Reise › Reisen Safari Individualreisen Österreich


Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 Herr Markus Karner Reisen

Bad st. Leonhard
Die Vorfreude ist die schönste Freude, so sagt der Volksmund. Das trifft sicher auch auf die schönste Zeit des Jahres.. Zeit Urlaub Markus Urlaubmarkus Urlaubsreisen Urlaubsziele Gratis Preisen Reise Price Saison Garantie Wer Reisebüro Kurzreisen
2 SFA Sprachreisen Sprachreisen

SFA Sprachreisen in Salzburg und Wien bieten Sprachreisen und Sprachferien in England, Frankreich und den USA in Englisch, Französisch, Italienisch.. Sprachreisen Jugendliche Erwachsene Sprachferien Wien Salzburg Ausland Schulklassen Angebote Katalog Sprache Reise St San Unterbringung
3 Hagleitner Touristik – Genuss Reisebüro

Zell am See
Wer auf der Suche nach Genussurlaub oder Gourmetreisen ist, ist beim Profi für Genussreisen Marion Hagleitner Touristik genau richtig. Hagleitner.. Gtgtgt Radreisen Genussreise Touristik Buchen Hagleitner Italien österreich Gourmetreisen Entdecken Deutschland Genussreisen Genuss Genussurlaub Datenleitung Sicherer Finden Adria
4 PromoMasters Online Marketing Wien Suchmaschinenoptimierung

PromoMasters Wien ist Spezialist für Suchmaschinenmarketing, Suchmaschinenoptimierung SEO, Suchmaschinenwerbung SEA und AdWords sowie Analytics. Die Agentur mit Sitz in Wien.. Google Promomasters Suchmaschinenoptimierung Blog Website Media Social Adwords Responsive Seo Tipps Schulung Open Relaunch Salzburg Reise Assistent Graph Tablets Suchmaschinenmarketing Tourismus
5 Gutscheine Gewinnspiele sowie Online-Shops aller Art Gutscheine Gewinnspiele sowie Online-Shops Werbeagentur

Weißkirchen in Steiermark
Discount Portal bietet seriöse, geprüfte Gutscheine und Gewinnspiele an, die täglich aktualisiert und ergänzt werden. Nebenbei werden Online-Shopping sehr leicht gemacht.. Gewinnspiele Gutscheine Discount Besten Urlaubsportale Portal Reise Gratis Testenz Produte
6 Flughafentaxi Wien Taxiunternehmen

Flughafentaxi Wien - Der kostengünstigste Reise ohne Stress Flughafentaxi Wien bedient seit über 5 Jahren den Transportbedarf des Flughafen in Wien... Flughafen Wien Reise Flughafentaxi Passagiere Kunden Schritt Handgepäck Koffer Fahrer Stk Faq Taxi Fahrt Bestellen Meeting Bustransferherumschlagen Transfer
7 Reisebus mieten Reise

Naderer bietet ein breitgefächertes Angebot von individuellen Tagesausflügen über organisierte Mehrtagesfahrten bis hin zu längeren Urlauben. Als Reisedienstleister plant.. Reise Bus Mieten Busreise Linz Naderer Reisebus Reisekalender Rückfahrt Kleinbus Anfrage Zusätzliche Angebot Preis Versicherungen Pauschalreisen Zeit Einzelzimmer Fahrzeiten Browser
8 Individualpädagogik Projekt Kanu bauen Kanutrekking Individualpädagogik Projekt Kanu bauen Individualpädagogik Sozialpädagogik

Wiener Neustadt
Eine erlebnispädagogische Reise mit dem Kanu - vom Selbstbau bis zur Ausfahrt Ich biete erlebnispädagogische Kanu Bau Workshops an, in welchen.. Kanu Kanus Kanubauen Bauen Angebot Trekking Pixeliode Kanutrekking Kinder Behinderung Erlebnispdagogik Stunde Stunden Jugendlichen Schiffsbau Sperrholz Zeta Preisanbotes Reise
9 Private Rundreisen auf Sri Reise

Individuelle Rundreisen und Ausflüge auf Sri Lanka - angeboten von Ihrem privaten Fahrer Kapila Bandara.. Lanka Holiday Kapila Bandara Tours Driver Sri Private Contact Reviews Culture Nature Kotalawala Kapila@hotmailcom Y
10 Reisesuchmaschine Reisevermittlung

