge online Newsletter Angebote Sonderangebote Online Buchungstool
nessreisen.at Ness Reisen NessReisen Ness Reisen
47 Magisch Reisen Magisch

Magisch Reisen
magisch-reisen.at Magisch Reisen
48 Gegg Reisen Exklusiv Luxus

Gegg Reisen Busreisen und vieles mehr! Leben ist Bewegung Bewegung ist Reisen ... AKTUELL Gegg Reisekatalog >Reiseträume < jetzt erhältlich Der neue Gegg-Reisen Katalog >Reiseträume
gegg-reisen.at Luxus Bistro Bistrobus Setra
49 Last Minute Reisen Angebote Holiday Smart GmbH Last
45127
Essen
Last Minute Reisen Angebote im Überblick von allen Veranstaltern finden Sie hier. Ihr ... Last Minute Reisen Angebote Last Minute Reisen Angebote können Sie ganz einfach hier vergleichen
reisen-ab-flughafen.at Last Minute Angebote Last Minute Reisen Angebote
50 ReiseSuchmaschine.at Reiseangebote im reisesuchmaschine

Flug reisen Luxusreisen billig reisen Pauschalreisen und auch eigene Anreise last ... Städtereisen Baustein-Reisen Mietwagen Kreuzfahrt Wellness Sonstige Angebote Sterne Luxusreisen Reisen
reise-suchmaschine.at Reisesuchmaschine Flugreisen Sommerurlaub Winterurlaub
51 Reisen direkt Reisen Ferien ferien

Ferien und Reisen zu Schnaeppchen Preisen reisedirekt: Direkt buchen direkt sparen. Grosser Reise und ...  Reisen direkt Reisen Ferien buchen - direkt sparen Inline HTML Online Reiseanfrage oder Live
reisedirekt.at Ferien Reisen Urlaub
52 Reiseberichte auf ReiseZiele.at Reiseziele

Reiseziele Reise Urlaub USA Reisebericht Reiseinfo ... auf Reise-Ziele!
reise-ziele.at Reiseziele Reise Urlaub USA Reisebericht Reiseinfo
53 Romania Touristik / RotReisen Ihre

Ihre Reise Spezialistäten für gelungene maßgeschneiderte Reisen und Urlaube! ... lunii! Profitati de reducere % din preturile afisate! Gruppenangebote Reisen und sparen mit netter
romaniatouristik.at Ihre +Reise +Spezialisten Für Gelungene Maßgeschneiderte+ Reisen* Und
54 SchweizerReisen Startseite Schweizer

SchweizerReisen in Korneuburg bietet exquisite Studien und Kulturreisen ... Menu Startseite Startseite ÖCV und MKV Reisen ÖCV und MKV Reisen Allgäu und Vorarlberg Allgäu
schweizer-reisen.at Schweizer Reisen Studienreisen Kulturreisen Busreisen
55 REISEaktuell Das österreichische CB-Verlags GesmbH Reise
1060
Wien
REISEaktuell eines der attraktivsten Reisemagazine aus Österreich informiert mit Top News zum Thema ... Executive Club Herzlich Willkommen! REISE-aktuell das internationale Reise-Journal konkretisiert
reiseaktuell.at Reise Magazin Reisemagazin Reise Aktuell
56 Lifeearthreisen Home Reisen

LifeearthReisen ... im Regenwald von Madagaskar mit Blind Climber Andy Holzer Diesmal führt die Reise mit Andy Holzer
lifeearth-reisen.at Reisen Afrika Asien Amerika
57 Notizen.at Reisen Leben notizen
6343
Rotkreuz
Notizen zu Freizeit Reisen Leben Arbeit ... Navigation Freizeit Notizen Reisen Notizen Leben Notizen Arbeit Notizen Allgemein Startseite
notizen.at Notizen At Freizeit Reisen
58 Weinstadt Reisebüro Fischer Reisen reisen

Fischer Touristik Reisen ... Fischer Touristik - Weinstadt Startseite Reisen Hotel Kreuzfahrten Ferienhaus/Wohnung Mietwagen
kanarische-inseln.at Reisen Weinstadt Lastminute Pauschalreisen Fischer Touristik Kreuzfahrt
59 Lidl Reisen ...einfach Lidl E-Commerce International GmbH & Co. KG Lidl
74172
Neckarsulm
LidlReisen sind spannende und erholsame Reisen zu unglaublich günstigen Preisen in die ganze Welt ...einfach ... um alle Funktionen unserer Seite nutzen zu können. Zur Navigation springen Zum Inhalt springen Lidl Reisen ...einfach
lidl-reisen.at Lidl Reisen LidlReisen Flugreisen
60 Weiss Reisen Reisebüro Weiss

Ihr Reisebüro WeissReisen Bus Schiffs und Flugreisen. 5280 Braunau ... Reisebüropartner Reiseversicherung Kontakt Herzlich Willkommen bei Weiss-Reisen in Braunau Weiss-Reisen
weiss-reisen.at Weiss Reisebüro Reisen Busreisen Flugreisen
61 Neuhuber Reisen Neuhuber
9500
Villach
Neuhuber Reisen Österreichs erstes MOBILES REISEBÜRO mit Sitz in Villach Kärnten ... . Makunudu Malediven Ich sehe mich als Ihr Guide und persönlicher Reise-Berater durch den wirren Angebots
neuhuber-reisen.at Neuhuber Reisen Elke Neuhuber Reisebüro
62 Bixi: Ski Rennrad rennrad
83679
Sachsenkam
Bixi's SlowRide rennrad reisen und skireisen Homepage ... Rennrad-Reisen zum Marathon Nove Colli - Cesenatico .. - .. Die Reise zum Maratona
bixi.at Rennrad Reisen Radmarathon Ski Tiefschnee Slowride Bixi
63 Pernsteiner Reisen: Startseite Pernsteiner GmbH Pernsteiner
4131
Kirchberg ob der Donau
Pernsteiner Reisen Reisebüro Reiseberater Reiseführer ... Reisefotos Fahrpläne Neu aktuelle Reisen NEU! Musical Mary Poppins im Ronacher Theater Samstag . Dezember
pernsteiner-reisen.at Pernsteiner Reisen Reisebüro Busreisen Tagesreisen
64 AusserfernReisen Bernhard Holaschke Reisen

Ausserfern Reisen Reisebüro in Ehrwald Tirol Bernhard Holaschke ... Freitag .. Start Ausserfern Reisen - Bernhard Holaschke Home News Kontakt Bilder Login
ausserfern-reisen.at Reisen Urlaub Winter Sommer
65 Ichreise.at Die Website Weekend

Die Website rund um das Thema Reisen Urlaub in Österreich ReiseNews uvm.! ... Wir unternehmen je . Einwohnern die meisten Reisen darunter auch Fernreisen und geben mit die höchsten
ichreise.at Weekend Österreich Navigator ReiseNews
66 Wien Reise Kurzreise

Die Reisen nach Wien werden immer in Erinnerung bleiben denn nach einem Besuch ... WWW.REISEN-WIEN.AT Infos und Tipps Reisen Wien Sehenswürdigkeiten Alltagskultur Infrastruktur
reisen-wien.at Kurzreise Wien Wien Kurzreisen Wien Reisen
67 Mayerhofer Reisen Home Mayerhofer

Mayerhofer Reisen Reisebüro Reisebusse Taxi Personenbeförderung ... . >> www.europaeische Allgemeine Reisebedingungen Für unsere Reisen gelten die Allgemeinen Reisebedingungen (ARB
mayerhofer-reisen.at Mayerhofer Reisen Mayerhofer Reisen Hubert
68 Alaska reisen alaskatravel
4664
Laakirchen
Willkommen bei ALASKA REISEN erleben Sie mit uns unvergessliche Reiseeindrücke ... alaska reisen Direkt zum Seiteninhalt Hauptmenü Homepage PROGRAMM FOTOGALERIE Album Album
alaska-reisen.at Alaskatravel Alaska Travel Alaskatravel Alaskareisen
69 Reise Stornoversicherung Reise
30938
Burgwedel
Reise Stornoversicherung Die Reiseversicherung für Österreich mit unserem Vergleichsrechner finden Sie schnell und ... Sie? Vergleichsrechner Reise - Stornoversicherung Vergleich Reise Stornoversicherung für Reisende aus Österreich
reisestornoversicherung.at Reise Stornoversicherung Reiseversicherung
70 Aydin Reisen Startseite Reisebüro
6890
Lustenau
Aydin Reisen Reisebüro in Lustenau/Vorarlberg. Tel. 05577 89981 ... bei Aydin Reisen! Wir freuen uns Sie über aktuelle Reiseangebote informieren zu dürfen. Unser Personal steht
aydinreisen.at Reisebüro Türkei Istanbul Reisen
71 Die schönsten Reisen zu Urlaub
1180
W i e n
Die besten Anbieter für Ihre Reise vergleichen Sie die Preise es lohnt sich! ... Die schönsten Reisen zu besten Preisen! Flüge Die Flughhäfen der Welt - die günstigsten Flüge
online-reiseportal.at Urlaub Reisen Flüge Hotels
72 M.e.i.e.r Reisen Erleben Urlaubsreisen tür

Verreisen Sie mit M.e.i.e.r Reisen Türkeireisen zu günstigen Preisen. Jetzt zuschlagen und in der ... HOME TOP Angebote Dubai Infos zur Reise Termine Preise Türkei Termine Preise Infos zur Reise
meier-urlaubsreisen.at Urlaubsreisen Türkei Meier Reisen
73 ORP.at Online Reise Billiger

Billiger Reisen günstiger fliegen Last Minute Angebote und Mietwagen Preisvergleich. Das alles finden ... www.ORP Online Reise Portal Hotelsuche Mietwagen Last-Minute Ski Snwoboard
orp.at Billiger Reisen Günstiger Fliegen
74 Freund Reisen Mayrhofen Zillertal Freund

Freund Reisen Reisefreund das Reisebüro in Tirol ... Freund Reisen Mayrhofen Zillertal reisefreund Reisebuero online buchen Last Minute
freundreisen.at Freund Reisen Reisefreund Das Reisebüro In Tirol
75 Türkei Reise Urlaub ÖGER TOURS GmbH Türkei
20097
Hamburg
Ihr Reiseanbieter für Türkei Urlaub Reisen Städtereisen und Hotels. Buchen Sie "günstige" Reiseangebote ... Preishits Reisen unter - ? Hoteltipp Türkei Toggle submenu Aktivurlaub Toggle submenu Ausflüge
oeger.at Türkei Reisen Türkeireisen Türkei Reisen Türkei Urlaub Türkeireisen
76 Vatkov Reisen Vatkov Vatkov

??????????? ????????????? ???????? VATKOV REISEN GmbH ?????????? ??????? ???????? ????????? ? ??????? ??????????? ?????????? ... No images ??????? ???????? ????????? ????????? ??????? VATKOV REISEN GmbH +
vatkovreisen.at Vatkov Reisen ????????????? ???????? ???????????
77 Schröfelbauer reisen Schröfelbauer
3242
Texing
Ich lege großen Wert auf Qualität das heißt bei allen unseren Reisen sind genug ... Reiseecke in Gaming Schröfelbauer Reisen Gaming Markt Gaming Telefon texing
schroefelbauer-reisen.at Schröfelbauer; Schroefelbauer; Reisen; Texingtaler Taxi; Texing; Texingtal; Taxi
78 TAXI HEIDIS REISEN HAVELKA Taxi

Mit Taxi Heidis Reisen reisen Sie bequemer von A nach B. ... HOME FUHRPARK KRANKENTRANSPORT KONTAKT > CHEFSACHE > CATS DOGS TAXI HEIDIS REISEN - die feinere
heidis-reisen.at Taxi Tranfser Flughafentaxi Jugendtaxi Businessfahrzeug Krankentransport Kinderg
79 Busch Pedit Reisen Busreisen

Busreisen Reisen Bus Busch Pedit Mietbusse BusCharter ... BUSUNTERNEHMEN mit sehr dynamischer Entwicklung und haben unsere Tätigkeit unter das Motto REISEN MIT SERVICE
reisenmitservice.at Busreisen Reisen Busunternehmen Innsbruck
80 MusicCorn WorkshopReisen 2014 Corn GmbH Workshop
4400
Steyr
"MusicCorn Reisen" ist ein Angebot des Musikhauses MusicCorn. Wir bieten WorkshopReisenGesamtpakete: Anreise Unterkunft ... Musik-Workshop-Reisen Reisen Kontakt ARB Workshop-Reise Gitarre .. - .
reiseverfuehrer.at Workshop; Reise; Reisen; Urlaub; Workshop; Kurs; Seminar; Musik
81 SportivReisen vereint Urlaub mit Sportreisen
2511
Pfaffstätten
SportivReisen vereint Urlaub mit Fitness. ... Das Team FSC Sport-Shop Kontakt Sportiv-Reisen vereint Urlaub mit Fitness. Sportivreisen intern
sportivreisen.at Sportreisen Sport Reisen Afterwork Training
82 Hammertinger Reisen .:. Home Reisen
4873
Frankenburg am Hausruck
Hammertinger Reisen in Frankenburg. Ihr Spezialist für Reisen Kurreisen Wallfahrten Badefahrten ... Reisen Tagesfahrten Adventsfahrten Wellnessreisen Musikfahrten Flugreisen Kreuzfahrten Wallfahrten
hammertinger.at Reisen Kurreisen Wallfahrten Badefahrten
83 MairReisen Wattens Willkommen Mair Reisen GmbH Mair
6112
Wattens
MairReisen Wattens Ihr Partner wenn Sie ein Busunternehmen mit viel Komfort suchen. Vom ... -Race in Schladming Firmenevents oder Vereinsausflüge - mit Mair-Reisen ist eine entspannte
mair-reisen.at Mair Reisen Bus Reise
84 Egons Reise Egons
6020
Innsbruck
Egons verrückte Reise Ein Hörbuch mit Liedern und Dialogen von Simon Kräutler Michael Schefts ... Egons verrückte Reise Egons Familie Facebook Downloads Kontakt Kontakt Egons verrückte
egons-reise.at Egons Reise Egon´s Reise Egon´s Verrückte
85 Reisen nach Südamerika INTI Tours e.K. Reisen
73326
Deggingen
INIT Tours ist ein spezialisierter Reiseveranstalter für nachhaltige Reisen nach Südamerika Mittelamerika und in ... Eisenbahnromantik Studienreisen ? INTI Tours > Reisen nach Südamerika Mittelamerika und in die Karibik Herzlich
inti-tours.at Reisen Nach Südamerika Reisen Nach Mittelamerika
86 Www.sabtours.at  sabtours Reisen sabtours

sabtours bietet Busreisen Flugreisen Kreuzfahrten Pauschalreisen und vieles mehr. In unseren 18 ... zum Reiseblog erweiterte Suche sab-reisen Busreisen Flugreisen Städtereisen Fernreisen Badereisen
opernundreisen.at Sabtours Reisen Sabreisen Sabcruises Sabbusse
87 INTER VEGA REISEN I.V.R Reisebüro GmbH Intervegareisen
1010
Wien
Intervegareisen Ihr zuverlässiger Partner für jede Reise dieser Welt! ... Sofia City Break Rundreise Bulgarien Tage Sommelier Trip Matura Reise nach Bulgarien
intervega.at Intervegareisen INTERVEGAREISEN Inter Vega
88 Www.sabtours.at  sabtours Reisen sabtours

sabtours bietet Busreisen Flugreisen Kreuzfahrten Pauschalreisen und vieles mehr. In unseren 18 ... erweiterte Suche sab-reisen Busreisen Flugreisen Städtereisen Fernreisen Badereisen Vital
innviertler-reisen.at Sabtours Reisen Sabreisen Sabcruises Sabbusse
89 Was ist .reise? dotreise-registry GmbH
21227
Bendestorf
.reise die neue TopLevelDomain der Reisewirtschaft ... Über .reise Was ist .reise? Vision Vorteile von .reise Google wird .reise-Domains lieben Grusswort
dotreise.at
90 Reisen24Online | günstig reisen günstig
8383
Sankt Martin an der Raab
Reisesuchmaschine günstig Reisen | Preisvergleich und Angebote für Flüge Hotels und Ferienwohnungen ... News REISEGEWINNSPIEL REISE-NEWSLETTER Ausgezeichnet als "BestNewsletter"! Aktuelle Reiseangebote
reisen24online.at Günstig Reisen Billige Flüge Billige Hotels
91 Tromayer Reisen Bruchmann Alois e.U. Stefan
8504
Preding
Stefan Tromayer Reisen Mönichwald Bus Taxi unternehmen für Eventreisen Ausflüge Krankentransporte ... mit Ihnen! Steigen Sie ein und fahren Sie mit uns. Â Gelo Systems Tromayer Reisen officetromayer-reisen
tromayer-reisen.at Stefan Tromayer Tromayer Stefan Stefan
92 Www.sabtours.at  sabtours Reisen sabtours

sabtours bietet Busreisen Flugreisen Kreuzfahrten Pauschalreisen und vieles mehr. In unseren 18 ... Rufen Sie uns an für persönliche Beratung! Mo bis Sa ? sab-reisen Reisehits
sab-cruises.at Sabtours Reisen Sabreisen Sabcruises Sabbusse
93 Travelsmile.de Lastminute Reisen Lastminute

Hier finden Sie Reise Angebote mit Tiefstpreisgarantie! ... Städtereisen Hotels . Wellness Wellness Reisen . The s.mile Family Reiseführer . Info-Service Auswertiges-Amt
travelsmile.at Lastminute Reiseangebote LastMinute Billigreise
94 Siebler Reisen Der siebler
9781
Oberdrauburg
Siebler Reisen ? Der Drautaler | Der Ansprechpartner für Ihre Reise Busreisen Taxi ... Siebler Reisen - Der Drautaler Reisebüro Busreisen Taxi Mietwagen Siebler Reisen Home
derdrautaler.at Siebler Reisen Der Drautaler Irschen
95 Vietnam reisen individuel geführt ho

vietnam reisen individuel geführt mekong delta hanoi halon bay ... auf meiner Seite und viel Spass beim Anschauen und Auswählen +++ Wer sich auf die Reise nach Vietnam begibt
reisen-vietnam.at Ho Chi Minh Hanoi Halong Bay Mui Ne
96 Schenker Reisen Schenker
6020
Innsbruck
Schenker Reisen Ihr Reisebüro für Ihren perfekten Urlaub reibungslose Geschäftsreise aufregende Gruppenreise ...  Schenker Reisen Startseite Kontakt Newsletter Unsere Website ist nicht für
travelmanagement.at Schenker Reisebüro Innsbruck Urlaub
97 GloboReisen Erlebnisreisen Indonesien Kleines

Kleines Reisebüro Reisen nach Indonesien Reisen nach Bali Reisen nach Lomok Erlebnisreisen ... Sie den Vorteil dass ich selbst gerne reise!
globoreisen.at Kleines Reisebüro Gruppenreise Chile Chilereise
98 URLAUB IN BESTEN HÄNDEN Schauinsland-Reisen GmbH Schauinsland
47051
Duisburg
Lastminute Pauschal nur Hotel oder nur Flug Angebote von SchauinslandReisen ... Teneriffa Hotel Iberostar Anthelia Schauinsland-Reisen GmbH Startseite Service Sitemap Anfahrt
slr-info.at Schauinsland Reisen Urlaub Angebote Hotel Flug Pauschal Lastminute
99 Eine Reise zu sich Angelika

Erleben Sie mit den Klangschalen von Angelika Nagele in Klagenfurt eine Reise zu sich selbst ... Schenken sie sich und Ihren Lieben eine besondere Reise zu sich! Angelika Nagele Klangschalen
reisezusich.at Angelika Nagele Klangschalen Tiefenentspannung Schwingung Klagenfurt Reise Zus
100 SILMAR Reisen Start/home Sylvia

SILMAR Reisen ist Ihr kompetenter Reisebüro unweit von Wien! Bei Fragen oder Anregungen nehmen ... Reisen Journeys ..auf zu neuen Horizonten! ..discover new horizones! Reisen Journeys ..auf zu neuen
silmar.at Sylvia Gabauer Silmar Reisen Reisebüro Silmar
101 Canaren Reisebüro Fischer Reisen canaren

Fischer Touristik Canaren Reisen ... Fischer Touristik - Canaren - Kanaren Startseite Kanaren Reisen Hotel Kreuzfahrten Ferienhaus
kanaren-reisen.at Canaren Canarischen Inseln Reisen Pauschalreisen Langzeiturlaub Canarische Insel
102 Orientierungen.at Über das Reisen Asien

Über das Reisen und Entdecken. Reisegeschichten Wolfgang Emerich aus Wien ... du auf meiner Seite gelandet bist. Ich publiziere hier Erlebnisse und Erfahrungen meiner Reisen nach Thailand
orientierungen.at Asien Südostasien Indien Thailand
103 Reise Reisen reise

Reise Reisen Lastminute Lastminutereisen zu TOP Preisen Urlaub pur mit Bestpreisgarantie ... Reise - Reisen - Lastminute - Lastminutereisen zu TOP Preisen - Urlaub pur mit Bestpreisgarantie
reise-24.at Reise Reisen Lastminute Last Minute Lastminute Reisen Urlaub
104 ReisePreisvergleich Terracus Last

Aktuelle Urlaubsangebote Lastminute more Flug Hotel Mietwagen und preiswerte Reisen ... am um Urlaubsziel Dauer Erwachsene Kinder vom bis Reise- Lastminute-Angebote Rückruf-Service
terracus.at Last Minute Lastminute Reisen Urlaub
105 RATZ REISEN Reisen

Ratz Reisen ist Ihr verläßlicher Partner für BusReisen und Ausflugsfahrten. Auch Taxifahrten und Krankentransporte gehören ... Sie sicher ans Ziel INFO Das aktuelle Ausflugsprogramm finden Sie im Menü Angebote Ratz Reisen Taxi
ratz-taxi.at Reisen Ratz Ausflugsfahrten Busreisen
106 Reisen | Reisezeit ist Unterkunft
2514
Traiskirchen
Unterkunft Anreise Kreuzfahrten Singlereisen Reisen mit Kindern Fastenreisen Rucksackreisen ... Benutzerdefinierte Suche Reise Unterkunft Anreise Kreuzfahrten Singlereisen Reisen mit Kindern
reisebranche.at Unterkunft Anreise Kreuzfahrten Singlereisen
107 Urlaub Reisen direkt urlaub
1190
Wien
|? TUI.at Urlaub amp; Reisen mit Qualität bei TUI buchen ? Direkt beim ... Urlaub Reisen direkt beim Reiseveranstalter buchen ? TUI TUI verwendet Cookies
tui.at Urlaub Reisen Reiseveranstalter TUI
108 Billig Reisen buchen Last Billig

Die besten Reiseschnäppchen con Reisebox.de Last Minute reisen und billig Reisen und Pauschalreisen sowie Flugreisen ... Reisen online buchen Lastminute Reisen Pauschalreisn Reisen buchen Urlaub Flugreisen Last Minute Reisen
reisebox.at Billig Reisen Last Minute Reisen Billig
109 123start auf ins Radtouren

123start auf ins ReiseAbenteuer Reiseberichte unserer Radtouren Abenteuerreisen und Expeditionen Karin ... - Budapest . . - . . Abenteuer-Reisen (Karin und Clemens ohne Rad
123start.at Radtouren Abenteuerreisen Expeditionen Reisen Karin Und Clemens Scheidhammer
110 Urlaub und Meer flüge

Buchen Sie Ihren Urlaub oder Ihre Reise günstig in Ihrem Online Reisebüro. Alle Flüge und ... Service Buchungsinformationen Home Flug Hotel Last Minute Pauschal- reisen Mietwagen Reise
checkmytrip.at Flüge Billigflieger Hotels Urlaub
111 Asien Reisen Afrika reisen

Europa Reisen Reisen weltweit Reisepartnerbörse Reisen Südamerika Asien USA ... Startseite Reiseziele - Reisen Reisearten Ferienhaus Hotel Flug Transfer Mietwagen Camper Bahn
reisekontakte.at Reisen Erlebnisreisen Rundreisen Südamerika
112 ::Franzl Reisen und Taxi Franzl
6314
Wildschönau
Franzl Reisen Ihr Reisepartner und Taxibetrieb in Niederau Wildschönau ... Home Busreisen Reisebüro Taxi-Kleinbus Kontakt Pension Herzlich willkommen bei Franzl Reisen
franzl-reisen.at Franzl Reisen Ausflugsreisen Tagesreisen Reisebüro
113 ITS BILLA REISEN Jung von Matt/Neckar GmbH Flüge
70190
Stuttgart
Willkommen bei ITS BILLA REISEN Lastminute Reisen sofort online buchen und in wenigen Tagen ... BILLA REISEN Startseite ITS BILLA REISEN Startseite Meine Merkliste Einen Moment bitte! Verfügbare
itsbilla.at Flüge Online Buchen Reisen Online Buchen
114 Kories Reisen Urlaub... Boutique
73614
Schorndorf
Sie suchen etwas Besonderes mit dem gewissen Etwas? Dann sind Sie bei uns richtig ... bei Kories Reisen. Sie suchen etwas Besonderes mit dem gewissen Etwas? Dann sind Sie bei uns richtig
boutique-hotel.at Boutique BoutiqueReisen Reise Reisen
115 Startseite Gansberger Reisen Impressum Gansberger Reisen GmbH Gansberger
3702
Niederrußbach
Gansberger Reisen Niederrussbach Busreisen Busreise Flugreisen Flugreise Schiffsreise ... Herbst - Winter Gutschein anfordern Gansberger Reisen GmbH I Horner A- Niederrußbach I Tel
gansberger-reisen.at Gansberger Reisen Niederrussbach Busreisen Busreise
116 Last Minute Reisen last