Reisepreisvergleich, online Buchung und Beratung quer durch den Bereich Tourismus. Neben den Pauschalreisen, Flüge und Hotels gehören auch Rundreisen, Kreuzfahrten.. Reise Urlaub Anreise Eigene Flug Reisen Buchen Pauschalreisen Sommerurlaub Minute Italien Reisesuchmaschine Last Hotel Günstig Schweiz Paris
11 Ristorante il Cavallino Baden Italienisches Restaurant

… im Ristorante il Cavallino, dem neuen Badener Treffpunkt für alle Freunde der feinen italienischen Küche. Begeben Sie sich mit.. Ristorante Cavallino Zutaten Baden Restaurant Fotos Speisekarte Cucina Italienische Atmospäre Begeben Freunde Muss– Reise Welt
12 Christina Gritsch Altwaren Räumungen

Zeitreise, Historische Möbel, Antike Möbel, Räumungen, 50er, 60er, 70er, 80er, Schallplatten, Bücher, Teppiche, Antiquitäten, Gritsch, Puppen, Tische, Möbel, Regale, Verlassenschaften.. Zeitreise Herzlichst Platz Christina Spezialistin Glas Porzellan Möbel Mich Geschäft Reise Musik Angebot Gebrauchtwaren Schnitzelklopfer Verlassenschaft Epochen Lassen Ostern Möbel Kleinteile
13 Vorarlberg-Hotels Reise

Vorarlberg-Hotels ist ein unabhängiger Blog. Wir stellen Ihnen hier regelmässig Hotels im Ländle vor, die wir selbst getestet haben... Hotel Hotels Leave Posted Vorarlberg Kleinwalsertal Zimmer Hirschegg Montafon Dornbirn Schruns Bezau Silbertal Tagged Scesaplana
14 La Vida Bella - Lebensberatung

Ich nehme mir bewusst Zeit, für Sie hier zu sein, um Sie und Ihre Themen kennen zu lernen. Mit diversen.. Text Bitte Eingabefeld Mail Vinothchandar Schritt Reise Nachricht Entscheidung Vida Bella Unterstützt Name Webnode Ecke Reiki Mein Ch
15 Ferienwohnung Galtür Reise

Ferienwohnung Paznaun.. Tirol Urlaub Galtür Ferienwohnungen Oostenrijk Vakantiewoning Reizen Schönen Land Ferienwohnung Unser Ferienhäuser Ferienwohnungs Winterurlaubtirol Y
16 Koffer und Taschen Lederwaren

Ein Fachgeschäft für praktische Reisekoffer, Trollys, Reisetaschen und Reisebedarf für sicheres und bequemes reisen.Modische Taschen und Geldbörsen. Aktuell-Billig-Chick. Seit 25.. Lederwaren Wien Reise Taschen Reisetasche Geldtaschen Abc Koffer Freizeit Kabinengrösse Reisen Shopping Angebote Businessschule Reisegepäck Aktuell Billig Chic Lederbörsen Qualität
17 Koffer und Taschen Lederwaren

Ein Fachgeschäft für praktische Reisekoffer, Trollys, Reisetaschen und Reisebedarf für sicheres und bequemes reisen.Modische Taschen und Geldbörsen. Große Auswahl an.. Lederwaren Wien Reise Geldtaschen Taschen Abc Reisetasche Koffer Reiseaccesoires Reisekoffer Shopping Kabinengrösse Reisegepäck Angebote Reisen Modische Lederbörsen Laptoptaschen
18 Marokko Reisen vom Spezialisten Reiseveranstalter

Erleben Sie die Vielfalt und Gastfreundlichkeit Marokkos auf einer Individual- oder Gruppenreise. Seit 39 Jahren sind wir darauf spezialisiert, Ihren.. Reisen Marokko Ritz Land Katalog Golfreisen Individuelle Leute Reise Golf Marokkoreisen Städtereisen Golfplätze Kontaktformular Vertragsbedingungen Reiseziel
19 Urlaub am Klopeinersee Reise

Wir von Einfach Klopeinersee bieten ausgewählte Unterkünfte in verschiedenen Preiskategorien am Klopeinersee an. Ob ein einfaches Zimmer im Zentrum.. Klopeinersee Einfach Klopeiner Deine Unterkünfte Urlaub Zimmer Pension Unterkunft Badesteg Funktionierts Google+ Hotel Faqs Unterkünften Sende
20 Satur reisen Satur