Urlaub im TÜV geprüften ReiseVergleich von Travel24 finden +++ Hier beim Spezialist Reisen Last ... www.travel.fr Ihr Partner für Last Minute Reisen - Last Minute Urlaub buchen - travel.at Last Minute
travel24.at Last Minute Reisen Last Minute Last
117 Urlaub mit Schauinsland schauinsland-reisen gmbh Reisen
47051
Duisburg
Urlaub mit SchauinslandReisen Lastminute Pauschal nur Hotel oder Flug Angebote ... . Mit großem Erfolg Kundenchampion Sri Lanka Clubhotel Dolphin Schauinsland-Reisen GmbH Startseite
joy-hotels.at Reisen Urlaub Schauinsland Angebote Hotel Flug Pauschal Lastminute
118 NEWFOODLAND KULINARISCHE REISEN:  Jürgens & Bjaoui GbR Kulinarikreisen
10437
Berlin
Newfoodland bringt Menschen mit Passion für gutes Essen erlebnisreiches Reisen und Kultur zu den ... START DARUM REISEN GENUSS KONTAKT Venedig Kulinarischer Segeltörn Wein aus der Lagune private
newfoodland.at Kulinarikreisen Kulinarik Kulturreisen Kulinarische Reisen
119 TopTours Ihr Reisebüro Top Tours GmbH Toptours
2340
Mödling
Toptours Ihr Reisebüro für spezielle Reisen. Planen Sie mit uns Ihre ins Weltall ... Incentives Virgin Galactic Top Tours Reisen in Europa Lernen Sie Europa kennen. Städtetrips Badeurlaub
toptours.at Toptours Stingl Reisebüro Reise
120 ReiseAktuell Das österreichische Reisemagazin CB-Verlags GesmbH Kulinarik
1060
Wien
REISEaktuell eines der attraktivsten Reisemagazine aus Österreich informiert mit Top News zum Thema ... Travel Lifestyle Luxus Gourmet Menü Top News On Tour Reisen Hotels Hideaways Österreich
urlaubsplanung.at Kulinarik Gourmet Haubenküche Sterneküche
121 Fremdsprachenreisen Sprachenreise Fremdsprachenreis

Glas Busreisen der Spezialist fürFremdsprachenreisen Sprachenreise Sprachen lernen Sprach Busreisen Sprachen ...  Fremdsprachenreisen Sprachenreise Sprachen lernen Sprach Busreisen Sprachen und Reisen
fremdsprachreisen.at Fremdsprachenreisen Sprachenreise Sprachen Lernen Sprach
122 Urlaub Suchmaschine Reiseangebote billig

Preisvergleich für Reisen und Urlaub vom billig Urlaub bis zum Luxusurlaub jetzt online ... Flug Eigene Anreise Ferienhaus Städtereisen Mietwagen Blog Reiseangebote Reisen bis Euro Reisen
urlaub-suchmaschine.at Billig Urlaub Reisesuchmaschine Reisepreisvergleich Lastminute
123 Günstige Last Minute Reisen Last

Günstige Last Minute Reisen buchen ? Sie am besten bei uns! Tolle Angebote für günstige ... Reisen GmbH Alle Rechte vorbehalten. Kontakt Newsletter AGB von billigweg Veranstalter AGB Datenschutz
billigweg.at Last Minute Reisen Günstig Reisen Urlaub
124 Autohaus Reiser Autohaus Reiser - ABR Automobilvertriebs GmbH VW
5204
Strasswalchen
Autohaus Reiser Ihr Spezialist für VW Audi Skoda Seat und Gebrauchtwagen ... BILDERGALERIE .. Autohaus Reiser ... wie alles begann ... Interessente Bilder von "damals" und "heute
auto-sesser.at VW Audi Skoda Seat
125 Www.thermenlinie.at J A www.thermenlinie.

www.thermenlinie.at Busreisen JANDRISEVITS Reisen GesmbH Dt. Tschantschendorf ... www.thermenlinie Aktuelle Reisen Kontakt Downloads Plan als PDF Plan als XLS Besucher REISEN
thermenlinie.at Www.thermenlinie.at Busreisen JANDRISEVITS Reisen GesmbH
126 China Reisen und China China
48165
Münster
Als führender China Spezialist organisieren wir China Reisen und China Rundreisen. Wir bieten China Gruppenreisen ... Stopover China Reisen China Rundreisen Garantierte China Reisen mit Rabatten und zum Tiefpreis
chinareise.at China Reisen China Rundreisen China Individualreisen
127 Kolumbien. Reisen. Individual. Individuelle. kolumbien

Kolumbien Reisen ist ein Tourveranstalter der individuelle Erlebnisreisen und Individualtourismus im faszinierendsten Land Lateinamerikas ... infokolumbienreisen.co + Skype colombiaviajes Kolumbien Reisen â
kolumbienreisen.at Kolumbien Reisen Individualreisen Individualtourismus
128 Murtal Express Oldtimer Oldtimer

Auf Oldtimer Reisen finden Sie Oldtimer Bus Reisen Hochzeitsfahrten und Oldtimer Fahrten zu besonderen ... Navigation überspringen Oldtimer Reisen Reisebus Oldtimer für Ihr Fest OldtimerEvents Bilder Saurer
oldtimer-reisen.at Oldtimer Lastkraftwagen Diesel Max Max
129 Metz SaharaReisen :: Tunesien Metz

SaharaReisen Saharareisen Geführte Erlebnisreisen mit dem Geländewagen oder zu Fuß Tunesien erleben. ... WILLKOMMEN BEI SAHARA-REISEN ... der privaten website der Familie Metz
sahara-reisen.at Metz Sahara Saharareisen SaharaReisen
130 PRIMA REISEN: Home Italien

PRIMA REISEN ? Ihr Spezialist für Finnland Irland Italien Jersey Norwegen ... Gruppenabteilung Bewerbung Buchungszentrale PRIMA REISEN Presse PRIMA REISEN Finnland -Winterzauber
sengwein.at Italien Ferienwohnungen In Italien Appartements
131 Startseite Holiday Reisen Reisebüro
2
Personen.
Reisen nach Wunsch Ihr erfahrener Reiseveranstalter und Reisebüro in Linz organisiert Pauschalreisen und ... Willkommen bei Holiday Reisen Holiday Reisen ist ein österreichisches Unternehmen und hat sich auf Fernreisen
holidayreisen.at Reisebüro Reiseveranstalter Pauschalurlaub Individualreise
132 Die große ReiseUmfrage rund Österreich GmbH Reise
1100
Wien
ReiseCommunity! Bestimmen Sie die Trends Produkte und Dienstleistungen der Zukunft. Einfach Umfrage beantworten und ... Reise-Umfrage Startseite Umfrage Gewinne Gewinner Mehr Umfragen Teilnahmebedingungen Die große
reise-umfrage.at Reise Gewinnspiel Gewinn Gewinnen
133 Hotelbewertungen Urlaub Hotelbewertungen

HolidayranKing.de Ihr Portal für Hotelbewertungen. Erst vergleichen dann buchen und sparen. Hier buchen Sie ... Hotelbewertung Urlaubsbilder Pauschalreisen All inklusive Reisen bis - Euro Wellness Clubreisen
holiday-ranking.at Hotelbewertungen Hotelbewertung Hotels Hotel
134 LuxuryTravel.at die ReiseInformationsplattform LuxuryTravel

LuxuryTravel.at die ReiseInformationsplattform für anspruchsvolle Genießer ... Vielen Dank unseren Business Partnern Herzlich Willkommen bei LuxuryTravel die Reise
luxurytravel.at LuxuryTravel Strahner Mag. Karin Strahner Ambassador Reisen Travel
135 7CS SEVEN SEAS 7CS.at

Urlaub Last Minute Reisen Restplatz Reisen Kreuzfahrten und Städtereisen mit Hotelbewertungen und ...  CS SEVEN SEAS - Urlaub Last Minute Reisen günstiger buchen CS
7cs.at 7CS.at Seven Seas 7CS Reisen
136 Brandstetter Reisen

Brandstetter Reisen ... Reisen Tagesfahrten Fuhrpark Mietwagen/Airport Bussharing Galerien Unternehmen Anfragen Suche
rb-reisen.at
137 EbnerReisen Aktuelles Reiseprogramm ebner

Ebner Reisen Busreisen Aktuelles Reiseprogramm
ebnerreisen.at Ebner Reisen Busreisen Reiseprogramm
138 Home Raiffeisen Reisen Reisen

RaiffeisenReisen persönlich: Über uns Raiffeisen Family Raiffeisen Aktiv Reiseziele Weltweit Themenreisen ... Raiffeisen Reisen Logo Über uns Leitbild Vision Geschäftsleitung Team Standorte Filiale Wollzeile
raiffeisen-reisen.at Reisen Weltweit Über Uns Family
139 Pensionisten Reisen Reisen Pensionisten

Pensionisten Reisen Reisen für Rentner Busreisen Pensionisten und Renter busreisen für alte ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage
pensionisten-reisen.at Pensionisten Reisen Reisen Für Rentner Busreisen
140 Www.koosz.at Malerei Reisen www.koosz.at

www.koosz.at Malerei und Reisen und Texte Reisen journaille Lebenslauf k.u.k. ... einmal mit Rosinante...einmal ohne Sancho... Natürlich versuche ich auch meine Reisen zu dokumentieren - Reisen ans
koosz.at Www.koosz.at Malerei Und Reisen Und Texte
141 Individuelle Kanada Reise mit Kanada
29549
Bad Bevensen
Buchen Sie Ihre KanadaReise direkt beim KanadaSpezialReiseveranstalter. Einfach online mit kompetenter Beratung und professionellem Service. ... Kanada Reisen Wohnmobil-Reisen Wohnmobil-Preisvergleich Alle Vermieter Modelle
kanada-reise.at Kanada Reise Buchen Reiseveranstalter
142 Wellcomeonline. Das Internet Wellcome

Wellcomeonline ist das Internet Reise und GourmetMagazin für die schönen Seiten des Lebens. ... Toulouse-Lautrec Der Weg in die Moderne ?Eine Reise durch Marrakech? in der Tiroler Zugspitz Arena
wellcome-online.at Wellcome Online Magazin Reisen
143 Urlaub Last minute Reisen Urlaub

Urlaub Reisen Last Minute: Günstige Reisen in schöne Hotels garantieren einen unvergesslichen Urlaub. ... Sie sind hier Urlaub Reisen Last Minute Urlaub mit HolidayTrex - Sun up your life! Buchen
holidaytrex.at Urlaub Last Minute Reisen Pauschalreisen Kurzurlaub Busfahrt Hotel
144 Rolarika auf Reisen Rolarika

Rolarika auf Reisen ... deactivated. Successful Error Rolarika auf Reisen All albums Login Herzlich Willkommen auf unserer
rolarika.at Rolarika
145 Travelport.at Günstige Reisen travelport

travelport.at Billige Flüge Hotels Mietwagen sowie billige Reiseangebote für Pauschalreisen und LastminuteReisen ... travelport - Reisen travelport Service Center + - dt. Festnetz Startseite
travelport.at Travelport Österreich Urlaub Ferienwohnung Ferienhaus
146 Schmidhofer Reisen Kulturreisen Schmidhofer

Schmidhofer Reisen ist Ihr Spezialist für Kultur und Bildungsfahrten Wander oder Städtereisen. Wir bieten ... -reisen Startseite Über uns Chronik Unser Team Fuhrpark Aktuelle Reisen Linienverkehr Bilder Bilder
schmidhofer-reisen.at Schmidhofer Reisen Schmidhofer Reisen Innervillgraten
147 Island ProTravel Ihr Island

Vielfältige Angebote für Ihren Urlaub in Island! Island Reisen mit dem Reiseveranstalter für Gruppenreisen ... für alle die individuell reisen wollen. Grönland Erleben Die größte Insel der Welt lädt dazu ein Tradition und Kultur
islandwohnmobile.at Island Urlaub Reise Island Reisen Reiseveranstalter Island Protravel
148 BELMONDO REISEN reisebüro

Belmondo Reisen Kufstein Österreich
belmondoreisen.at Reisebüro Kufstein Reise Türk
149 Reisebetreuung Reisebetreuung für Reisebetreuung

Reisebetreuung Reisebetreuung für alte Menschen Reisebetreuung für Behinderte Pensionisten Reisen Reisen ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage
reisebetreuung.at Reisebetreuung Reisebetreuung Für Alte Menschen Reisebetreuung
150 Gullivers Reisen

Gullivers Reisen ...  Gullivers Reisen Kontakt Wien Wien Wallnerstraße Palais Esterhazy + - -
gullivers.at
151 Weltjugendtag 2008 in Sydney Weltjugendtag

AkzenteReisen bietet Euch Gruppenreisen zum XXIII. Weltjugendtag in Sydney Australien ... Teilnahme Reise mit Flug Angebot Angebot Angebot Reise ohne Flug Angebot Angebot Nur Flug
worldyouthday.at Weltjugendtag 2008 Sydney Australien
152 Gullivers Reisen

Gullivers Reisen ... officegulliversreisen Papageno Touristik - Die Kunst des Reisens … Pottendorferstraße
reise-outlet.at
153 Losfliegen.AT die ReisePreisvergleichsSuchmaschine losfliegen

Losfliegen.AT bietet Ihnen aktuelle Urlaubsangebote Lastminute More Flüge hotels Mietwagen ... am um Urlaubsziel Dauer Erwachsene Kinder vom bis Reise- Lastminute-Angebote Rückruf-Service
losfliegen.at Losfliegen Schnell Losfliegen Günstige Flüge
154 Home Nefer Reisen Nefer Reisen GmbH Ägypten
30161
Hannover
Nefer Reisen bietet Ihnen einmalige Entdeckungsreisen nach Ägypten und Rundreisen in den Orient. Unsere Programme ... einer faszinierenden Kultur Dubai und Oman – die märchenhafte Welt Arabiens Nefer Reisen bietet Ihnen einmalige
aegyptenspezialist.at Ägypten Kulturreisen Ägypten Studienreisen Ägypten Erlebnisreisen Ägypten Nefer
155 Aupair Reisen und Ausflüge Aupair

AupairReisen für Aupairs und Studenten: Stadtführungen Reisen und Ausflüge nach Wien Rom ... ein besseres Kennenlernen des Gastlandes und seiner Umgebung. Als Reise- Ausflugs- und Stadtführung -Agentur
aupair-reisen.at Aupair Aupairs Führung Österreich
156 Namibia Reisen Selbstfahrreisen Selbstfahrer Namibia

Individuelle Selbstfahrreise Namibia Reise für Selbstfahrer mit dem füe Sie persönlich zusammengestellten TourenLogbuch ... auch Sie von über Jahren Reise-Erfahrung sowie leistungsstarken Partnern vor Ort! Unser Spezialgebiet
namibiareisen.at Namibia Reise Selbstfahrreise Individuell
157 Reisen Tickets Events :: Urlaub

Reisen Urlaub Sprachreisen Hotelbewertung Freizeit LastMinute Schnäppchen und Pauschalreisen ... -Angebote Flüge Hotels Mietwagen Sportreisen Wellnessreisen Ferienhäuser Tickets Versicherung Reise-Magazin
travelbob.at Urlaub Reise Reisen Ferien
158 :: Anspruchsvoll reisen mit  wishlinereisen.de | Urlaub wishline

Hochwertige Reisen von ausgewählten Reiseveranstaltern: Abenteuerreisen Aktivurlaub Erlebnisreisen Expeditionen Gourmetreisen ... Urlaub Ferien Reisen - Reiseangebote für Reiseziele weltweit! Die Website ist aktuell in Ã
wishline-reisen.at Wishline Wishline Reisen Wishlinereisen Reisen Reise Urlaub Ferien
159 Sritours | Sri Lanka sri

Private Rundreisen Kleingruppenreisen und maßgeschneiderter Badeurlaub für jedes Budget. Urlaub Reisen auf Sri ... -tours bietet Ihnen qualitativ hochwertige maßgeschneiderte Sri Lanka Reisen für jedes Budget
sri-tours.at Sri Lanka Reise Sri Lanka Reisen
160 Mauritius Urlaub Hotels Heiraten Mauritius

Mauritius Urlaub | Angebote von L'Evasion Tours Ihrem Mauritius Reiseveranstalter Mauritius Reisen Urlaub Hotels ... Mauritius Urlaub Reisen Hotels Heiraten Golfreisen Kreuzfahrten Mauritius Urlaub Golfreisen
urlaub-mauritius.at Mauritius Urlaub Reisen Urlaub
161 Ayurveda for health Ayurveda

Entdecken Sie mit uns als Spezialist für Ayurveda Reisen inkl. Yoga die besten Ayurveda Resorts ... Home Die besten Destinationen Kombinationen Ayurveda Reisen Aktuelle Angebote Ayurveda
ayurveda4health.at Ayurveda Reisen Inkl. Yoga
162 Yoga Retreats Reisen Yoga

Yoga Retreats Reisen. Der Ratgeber für Regionale Yogareisen in Europa Asien und Afrika für ... www.retreat Yoga Retreats Reisen Kontakt Ayurveda und Yoga am Meer in Südindien .
retreat.at Yoga Retreats Reisen YogaReisen YogaUrlaub
163 Pölzl Reisen Reisebüro Pölzl
3950
Gmünd
Pölzl Reisen Reisebüro in Gmünd. Busreisen Flugreisen Städtereisen Thermenaufenthalte Theaterfahrten ... hat sie nicht die Reisesehnsucht und den Wunsch die schönsten Regionen der Welt auf einer sorgenfreien Reise kennen zu lernen
poelzl-reisen.at Pölzl Poelzl Reisen Reisebüro
164 Starte durch mit CONSUL Radsportferien

Erlebnisreiche und unbeschwerte Radsportferien mit Consul Reisen. Erleben Sie Mallorca Andalusien und ausgesuchte Radsportgebiete ... für den Winter! Reinschauen lohnt sich! Consul Reisen Günther Gausch Ges.m.b.H.Co.KG A- Wels Hafergasse E
consul.at Radsportferien Radferien Radfernfahrten Radtouren
165 Lastminutes.at Lastminute Reisen DomainQuadrat Marketing GmbH
1230
Wien
lastminute last minutes reise reisen ... last-minutes Übersicht von Lastminute Reisen Sie können die Domain last-minutes kaufen
last-minutes.at
166 Billigereise.at billigereise DomainQuadrat Marketing GmbH billige
1230
Wien
Links zu billige reisen und billigreisen ... Hinweis Bei diesen Inhalten handelt es sich nicht um das Angebot der Verkehrsbüro Ruefa Reisen
billigereise.at Billige Reise Billigereise Billigreisen Reisen
167 Fuchs Reisen: Fuchs Reisen Busreisen
8230
Hartberg
Fuchs Reisen Ihr BusreisenSpezialist. Busreisen zu Traumpreisen. ... Home Reisen Reisekalender Tagesfahrten Kurzreisen Rundreisen Große Reisen Wandern Wohlfühltage
web.fuchsreisen.at Busreisen Reisebüro Taxi Einzelreisen
168 Flugbörse die günstigste Art flugbörse

Weltweit günstig Reisen. Flüge Hotels Leihwagen Rundreisen ... Bei uns finden Sie ... Reisen - Weltweit! Wir können auf eine Datenbank mit über . verschiedenen Tarifen zugreifen
flugboerse.co.at Flugbörse Flugreisen Flugbüro Weltweit Checkfelix
169 Pension Berggeist sölden tirol pension

pension Berggeist in sölden tirol reisen in tirol österreich m/o Kinder zum sport wandern klettern ... für reisen und klettern ski in sölden tirol reisen pension pension Berggeist in sölden tirol reisen in tirol
berggeist-soelden.at Pension Sölden Tirol Reisen
170 Reisefeeling Toller Urlaub Reisefeeling

Reisefeeling Toller Urlaub Reisegefühle Luxusurlaub Reisen und Busreisen Traumurlaube ...  Reisefeeling Toller Urlaub Reisegefühle Luxusurlaub Reisen und Busreisen Traumurlaube
reisefeeling.at Reisefeeling Toller Urlaub Reisegefühle Luxusurlaub
171 Kerngast Reisen im Vulkanland Kerngast Reisen GmbH Reisen
8092
Mettersdorf a. S.
Ihr Reisepartner im Vulkanland ... Aktuelles Reisen Buchen Fahrzeuge Über Uns Links Kontakt Herzlich Willkommen bei Kerngast Reisen
kurzreisespezialist.at Reisen Fernreisen Kerngast
172 Luxusreisen LuxusReise Luxusreisen

Glas Busreisen der Spezialist für Luxusreisen LuxusReise Luxusreise Luxusbus Luxusbusse ...  Luxusreisen Luxus-Reise Luxusreise Luxusbus Luxusbusse Traumbus Topbus Luxusbusse
luxus-reise.at Luxusreisen LuxusReise Luxusreise Luxusbus
173 SEND James ohne SEND JAMES ist ein Premium-Dienst der KEP AG Koffer
50825
Köln
Reisen Sie zu den schönsten Plätzen in Deutschland Österreich Schweiz Südtirol ... Stets zu Diensten Ihr Reise Gepäck- und Koffer-Service Kontakt Gepäck Zielort Abholung Rückreise
send-james.at Koffer Versenden Gepäck Versenden Gepäck Verschicken
174 UngerReisen BistroBus leistbarer BistroBus

UngerReisen BistroBus leistbarer Luxus und unübertroffener Komfort ... Sie sich für eine UNGER-REISE! Wir freuen uns auf Sie ...
unger-reisen.at BistroBus Bistrobus Reisebüro Individualreisen
175 Pölzl Reisen Busreisen PölzlReisen

PölzlReisen Busreisen Mooskirchen Steiermark Ausflugsfahrten Vereinsfahrten Einkaufsfahrten Badereisen ... Home Drucken A A A Buchungshotline - Aktuelle Reisen Bade- und Einkaufsfahrten
poelzlreisen.at PölzlReisen Busreisen Mooskirchen Steiermark Ausflugsfahrten Vereinsfahrten Eink
176 Last Minute und Reise lami24.de

lami24.de das neue Reiseportal für Ihren Last Minute Urlaub mit vielen Reise ... Kreta ab - Euro Alle Lastminute Reise Angebote Last Minute nur Flugangebote Hin- und Rückflug ab Rom
lami24.at Lami24.de Lastminute Last Minute Pauschalreisen
177 Hofer Reisen Hofer Reisen GmbH & Co KG
4642
Sattledt
Gute Reise gute Preise bei Hofer Reisen. Günstiger Reisen ? Mehr von der Welt ... Merkliste Angebote Hofer Reisen Da bin ich mir sicher. Buchungs-Hotline täglich ?
hofer-reisen.at
178 Philippinen Reisen preiswert und flytocebu

Philippinen mit Fly to Cebu Reisen Individuell und sicher ... Philippinen- Reisen hier klicken
ftc-reisen-hellstern.at Flytocebu Philippinen Cebu
179 Reisebüro Kerschner Reisen Kerschner Reisen GmbH
3250
Wieselburg
Webauftritt des Reisebüro Kerschner Reisen. ... ARB Kontakt Facebook + - wieselburgkerschner Kerschner Reisen
eurotrail.at
180 Estland Urlaub Tallinn Hotels eesti

Reiseinformationen über Estland. Baltikum Reisen und Urlaub Eesti Tallinn und Estonia laden ein ... » Landesinformationen » Städte Regionen » Kultur » Urlaubtipps » Wissenswertes » Reiseberichte » Adressen » Reisen
eesti.at Eesti Estonia Estland Tallinn
181 > Home :: Roadbook.at ::

:: Roadbook.at :: Motorradumbauten und Reisen ... Motorrad - ROADBOOK Alles über meine Reisen und Umbauten Home Motorrad T Bully Reisen Kontakt
roadbook.at :: Roadbook.at :: Michael Wögerer Hubrauerweiterung
182 Last Minute Urlaub Restplatzbörse

Urlaub zum Bestpreis: Last Minute Reisen und Hotels von über 70 Veranstaltern! Flugtickets Last ... und weltbekannte Sehenswürdigkeiten locken viele Urlauber an. ab ? Türkei Last Minute Reisen Antalya Side
restplatzboerse.at Restplatzbörse Urlaub Reisen Last Minute Hotels Flugtickets Reisebüro
183 Www.jenisy.at Abenteuer Reisen Motorrad Motorradabenteuer

Abenteuer mit dem Motorrad Fahrrad eBike! Abenteuer Reisen Leben = das ist für ... Wunderhecke Sichtschutz mal anders.. . Gewächshaus- Update Abenteuer - Reisen - Leben
jenisy.at Motorradabenteuer Motorrad Ebike Abenteuer
184 Segelreisen Segelurlaub Kaya Lodge Touristik GmbH segelreisen
33104
D-Paderborn
Segelreisen online buchen: Segelurlaub Mitsegeln auf Segeltörns Kojencharter Blaue Reise auf Mallorca ... Mallorca Mitsegeln Segelschule Türkei Blaue Reise Alle Ziele Griechenland Kroatien Türkei Hausbootreisen
segelreisen-online.at Segelreisen Segelurlaub Kojencharter Mitsegeln
185 Reise ins Glück Angebot
4784
Schardenberg
Reise ins Glück Pfarrwerfen ... Segelyacht Admiral mieten Reise ins Glück - Urlaub Reise ins Glück - Auszeit Reise ins Glück - Erlebnisdate
reise-ins-glueck.at Angebot Kompetenz Beratung
186 Clickundflieg.com Last Minute Click und Flieg OHG Lastminute
40474
Düsseldorf
Günstige Last Minute Reisen und Reiseangebote bequem online buchen mit Preisgarantie von click und ... Top Beratung Sicher buchen Hotelbewertungen Reisebüro Click und Flieg Unsere Reise-Experten beraten
clickundflieg.at Lastminute Reisen Pauschalreisen Urlaub
187 Reisebüro24.at Lastminute Ferien Reisebüro

Reisebüro24.at Lastminute Ferien Reisen günstige Reiseangebote im Internet Reisebüro online buchen! Arrangement ... Reisebüro.at Lastminute Ferien Reisen Günstige Reiseangebote kannst Du hier im Internet
xn--reisebro24-feb.at Reisebüro Reiseburo Reisebuero Lastminute
188 Travel Reisen urlaub

Wer gerne reist steuert immer weider verschiedene Reiseziele an. Urlaub an der Sonne oder im ... Travel Reisen Direkt zum Seiteninhalt Hauptmenü Homepage Afrika Asien Australien Europa
travel-reisen.at Urlaub Reisen Ferien
189 *** VOILA KÄRNTEN REISEN Voila
9220
Velden
Voila Kärnten Reisen bietet Ihnen einfach alles was das Urlauberherz höher schlagen läßt. Von ... - NALGIETOUR „Durch die ehemalige DDR“ ..-.. – Infos bei Voilà Reisen
voila-reisen.at Voila Urlaub Reisen Kärnten
190 Yoga Reisen Yogareisen Yoga
73447
Oberkochen
Yoga Reisen. Yogareisen und Retreats in Marokko Portugal Italien Indien Ibiza Deutschland Österreich. Der Ratgeber ... Österreich Yoga Reisen Kontakt Ayurveda im Thermenhof in Österreich www.Thermenhof Im Ayurveda
yogareisen.at Yoga Reisen Yogareisen Yoga Reisen
191 Schörgenhuber Schlager Reisen Schörgenhuber

Schörgenhuber Schlager Reisen Einsteigen Platz nehmen und wohlfühlen Busreisen Mehrtagesfahrten ... Schörgenhuber Schlager Reisen Einsteigen Platz nehmen und wohlfühlen Busreisen - Mehrtagesfahrten
schlager-reisen.at Schörgenhuber Schlager Reisen Einsteigen Platz Nehmen
192 Reiseorganisation Reise organisieren Reiseorganisation

Reiseorganisation Reise organisieren Busreise organisieren Busreise managen Busreise empfehlen ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage
reiseorganisation.at Reiseorganisation Reise Organisieren Busreise Organisieren
193 Ernst Uschi Wagners events

private homepage über musikalisches im musiccorner wissenswertes über unsere reisen urlaub events ... MusicCorner EVENTS REISEN WIEN LINKS Gästebuch Wir beide das sind I und Er Wagner
wagners-web.at Events Urlaub Reisen Amerika
194 Dominikanische.at Reisen in DomainQuadrat Marketing GmbH
1230
Wien
dominikanische republik reise urlaub ... -minute Reisen bis zu -% buchen Ihre Traumreisen buchen. Sonderangebote bis % g www.ab
dominikanische.at
195 Mauritius La Réunion Mauritius

Islands4more seit Jahrzehnten der Reiseveranstalter für Reisen in den Indischen Ozean bietet individuelle Reisen ... für Reisen in den Indischen Ozean Islandsmore ist der Veranstalter für den Indischen Ozean. Mauritius
islands4more.at Mauritius Madagaskar La Réunion Reunion
196 Grisu auf Reisen

Unsere Reisen mit dem Wohnmobil Albanien und Griechenland Mystras Geocaching Thermeninfo ... Grisu auf Reisen Direkt zum Seiteninhalt Hauptmenü Home Ueber Uns Fahrzeuge Zelt/Wohnwagen
grisu-auf-reisen.at
197 Nilkreuzfahrten Last Minute Nilkreuzfahrten

Lastminute Nilkreuzfahrten Reisen aller Reiseveranstalter im Preisvergleich mit Bestpreis Garantie. LastMinute Nilkreuzfahrt bis 65 ... für die nächte Flugreise ... mehr Info Lastminute Reisen Pauschalreisen Ferienhaus/Wohnung Charterflüge Mietwagen
nilkreuzfahrt.at Nilkreuzfahrten Nilkreuzfahrt Aegypten Lastminute
198 Island Reisen Grönland NORDWIND REISEN GmbH Grönland
87700
Memmingen
Urlaubsreisen nach Grönland Island und Spitzbergen ... Ihr Urlaubsspezialist für Island Grönland und Spitzbergen Reisen NORDWIND Beratungshotline +
nordwindreisen.at Grönland Reisen Island Reisen Island Urlaub
199 Vorderegger Reisen Busreisen Vorderegger GmbH Reisen
5700
Zell am See
Vorderegger Reisen der kompetente Partner. Reisebüro. Flug Schiff Bahn. Busreisen und Incoming in ... . Hier gehts zum Urlaub Vorderegger Reisen - ein voll konzessioniertes selbstständiges Reisebüro
vorderegger.at Reisen Bus Flug Incoming
200 Moderne Reisen modernereisen Moderne

Reisebüro und Busreisen Glas. Moderne Reisen modernereisen moderne busreisen moderner urlaub ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage
modernereisen.at Moderne Reisen Modernereisen Moderne Busreisen
201 PolarAdventures | Kreuzfahrten und kreuzfahrt

Seit 1996 organisiert PolarAdventures Kreuzfahrten und Flüge in die Arktis und Antaktis. Die aktuellen Angebote ... Expeditionen Kreuzfahrten und See-Reisen mit Eisbrechern Polarschiffen und Seglern in die Arktis
polaradventures.at Kreuzfahrt Antarktis Polar Spitzbergen
202 Reisephilosophie Philosophie der Philosophie

Das Buch Reisephilosophie. Inhalt Autorin Buchbestellung. ... Reisephilosophie Startseite Buchinhalt Autorin Abstract Buchbestellung Über das Reisen
reisephilosophie.at Philosophie Der Reise Reisen Reisephilosophie Apodemik Kunst Reisetheorie
203 Services Reisen services

... Vorarlberg Wien ARBÖ-Mitglied werden Aktionen Mitgliedschaft ARBÖ erleben Services Reisen Auto Motor Rad
reise-service.at Services Verkehrsinfos Reisen Spritpreise Tools
204 Das Sonnenleben [Reisen zum sonnenleben

das Sonnenleben [Reise zum Licht] Seminare ... -Reisen zum Licht! Für körperliche Beschwerden oder einfach als Selbsterkenntnis Seminar
das-sonnenleben.at Sonnenleben Rosemarie Seminare Meditation Licht Reiki Reikimeisterin Kroatien
205 ReiseMovies Reisenbuchen ReisebuchungTravelMovies Reisetipp

ReiseMovies Reisen in Österreich ? Reisetipp Hotels für Ihre Reisen buchen. Reisebuchung in Österreich ... Wenn einer eine Reise tut dann kann er viel erzählen ... Hier auf Reise Movies finden Sie Urlaubs
reisemovie.at
206 Trendreisen Reisetrends Trendreisen

Fachbatrieb für Trendreisen Reisetrends Reiseziele Reisetipps Reise Emphelungen Reisemessen ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage
trend-reisen.at Trendreisen Reisetrends Reiseziele Reisetipps
207 Resietrends Reiseziele Resietrends

Resietrends Reiseziele Reisetipps Reise Empfehlungen Reisemessen Busreisen Busreise Trends ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage
reise-trends.at Resietrends Reiseziele Reisetipps Reise Empfehlungen
208 Reiseplanung für Gruppen und Reiseplanung

Reiseplanung für Gruppen und Vereine Reise planen Busreise planen Vereinsreise planen ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage
reiseplanung-gruppen.at Reiseplanung Für Gruppen Und Vereine Reise Planen
209 Reiseplanung für Firmen und Reiseplanung

Reiseplanung für Firmen und Betriebe Reise planen Busreise planen Vereinsreise planen ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage
reiseplanung-firmen.at Reiseplanung Für Firmen Und Betriebe Reise Planen
210 Reiseplanung für Gruppen und Reiseplanung

Reiseplanung für Gruppen und Vereine Vereinsreisen Busfahrten für Vereine Ausflugsfahrten im Bus für ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage
reiseplanung-vereine.at Reiseplanung Für Gruppen Und Vereine Vereinsreisen Busfahrten
211 INDIA Film Reisen Indien

Die Homepage beschreibt einzelne Reisen durch Indien die der Inhaber von INDIA Film aus
india-film.at Indien Erfahrungsberichte Bilder Reisen
212 Afrika Reisen Urlaub Afrika

Afrika Reisen Urlaub und Ferienportal ... Afrika Reisen Hier finden Sie ab demnächst unser AFRIKA REISEN Portal mit vielen interessanten
afrika-reisen.at Afrika Africa Südafrika Reisetips
213 Korsika Urlaub Hotels Ferienhäuser Korsika

Korsika Urlaub | Angebote von L'Evasion Tours Korsika Angebote von L'Evasion Tours Ihrem ... Korsika Urlaub Hotels Ferienhäuser Villen Ferienwohnungen Reisen Rundreisen Selbstfahrtouren
korsika-urlaub.at Korsika Reisen Urlaub Hotels
214 Gasteintaxi Rudigier Reisen Taxi

Gasteintaxi bei uns reisen Sie First Class. Vom einfachen Airport Transfer vom Flughafen in die ... Gasteintaxi ? Rudigier Reisen ? Taxi ? Stefan Rudigier ? Panoramareisen ? Taxitransfer
taxigastein.at Taxi Gastein Gasteintaxi Rudigier Reisen
215 SCHARINGER REISEN Busreisen Reisen

Herzlich willkommen beim Reisebüro Scharinger Ihrem Partner für Busreisen Flugreisen Schiffsreisen ... Run Herren Weiß reisen aktuelles kontakt/öffnungszeiten über uns service bestellung Scharinger
scharinger-reisen.at Reisen Reisebüro Reisebuero Oberösterreich
216 GTI Reisen Reisebüro: GTI-Reisen GmbH Reisebüro
6361
Hopfgarten in Tirol
GTIReisen Ihr Reisespezialist im Brixental bietet Flugreisen Pauschalreisen Last Minute Angebote ... Minute Hotels Weltweit Hotelangebote Hotelbeschreibungen Reisen in einer Gruppe bis zu Teilnehmer
gti.at Reisebüro Reisebuero Reisen Flugreisen
217 Ihre Reisen Online! Ganz Weltreise

Reiseberichte Tipps und Tricks die das Reisen leichter machen!
myjourney.at Weltreise Langzeitreise Worldtrip Weltreiseplanung
218 Urlaubsberatung Urlaub beraten Urlaubsberatung

Urlaubsberatung Urlaub beraten Reiseberatung Reiseplanung Beratung und Planung von Reisen ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage
urlaubsberatung.at Urlaubsberatung Urlaub Beraten Reiseberatung Reiseplanung
219 Willkommen bei Wiegele Reisen Johann Wiegele & Söhne GmbH Bus
9530
Bad Bleiberg
Das Busunternehmen Wiegele Reisen bietet Ihnen eine umfangreiche Auswahl an Reisearten. Von Tagesfahrten über Klassenfahrten ... Buchen Anfahrt Willkommen bei Wiegele Reisen! Wir wünschen all unseren Kunden
wiegele-reisen.at Bus Reisebus Reisebüro Villach
220 Reisen kann so schön reise

portal für reiseberichte ... Reisen kann so schön sein EUROPA AFRIKA AMERIKA ASIEN AUSTRALIEN NEWS Startseite Kontakt
psontour.at Reise Ausland Innland Afrika
221 Reiseplanung Reise planen Reiseplanung

Reiseplanung Reise planen Busreise planen Vereinsreise planen Gruppenreise Planen Schulwoche ...  Reiseplanung Reise planen Busreise planen Vereinsreise planen Gruppenreise Planen
reise-planung.at Reiseplanung Reise Planen Busreise Planen
222 Doggydayz Reisen mit Reisen

Doggydayz die Reiseagentur für Reisen mit Hund Piratenhäuser Seeräubervillen Hüttenurlaub
doggydayz.at Reisen Mit Hund Urlaub Mit Hund
223 Lastminute Urlaub | Super lastminute

Lastminute Urlaub Mit dem Restplatzshop haben Sie sich für den Spezialisten zum Thema Reisen
restplatzshop.at Lastminute Urlaub Super Last Minute Reisen
224 Gabriele Reis Gabrielereis

... Gabriele Reis Direkt zum Seiteninhalt Hauptmenü × Homepage Erklärung Beratungsfelder Über
glaubeliebehoffnung.at Gabrielereis Gabriele Reis Reis Gabriele
225 SAHARASTERN Saharastern

Saharastern Reisen Wüste Marokko ... Landschaft verzaubern und tauchen Sie in das Leben der Maghrib ein! Eine Reise durch das Königreich
saharastern.at Saharastern Reisen Wüste Marokko
226 Bösch Reisen Busfahrten Bamp;ouml;sch

Bösch Busreisen Reisen mit besonderem Flair Gruppenreisen für Halbtages und Tagesfahrten Wochenausflügen ... Bösch Reisen GesmbH Co KG A- Lustenau Hagstraße + -
boeschreisen.at Bamp;ouml;sch Bamp;ouml;schreisen Busreisen Reiseveranstalter
227 Bus | Busreisen | Bus

Sicher organisieren Sie für das Jahr 2010 Tagesausflüge Theater Opernfahrten oder mehrtägige Ausflüge ... Busreisen Reisen mit dem Bus Liebe Kunden Wir haben unseren Busbetrieb im Jahr eingestellt
mayer-bus.at Bus Reisen Busreisen Reisen Mit
228 Werner Predota Home werner

Werner Predota geht auf Reisen ... Werner Predota begleitet Sie auf Reisen Home Reisen Extrablatt Videos von Werner Predota Presse
predota.at Werner Predota Reisen Seniorenreisen
229 Ferienlager Feriencamps Ferienlager

Reisen sowie Urlaub speziell für Kinder und Jugendliche: Die Camps.at Ferienlager Sommercamps Feriencamps ... ! Diätcamp Multi Activity Camp Reit- und Pferdecamp "Gipsy" Vor der Reise Anreisemöglichkeiten
camps.at Ferienlager Feriencamps Reisen Urlaub
230 Camping Wohnwagen Camping

Private Homepage mit dem Hauptinhalt Camping ... aber wie? Wohnwagen und Stellplatz Ausflüge und Reisen .. bis .. Baia Domizia . bis .. Kärnten
domandl.at Camping Wohnwagen Reisen
231 Seychellen Urlaub Reisen Hotels Seychellen

Seychellen Urlaub | Angebote von L'Evasion Tours Ihrem Seychellen Reiseveranstalter Reisen Urlaub Hotels Heiraten ... Seychellen Urlaub Reisen Heiraten Hochzeit Flitterwochen Hotels Privat-Inseln Kreuzfahrten
urlaub-seychellen.at Seychellen Reisen Urlaub Mahé
232 Herburger Reisen: Home Urlaub

Willkommen bei Herburger Ihr starker Reisepartner in Vorarlberg ... ob Familienurlaub oder Gruppenreise Fernreisen oder Last-Minute mit Herburger Reisen sind Sie richtig beraten
herburgerreisen.at Urlaub Reisen Reisebüro
233 Chamäleon Die Reise

Reisen mit höchstens 12 Teilnehmern – Afrika Amerika Asien Ozeanien ... Unsere Art des Reisens Unsere Geschichte Veranstaltungen Reisesicherheit Fotowettbewerb Jobs Chamäleon
namibia.at
234 Home Greimel

Greimel Reisen Ihr Reiseprofi aus Passail ... Home Unsere aktuellen Reisehits Christkindlmarkt Wien Sa. . Dez. ? - Greimel Reisen Ges.m.b.H
greimel.at Greimel Reisen Passail
235 Wolf Reisen GmbH Wolf
8343
Trautmannsdorf
... Wolf Reisen GmbH - Trautmannsdorf Wolf Ausflüge Reisen Machen Sie Ihren Urlaub
wolf-buschenschank.at Wolf Reisen Busunternehmen Reisen Tagesausflug Ausflug
236 Herburger Reisen: Home Urlaub

Willkommen bei Herburger Ihr starker Reisepartner in Vorarlberg ... . Egal ob Familienurlaub oder Gruppenreise Fernreisen oder Last-Minute mit Herburger Reisen
herburger-reisen.at Urlaub Reisen Reisebüro
237 Start (DUSCHLBAUER Reisen
4240
Freistadt
DUSCHLBAUER Reisen Bustouristik Linienverkehr in Freistadt. ... DUSCHLBAUER Reisen Bustouristik Linienverkehr in Freistadt. Start News Linienverkehr Downloads
duschlbauer-reisen.at
238 Herzlich Willkommen auf der putzreisen

Putz Reisen Die Website des Unternehmers Raimund Putz ... Start PUTZ Reisen Hauptmenü Startseite Aktuelle Veranstaltungen Unser Unternehmen Fuhrpark Kontakte
putzreisen.at Putzreisen Raimund Putz
239 Africa.at Afrika ist DomainQuadrat Marketing GmbH
1230
Wien
afrika südafrika suedafrika urlaub reise safari ... -deko.westwing Afrika Reisen Spezialist Individuelle Beratung www.thobareisen/afrika afrika reisen Ergebnisse
africa.at
240 Onlineholidays Reisen Kultur und Rundreise

Kulturelle Rundreisen preiswert und mit Niveau Busrundreisen Gruppenreisen Reisen mit Arzt Studienreisen Architekturreisen Städtereisen ... weltweit Budget Hotels Reiseschutz Travelcard Mietwagen Inseln Wellness - Reisen Frauen auf Reisen Tiere
onlineholidays.at Rundreise Busreise Deutschsprechende Gruppenreise Gruppenreisen Fachreisen Archi
241 InselReisen ihr Reisespezialist Bus

InselReisen ihr Reisespezialist für Stadt und Rundfahrten ... ! Insel-Reisen Schon immer an einen spontanen Kurzurlaub zu den Feiertagen gedacht? Für ein paar Tage
insel-reisen.at Bus Busdesign Bus Design Stadrundfahrten Flughafenstransfers Auslandsreisen Tage
242 Riedler Reisen Home Riedler Reisen & Touristik GmbH Taxidienst
4573
Hinterstoder
Ihr Weg ist unser Ziel! Ihre ReiseveranstalterFamilie Riedler und Mitarbeiter Home %mod_search% Katalog Download Laden ... sdfdsdf Home Reisen Inlandreisen Auslandsreisen Taxidienst Wandertaxi Rodeltaxi Jugendtaxi
landbus.at Taxidienst Regionalverkehr Reiseverkehr Anmietverkehr
243 Kreuzfahrten Reisen Kreuzfahrten

Reisen Sie mit kreuzfahrtprofi.at zu den schönsten Orten der Welt. Wundervolle Kreuzfahrten und Schiffsreisen günstig ... Download Kontakt Home Online Buchen Sagmeister Reisen Reisebüro Autobusbetrieb Team Unsere Geschichte
sagmeister-reisen.at Kreuzfahrten Kreuzfahrt Schiffsreisen
244 :: Proksch Reisen :: reisebüro

Prokschreisen Reisebüro Proksch. Ihr Reisepartner für Bus Flug Bahn und Schiff. ... phoc . Proksch Reisen - Inh. Waltraud Schalud. mail schwechatprokschreisen
prokschreisen.at Reisebüro Reise Reisen Gulet
245 Reisen in Salzburg Reisen

Reisen in Salzburg Salzburg Österreich Unterkünfte Urlaub Ferien Tourismusinformation Hotels ... Reisen in Salzburg - Salzburg Österreich Unterkünfte Urlaub Ferien Tourismusinformation Hotels
salzburgreisen.at Reisen Salzburg Österreich Tourismusinformation
246 Startseite EnergieReise EnergieReise

... ? Energetiks Energie-Reise - Vesseling Reiki im Raum Wiesbaden Frankfurt und Wien - "Die reinste
vesselingpractitioner.at EnergieReise Vesseling Reiki In Wien
247 Travel Partner Reisen GmbH Travel Partner Reisen GmbH Angebot
6352
Ellmau
Travel Partner Reisen GmbH Ellmau ... Sonne See und frischer Luft haben. Druckversion Sitemap Travel Partner Reisen GmbH Login Logout
magicmountains.at Angebot Kompetenz Beratung
248 Willkommen bei Tierra Incognita Tierra

... japanisches Sprichwort Wir über uns Reisen Service Fotogalerie Gästebuch Partner Tierra Incognita Reisen
tierra-incognita.at Tierra Incognita Reisen Fernreisen
249 Hernuss Reisen : Hernuß Hernuß

... Hernuss Reisen Tillmitsch bei Leibnitz Steingrub T + F + -
hernuss-reisen.at Hernuß Einem Reisen Handicap Oder Unsere Sind Unternehmen
250 Willkommen bei Biblische Reisen Biblische Reisen GmbH
3400
Klosterneuburg
Biblische Reisen Österreich: Veranstalter von ökumenischen Studienreisen Kulturreisen und Begegnungsreisen; Reisen in den Nahen ... Links Allgemeine Reiseinfos Reisen für Ihre Gruppe Aktuelles Angebotsanfrage Unsere Reiseziele Naher
biblische-reisen.at
251 OZEAN Studentenreisen reise

Ozean Reisen Studenten ... Reisen? genau richtig! Das alles wird bei uns Angeboten zu einem günstigen Preis so dass
ozeanreisen.at Reise Ozean Student Travel
252 Moser Reisen Pilgerreisen moser

... Leserreisen Messeflüge Musikreisen ORF Reisen Seniorenreisen Studien- und Pilgerreisen Urlaub Ferien Last
moser.at Moser Reisen
253 REISEN | Tipps für Ausflug

REISEN ist Österreichs Magazin für Urlaub und Freizeit in Österreich Europa und Übersee. Die ... . » mehr lesen .. .. REISEN-Magazin Herbst Jetzt mit großem Gewinnspiel
magazin-reisen.at Ausflug Wandern Urlaub Reisen
254 In Afrika Hotels direkt allafricahotels.d

Bei allafricahotels.de und AfricanWorld Reisen finden Sie Ihr Hotel Camps Lodges ... ¤ltig zusammengestellt. Beginnen Sie Ihre Reise nach Afrika schon jetzt auf unserer Webseite! Afrika
hotels-direkt-buchen.at Allafricahotels.de AfricanWorld Reisen Westafrika Angola Benin
255 Reise durch Kärnten Reise

Reise durch Kärnten Österreich Hotels Unterkünfte Urlaub Ferien Tourismusinformation ... Reise durch Kärnten - Österreich Hotels Unterkünfte Urlaub Ferien Tourismusinformation
kaerntenreisen.at Reise Kärnten Österreich Hotels
256 ReiseNetzwerk 4trips.de

Das ReiseNetzwerk 4trips.de bietet Infos zu weltweiten Destinationen und speziellen Reisearten; ReiseInspirator und Bildergalerien machen ... nach Göteborg Es gibt kaum eine schönere Art zu Reisen um die unverwechselbare Landschaft des Nordens
4trips.at
257 Am liebsten Reisen Kreuzfahrten

Reiseblog ? Reisenews ? Fernreisen ? Städtereisen ? Reiseberichte ? ReiseReporter ? ... Mittwoch September Am liebsten Reisen In der Welt Zuhause Start Fotoblog Afrika
amliebstenreisen.at Kreuzfahrten Seereisen Kreuzfahrtinspektor Seereisen
258 Naderer Reise Bus

Bus und Flugreisen ? Wir schneidern Ihre Reise nach Maß! Naderer Bustouristik in Linz und ... Naderer Reise Bus Bus- und Flugreisen ? Wir schneidern Ihre Reise nach Maß! Naderer Bustouristik
naderer-reisen.at
259 Sabines Reisebüro | Lastminute last

TOURPORT ist ihr Partner für Last Minute Reisen. Last Minute Urlaub günstig buchen mit einer
xn--mobiles-reisebro-wzb.at Last Minute Reisen Last Minute Last
260 ägyptenreise.at Ägyptenreisen Ägypten

Ägypten Reisen In Die Wärme ... ägyptenreise Ihre Reise Nach Ägypten Websearch Wir durchsuchen für Sie das Internet! Aktuelle
xn--gyptenreise-k8a.at Ägypten Reisen All Inklusive Kairo
261 TRAVEL MED CENTER :: Malaria

Reisen zählt zu den beliebtesten Freizeitbeschäftigungen eine gesunde Heimkehr sollte der krönende Abschluss jeder
travel-clinic.at Malaria Gelbfieber Impfung Angst
262 MAG Reisen Reisebüro Grandits: kroatien
2012
Gründung der MAG Seefahrtschule in Österreich
MAG Reisen Reisebüro Grandits: unsere Angebote: Kroatien: Hotels Appartements Bungalows Ferienhäuser ... Holzyachten Luxusyachten Gulets - Inselhüpfen FKK - Tauchkreuzfahrten » Blaue Reise Yacht Crew
magreisen.at Kroatien Istrien Dalmatien Kroatien Hotels Adria österreich Austria
263 Busreisen Tirol RuefReisen Busreisen

Busreisen mit RuefaReisen Tirol Sicher und mit Komfort an den Urlaubsort. Wir fahren Sie ... Zum Inhalt Zur Navigation Home Unternehmen Reisen Kontakt Anfrage http//static.clearsense
ruef-reisen.at Busreisen Tirol
264 PichlerReisen :: Ausflüge | judenburg

PichlerReisen Wir lassen niemanden im Regen stehen! ... -REISEN Schulbusfahrten Familienausflüge diverse Kurierdienste Fahrten mit Kleinbussen
pichler-reisen.at Judenburg Steiermark österreich Austria
265 Reisenpreisvergleich.at  Diese Website steht zum

Diese Website steht zum Verkauf! reisenpreisvergleich.at ist die beste Quelle für alle Informationen die ... reisen-preisvergleich Domain erwerben This domain is FOR SALE - Diese Domain steht ZUM VERKAUF
reisen-preisvergleich.at
266 Malta Gozo Reise malta

Malta Gozo online Reisen UrlaubsPortal. Infos günstige Buchung von Hotels in Malta ... HOME Multimedia Bildagentur Forum Videos Reisen Ausflüge Touren Ferienwohnungen Ferienhäuser
imalta.at Malta Gozo Reisen Urlaub
267 Willkommen in der Webheimat webheimat

Webheimat.at Urlaub Reise und Freizeit ... » Reise-Tipps Top Links » Lotto » EuroMillionen » Kreuzworträtsel » Mitglieder » Partnerbörse » Chat
webheimat.at Webheimat Urlaub Reise Freizeit
268 Kreta Reisen Urlaub Kreta

www.kretareisen.de Kreta Ihr Partner in Sachen Ferienwohnung Ferienhaus Reisen ... Herzlich Willkommen bei kreta-reisen startanibittewarten Angebot der Woche Kreta Kreativ Reise- führer
kreta-reisen.at Kreta Reisen Kreta Reisen Griechenland Urlaub Auf Kreta
269 Willkommen bei PRO Reisen PRO Reisen GmbH PRO
4020
Linz
Ihr Kreuzfahrtspezialist seit über 20 Jahren! ...  Willkommen bei PRO Reisen Nützen Sie den PRO Reisen Kreuzfahrtenfinder. Ihre individuellen
proreisen.at PRO Reisen Pro Reisen PRO
270 Columbus Reisen Startseite Studienreisen
1200
Wien
Entdecken Sie die Welt mit Columbus Reisen. Ob langersehnt oder kurzentschlossen. Bei uns gibt es ... ? Details Italienische Adriaküste Preis-Wert-Reise an die Adria. Seebäder Kunststädte Meer
columbus-reisen.at Studienreisen Städtereisen Rundreisen Kreuzfahrten Last Minute Kulturreisen
271 Reisen bilde(r)t Claudia
1100
Wien
Claudias und Georgs Weltreisen ... an uns Österreichbild Downloads Bananaboot-Ride Links Wikinger Reisen Ikarus Reisen Wigwam Reisen Regenwald
claudia-georg.at Claudia Und Georg Reisen Bildet Reisen
272 Angel Reisen Angelreisen

Angelreise Portal weltweit ... Angel Reisen Hier finden Sie ab demnächst unser ANGEL REISEN Portal mit vielen interessanten
angel-reisen.at Angelreisen Angel Reisen Angelreise Angelurlaub
273 Reiseratgeber.at Informationen zum

reiseratgeber.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-ratgeber Weitere Links Domain erwerben Sie können die Domain reise-ratgeber kaufen
reise-ratgeber.at
274 Sunseeking Reiseblog und

Willkommen bei Sunseeking´s ReiseBlog. Reist mit uns an die schönsten Plätze der Welt. ... Reise-Blog Thailand-Blog Home Thailand Chiang Mai Koh Samui Khao Lak Koh Chang Krabi Phuket Trang
sunseeking.at
275 Home :: ReisenWandernTauchen
2384
Breitenfurt bei Wien
Reiseberichte Wandertouren Tauchplätze und vieles mehr bei ReisenWandernTauchen ... Wird geladen... Teilen Du befindest Dich hier Home ? Willkommen bei Reisen-Wandern-Tauchen
reisen-wandern-tauchen.at
276 Meine Reise Urlaub text/html

News Preise Reportagen und Tipps zum Thema Reise. Aktuelle Nachrichten und Berichte aus ... Vergünstigungen - Mein Schiff wird kommen - Reisen von Rhône bis Wolga - Studienreisen Mit Schiff und Jet
meinereise.at Text/html; Charset=iso88591
277 Home Angelika

Angelika Reisen Busunternehmen Angelika Kluksarics ... Home Aktuelle Angebote Kontakt Angelika Reisen Wir bringen Sie ihrem Traumziel näher
angelika-reisen.at Angelika Reisen Bus Busreisen
278 FELNER REISEN 2380
2380
Perchtoldsdorf
... Reisebus Webcam Links Anfrage Kontakte Sie sind hier >> Startseite FELNER REISEN Zitronenfest in Menton
felner-reisen.at 2380 Perchtoldsdorf Plättenstrasse 21 Taxi Bus Autobus Felner
279 Webkatalog für Österreich mit Airberlin

Webkatalog und Suchmaschine mit geprüften Links aus Österreich Urlaub Reisen Hotels Banken Versicherungen ... Ihr Webkatalog und Suchmaschine mit geprüften Links aus Österreich. Infos zu Urlaub Reisen Hotels Beruf
topaustria.at Airberlin Suchmaschine Webkatalog Österreich Finanzen Wirtschaft Urlaub Reisen
280 Die besten Reise Urlaub Schnäppchen
85649
Brunnthal
Wir machen Urlaub günstiger und finden täglich alle Reise und Last Minute Schnäppchen Egal
schnaeppchen.at Schnäppchen Urlaub Last Minute Lastminute
281 Travel Doc | Ärztlich

Ärztlich begleitete Reisen haben eine besondere Qualität und zeichnen sich für jeden Reiseteilnehmer durch ein ... ? Main Menu ?Home Verein Ärzte Reisen - Tagesreisen - Busreisen - Flugreisen - Wellnessreisen
travelwithdoc.at
282 Reisekatalog.at Informationen zum

reisekatalog.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-katalog Weitere Links Domain erwerben Sie können die Domain reise-katalog kaufen
reise-katalog.at
283 Reiseangebote.at Informationen zum

reiseangebote.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-angebote Weitere Links Domain erwerben Sie können die Domain reise-angebote kaufen
reise-angebote.at
284 FragolloReisen Reisen

Reisebüro Fragollo ... Startseite Unternehmen Chronik Team Fuhrpark Standort Reisen Tagesfahrten Ausflüge
fragollo-reisen.at Reisen Reisebüro Steiermark Bus
285 Traumreisender Entlang der Donau Reisen

Alles um Reisen Wandern Lesen ... auf der Donau Herzlich Willkommen! Freue mich dass ich Dich hier begrüssen kann.Dies soll Dir helfen Reisen
traumreisender.at Reisen Irland Radfahren Wandern Lesen Donau Ungarn
286 Preiswert Reisen mit PEP pepXpress Touristik & Marketing GmbH pep
56070
Koblenz-Bubenheim
pepXpress ist Ihr SpezialReiseveranstalter für weltweite PEP und ExpedientenReisen ... - Interline- und Expedienten-Reisen Alle unsere Reiseangebote dienen der Fort- und Weiterbildung sowie
pepxpress.at Pep Expedienten Expedientenreise
287 Schwebach Reisen Frankenmarkt
4890
Frankenmarkt
Willkommen bei Schwebach Fischer Reisen in Frankenmarkt Oberösterreich. Wir fahren sie ins Fischerparadies und wieder ... ? Wilkommen bei Schwebach Reisen GmbH. ? Busse für jeden Bedarf und in jeder Preisklasse. Ob Betriebsausflug
schwebach-reisen.at
288 Tom Reisen | TaxiTom taxi

... Home News Reisen Taxi Kontakt » Fuhrpark » Team » Reisen » Taxi » Busanmietung » Links »
tom-reisen.at Taxi Taxitom Taxi Tom Dienstleistung
289 Kardamom Auf einer

Kardamom Auf Einer Reise.
kardamom.at
290 8 ZIELE 8

8 ZIELE 8 LAENDER Eine Reise durch Lateinamerika ... HOME . Menü DAS BUCH ZUR REISE ACHT ZIELE DER UNO ORGANISATIONEN . User CP User name Password
8ziele8laender.at
291 Reisemeer: Ihr Reisebüro in

Reisemeer ? Reisen mit und ohne Handicap ? Ihr Reisebüro in Linz für Behinderten gerechte ... Reisemeer Für Menschen mit und ohne Handicap Barrierefreies Reisen - Behindertengerechter Urlaub
reisemeer.at
292 Reisefalke.at Informationen zum

reisefalke.at ist Ihre erste und beste Informationsquelle über reisefalke Hier finden Sie auch weitere ... reise-falke Domain erwerben This domain is FOR SALE - Diese Domain steht ZUM VERKAUF Domain
reise-falke.at
293 Reisenhofer.at Informationen zum

reisenhofer.at ist Ihre erste und beste Informationsquelle über reisenhofer Hier finden Sie auch weitere ... reisen-hofer Domain erwerben This domain is FOR SALE - Diese Domain steht ZUM VERKAUF Domain
reisen-hofer.at
294 Grancanaria.at GranCanaria DomainQuadrat Marketing GmbH
1230
Wien
grancanaria grancanaria kanaren kanarische inseln reise urlaub ... Weitere Infos Sponsored Links zum Thema Gran Canaria Reise Reisen beim Testsieger finden Gran
grancanaria.at
295 Lastminute Börse Reisen Lastminute

Lastminute Börse Reisen günstige Reiseangebote im Internet Reisebüro online vergleichen buchen! Arrangement
xn--lastminutebrse-5pb.at Lastminute Börse Reisen Günstige
296 Reisenbuchen.at Informationen zum

reisenbuchen.at ist Ihre erste und beste Informationsquelle über Reisen buchen Hier finden Sie auch ... Domain erwerben infodomcollect DE US reisen
reisen-buchen.at
297 WILLKOMMEN Reinsberger Reisen GMBH Reisebüro
9344
Weitensfeld
Herzlich Willkommen bei Reinsberger Reisen in Weitensfeld ... REISEN ORGANISIERT Wir organisieren jede gewünschte Reise und erstellen Ihnen nach Ihren Wünschen
reinsbergerreisen.at Reisebüro Taxi Urlaub Buchen Reise
298 Ein Herz für Singles Reisen

Singles suchen Singles um gemeinsam zu verreisen. Das Portal " EIn Herz für Singles ... und Alleinreisende - die etwas andere Partnerbörse - kennenlernen um gemeinsam zu reisen - oder vielleicht auch mehr
clubschiffzentrale.at Reisen Singlebörse Kreuzfahrten Clubreisen
299 Reiseversicherung.at Informationen zum

reiseversicherung.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-versicherung Domain erwerben DOMAIN ERWERBEN DOMAIN FOR SALE Bei Interesse klicken
reise-versicherung.at
300 FlixBus ? Günstig mit
80639
München
Reise mit dem Fernbus in über 900 Städte in Europa. Hol Dir jetzt Dein Busticket ... )TürkçeDeutschNederlandsFrançais?e?tinaSvenska?????????Român?DanskMagyarSloven?inaSloven??inaHrvatski???????EspañolPolskiNederlandsFrançais Go Günstige Fernbus-Reisen ab ? von wählen nach wählen hin zurück Erwachsene Kinder Fahrräder
flixbus.at
301 Startseite  OMEGAReisen GMBH Omega

OMEGA Reisen GMBH Rosenweg 22 5164 Seeham Austria ... Toggle navigation Startseite Unsere Reiseziele Golfreisen ProGolf Reisen Individualreisen PRO's
omegareisen.at Omega Reisen Golf
302 STARTSEITE Pulay Reisen PULAY Reisen Ges.m.b.H. & Co OHG BUSUNTERNEHMEN
2544
Leobersdorf
Pulay Reisen Ges.m.b.H BUSUNTERNEHMEN REISEBÜRO MIETWAGEN Familienbetrieb mit einer über 50jährigen Erfahrung ... KONTAKT BUSANFRAGEN REISEN WANDERN Wir begrüßen Sie auf unserer neuen Homepage! Es freut uns dass
pulayreisen.at BUSUNTERNEHMEN REISEBÜRO MIETWAGEN
303 Grancanaria.at GranCanaria DomainQuadrat Marketing GmbH
1230
Wien
grancanaria grancanaria kanaren kanarische inseln reise urlaub ... Karin Steinberg-Be... Gran Canaria Street Map Dubbele EUR Maremonto Reise- und Wanderf Martin
gran-canaria.at
304 :: LÄNGENGRAD Expeditionen Offroad

Expeditionen Reisen Touren und Outdoor wir organisieren Veranstaltungen sowie Events Beratungen und
laengengrad.at Offroad Allrad Outdoor Geländewagen
305 Schipp Reisen GmbH busse

Ihr Spezialist für Busreisen ... Startseite Unternehmen Unsere Busse Anfragen Kontakt Herzlich Willkommen bei Schipp Reisen OG
schipp-reisen.at Busse Bus Busreisen Reisen
306 Für die Veröffentlichung von

Der kostenlose Service für PR und Öffentlichkeitsarbeit rund um Reisen ... Schöner Reisen ist ein kostenloses Webportal zur Förderung der Reiselust. Wir laden
schoenerreisen.at
307 Kleine Zeitung Gute Reise Anzeigen und Marketing Kleine Zeitung GmbH & Co KG urlaub
8010
Graz
Über 500 Nah und Fernziele online suchen und buchen! ... Zur klassischen Ansicht der Reiseplattform wechseln Kleine Zeitung Gute Reise - Das Urlaubsportal
reise.kleinezeitung.at Urlaub Reise Gute Reise Kleine
308 GenussReisen Österreich: GourmetReisen netwerk Kreidl GmbH & Co KG GenussReisen
6275
Stumm im Zillertal
GenussReisen Österreich: GourmetReisen Gourmet Hotels und GenussUrlaub in Österreich wählen Sie nach Lust ... Einkaufen Unterkünfte Genussvoll reisen in Österreich Ihre Anfrage Sie haben eine Frage zu den Genuss Reisen
genussreisen-oesterreich.at GenussReisen Österreich GenussUrlaub Österreich Gourmet Hotels
309 Kreuzfahrten Reisen Kreuzfahrten

Reisen Sie mit kreuzfahrtprofi.at zu den schönsten Orten der Welt. Wundervolle Kreuzfahrten und Schiffsreisen günstig ... Download Kontakt Home Mit uns Reisen Begleitete Kreuzfahrten Reiseleiter Buchung und Reiseablauf FAQ Warum
kreuzfahrtprofi.at Kreuzfahrten Kreuzfahrt Schiffsreisen
310 Startseite Prammer

Prammer Reisen In und Auslandsreisen Mietwagen ... Newsletter Startseite Über Uns Geschichte Kontakt Team Alles Grün Reisen Wellness Kultur Events
prammer-reisen.at Prammer Reisen Reiseunternehmen Busse Inlandsreisen Auslandsreisen
311 Blaue Reisen Türkei Blaue

... Kontakt Türkei-Links Willkommen bei Pera Air Travel Service ! BLAUE REISEN - SOMMER Unsere Routen
blauereisen.at Blaue Reisen Türkei Pera Air Travel
312 Intertravel Reisebüro GmbH in

Intertravel Reisebüro GmbH in 1010 Wien bietet Ihnen ein breites Angebot an unterschiedlichen Reisen wie ... Reservierung Reise?Länderinfo Traveldoc Visum Wetter Routenplaner Miles More BA-CA Währungsumrechner
intertravel.at
313 Reiseversicherungen.at Informationen zum

reiseversicherungen.at ist Ihre erste und beste Informationsquelle über reiseversicherungen Hier finden Sie auch weitere ... + reise-versicherungen Weitere Links Der Inhaber dieser Domain parkt diese beim
reise-versicherungen.at
314 Reiseausruestung.at Informationen zum

reiseausruestung.at ist Ihre erste und beste Informationsquelle über reiseausruestung Hier finden Sie auch weitere ... + reise-ausruestung Weitere Links Der Inhaber dieser Domain parkt diese beim Domain
reise-ausruestung.at
315 Reisebueros.at Informationen zum

reisebueros.at ist Ihre erste und beste Informationsquelle über reisebueros Hier finden Sie auch weitere ... + reise-bueros Weitere Links Der Inhaber dieser Domain parkt diese beim Domain
reise-bueros.at
316 Busreisen Steiermark Menapace Menapace

Gerne stellen wir Ihnen uns unsere Leistungen und unser Reiseprogramm mit dem dazugehörigen Service ... von Menapace Reisen. weiter http//static.clearsense//upload/imgproc/bg.jpg Reisevorschau
menapace-reisen.at Menapace Reisen Busreisen Steiermark Reisebusunternehmen
317 Unsere Reisen nach Kuba Reisebericht
8444
St. Andrä i. S.
Reisebericht unserer Reisen nach London Paris Amsterdam Rom Kuba Aegypten ... Gerhard und Bianca Hallo Leute das ist die Reise-Homepage von Gerhard und Bianca. Hier könnt
machersjunior.at Reisebericht USA Kalifornien Travel Barcelona
318 Reisesuchmaschine Reisepreisvergleich Reisesuchmaschine

Online günstig Urlaub buchen Reise Preisvergleich inklusive Discount Reiseangebote Mallorca Urlaub aktuell super ... Flug Eigene Anreise Städtereisen Baustein-Reisen Mietwagen Reiseangebote Dynamische Pauschalreisen
reise-suchmaschiene.at Reisesuchmaschine Reiseangebote Günstig Urlaub Buchen
319 Grenzenlos Barrierefrei Reisen barrierefrei
8344
Bad Gleichenberg
Ob im Sommer oder Winter aktiv oder gemütlich hier finden Sie barrierefreien Urlaub ... BARRIEREFREI REISEN begrüßt Sie recht herzlich! Barrierefreiheit Wunderschöne Reisen für Menschen
barrierefrei-reisen.at Barrierefrei Reisen Grenzenlos Fauster
320 Home Gabriele Bernsdeiner Gabriele

Kraftvolle und berührende Reisen in Asturien ... Kraftreisen in Asturien menu Home Reisen Energia-Asturias Naturaleza-Asturias Tierra-Asturias Gaia
bernsdeiner.at Gabriele Bernsdeiner Shiatsu Oviedo Asturien
321 ATV Akademischer Turnverein Linz ATV
4020
Linz
ATV Akademischer Turnverein Linz turnen geräteturnen laufen freundschaft verbindung kultur sport schitour gemeinschaft bewegung leichtathletik ... verbindung kultur sport schitour gemeinschaft bewegung leichtathletik reisen berg wandern tradition ball
atv-linz.at ATV Akademischer Turnverein Linz Geräteturnen Laufen Freundschaft Verbindung
322 Neuen Weg zu meinem Mental

Es geht um Gefuehrte Mental Reise Mental Training Lebensberatung ... ------------------------- www.gefuehrtementalreise/ Startseite - Geführte Mental Reise ? Geführte Mental Reise Geführte Mental Reise Mentaltraining
gefuehrtementalreise.at Mental Training Beratung Lebensberatung Gluecksberatung
323 Flüge | Flug flug
81240
Olching - München
Buchen Sie Flüge online. Flug und Reise einfach buchen. ... Flug Home Flüge Hotel Hotels Wien Hotels Salzburg Reisen Last Minute Mietwagen Länder Informationen
flug.at Flug Flüge Reisen Buchen
324 Home: Trident Travel Pauschalreisen

Trident Travel Ihr Partner bei Reisen aller Art in 1050 Wien ... Trident Travel Aktiv Reisen Hier finden Sie alle Infos zu unseren Skitourenreisen Wanderurlaub Erlebnis
trident.at Pauschalreisen Cluburlaub Fernreisen Hitflüge Städtereisen Rundreisen Wellness K
325 MaxReisener.at Badminton badminton
21337
Lüneburg
Hier informiert Sie MaxPhilipp Reisener aus Lüneburg über die Sportart Badminton ... Reisener zum Thema Badminton
max-reisener.at Badminton Max Reisener Maxphilipp Philipp Reisener
326 Reisen mit Karawane: EntdeckenErlebenErholen Touristik-Versicherungs-Service GmbH
22453
Hamburg
Reisen nach Australien Neuseeland Südsee Afrika Südamerika USA Kanada ... Länderkombinationen Äthiopien Äthiopien Reisen Länderhinweise Botswana Besondere Angebote Mietwagenreisen WD
karawane.at
327 Home | Traverdo.de

Traverdo.de: Inspirierende gesunde und nachhaltige Reisen und Unterkünfte weltweit. Garantierte Nachhaltigkeit der Angebote durch ... Kunst und Kultur Städtereisen Kulinarische Reisen Sprachreisen Kunstreisen Alte Zivilisationen Musik
traverdo.at
328 Busreisen Vorarlberg Fechtig Busreisen

Willkommen bei Fechtig Busreisen in Vorarlberg freuen Sie sich auf sichere komfortable und ... Fechtig Reisen - Ihr Partner in Vorarlberg! Profitieren Sie von unserer langjährigen Erfahrung
fechtig-reisen.at Busreisen Vorarlberg
329 Turus.net Magazin Fußball Ströer Digital Media GmbH Sport
22769
Hamburg
turus.net ist das Magazin für Reportage und Fotos aus Fußball Fankultur Radsport
turus.at Sport Fußball Fankultur Radsport
330 BeratungCoaching Veraenderung Verbesserung: Mental
2344
Maria Enzersdorf
Es geht um Gefuehrte Mental Reise Mental Training Lebensberatung ... ------------------------- www.beratungfuermich .at Startseite - Beratung für mich ? Beratung Coaching Workshops und Seminar
beratungfuermich.at Mental Training Beratung Lebensberatung Gluecksberatung
331 Lastminute Ferien Reisen Lastminute

Lastminute Ferien Reisen günstige Reiseangebote im Internet Reisebüro online vergleichen buchen! Arrangement
lastminuteferien.at Lastminute Ferien Reisen Günstige
332 Nur Reisen

... Reiselinks Startseite Reisen Billigflüge Ferienwohnungen Lastminute Kreuzfahrten Buchungshotline
nur-reisen.at
333 Lufthansa City Center ? Flights

Lufthansa City Center günstige Lastminute Reisen Flüge Hotels Städtereisen Mietwagen ... Reisen HomePage Bevorzugte Partner Online- Buchungen Flüge Low-cost Carrier Hotel Mietauto Ihre Anfrage
gaertner.at Flights Worldwide
334 Reisebüro Traunwieser GmbH Reisebüro Traunwieser GmbH Reisebüro
5201
Seekirchen am Wallersee
Reisebüro Mietwagen Traunwieser Seekirchen St.Gilgen Herzlich Willkommen im Urlaub ... Nützliche Wichtige Links Kontakt Newsletter Kontakt So finden Sie uns Datenschutz Reise suchen
traunwieser.at Reisebüro Mietwagen Traunwieser Seekirchen St.Gilgen Urlaub Reisen Ferien
335 LAGUNA REISEN Ihr Laguna

... Laguna Reisen Angebote Restplatz Magic Life Lastminute Hotel online Hotel online Mietwagen online
lagunareisen.at Laguna Reisen Laguna Reisen ÖVT OEVT WIN Win
336 Flüge vergleichen und günstig urlaub

Reisen zu günstigen Preisen sofort online buchen +++ Top Angebote für Ihren Urlaub ... Wochen HP im DZ Jetzt schon ab € Reisen Frühbucher Pauschalreisen All Inclusive Beauty Wellness
aerolloyd.at Urlaub Reise Urlaub Günstig Urlaub

Reise Reisen Safari IndividualreisenReisen Österreich Reise - Die Öffnungszeiten können zu Feiertagen Karneval, Valentinstag, Ostern (Karfreitag Ostersonntag Ostermontag), Tag der Arbeit und Himmelfahrt abweichen. Statistiken: 4 StadtBranche Punkte für "Reise " - In die Bewertung wird die Anzahl der Besucher und Erfahrungsberichte dieser Themenseite mit einbezogen. Reise › Reisen Safari Individualreisen Österreich - Reise Bewertungen Öffnungszeiten und Erfahrungen. Stand:

Neuer Eintrag 

Der Begriff Reise bedeutet im Sinne der Verkehrswirtschaft die Fortbewegung von Personen über eine längere Zeit zu Fuß oder mit Verkehrsmitteln außerhalb des Warenverkehrs, um ein einzelnes Ziel zu erreichen oder mehrere Orte kennenzulernen . Auch im Wirtschaftsverkehr werden Reisen unternommen . Im fremdenverkehrswirtschaftlichen Sinne umfasst eine Reise sowohl die Ortsveränderung selbst als auch den Aufenthalt am Zielort. Die verwendeten Verkehrsmittel bilden hierbei eine sogenannte Reisekette . Reise Öffnungszeit und Erfahrungen

△ nach oben kostenfreier Eintrag Datenschutz