Satur reisen ... Satur reisen AKTUELL INDIVIDUELL UND GRUPPENREISEN Hohen Tatra Zipser Land Holzkirchen UNESCO Satur Reisen
21 KrennReisen krenn
Bad Gleichenberg
Krenn Reisen ... Krenn-Reisen Gesellig Aktiv Gourmet Busse mieten Suche Busse mieten? + Krenn Reise Reisen Gourmet Pilgern Wallfahrt Bus Shuttle
22 Individuelle Reisen weltweit | Reisen

Weltweite Reisen individuell zusammenstellen. MESO Reisen Ihr Reiseveranstalter für Fernreisen. ... oder infomeso-berlin Alternativ Tours GmbH MESO Reisen GmbH Reisebüro Berlin Otto-Suhr-Allee Reisen Individuell MESO Reisen MESO Reisen Berlin Weltweit
23 ClubReisen: Hier finden Sie ClubReisen

ClubReisen: Finden Sie aktuelle Angebote zu ClubReisen. Viele Infos und alle Angebote. Sparen Sie bis ...  Club-Reisen Hier finden Sie alles zu Club-Reisen Club-Reisen Club Aldiana Club Robinson Club ClubReisen
24 IslandReisen Ihr Islandreise Spezialist Island

IslandReisen Ihr Islandreise Spezialist Agentur für Reisen nach Island ... + - Kontakt Katalog Menu Pauschalreisen Minigruppen Reisen Island Reise Islandreise Islandreisen Island
25 Reisen Restplatz billig Urlaub traviaNET GmbH Urlaub
Urlaub Reisen Restplatz Italien Restplätze Reisen billig Günstige Reisen Portugal ... Restplätze Cancun Reisen Spanien Restplatz Türkei Billige Reisen Griechenland billig Reisen Kreta Urlaub Reisen Spanien Restplatz
26 Strohmeier Reisen Ihr Reisen

Mit Strohmeier Reisen reisen. Ihr Partner für entspanntes Reisen. ...  Strohmeier Reisen - Ihr Partner für entspanntes Reisen Ihr Partner für entspanntes Reisen Reisen Busfahrten Steiermark Wettmannstätten
27 ReiseInsider das österreichische Reise

Reise Insider ... Ein Roadtrip auf dem südlichsten Abschnitt des Highway in Florida - hier heißt es reisen statt... weiterlesen Reise Insider Reiseportal Reiseblog
28 GOSCH reisen Tagesfahrten Michaela und Franz Gosch OG GOSCH
GOSCH Reisen. Tagesfahrten. ... Highlights Reise-Highlights Reiseeindrücke Reisen Tagesfahrten Mehrtagesfahrten GOSCH Reisen Tagesfahrten
29 Reisebausteine Reisen weltweit reisebausteine

Auf finden Sie mehr als 6000 Angebote und Reise Ideen weltweit preiswert und mit ... ..... gleich geht es weiter zu den Reise Angeboten auf reisebausteine Reisebausteine Reisen Reise Urlaub
30 Besser REISEN das Besser

besser REISEN Das Österreichische Reiseportal ... Home Reise News Auf Tour Österreich City-Trip Service Lifestyle Angebote besser REISEN-Tipps Besser Reisen Reisetipps LastMinute Kreuzfahrten
31 Homepage Hietz Reisen Hietz

Hietz Bus Reisen ... . WILLKOMMEN auf unserer Homepage von Hietz Reisen Gerne Hietz Bus Reisen Autobus Ausflug
32 Hermann und Susanne auf Hermann

Hermann und Susanne auf Reisen ... Hermann und Susanne auf Reisen Main menu About Home Meta Log in Entries RSS Comments RSS Hermann Und Susanne Auf Reisen
33 Lastminute Reise lastminute

Last Minute Urlaub zu Schnaeppchen Preisen reisedirekt: Direkt buchen direkt sparen. Grosser Reise und ... Minute Flüge Cluburlaub Kreuzfahrten » Hochseekreuzfahrten » Flusskreuzfahrten Lastminute Reise Über Lastminute Reise
34 Lastminute Reisen lastminute

Last Minute Urlaub zu Schnaeppchen Preisen reisedirekt: Direkt buchen direkt sparen. Grosser Reise und ... Minute Flüge Cluburlaub Kreuzfahrten » Hochseekreuzfahrten » Flusskreuzfahrten Lastminute Reisen Über Lastminute Reisen
35 Besser REISEN das Besser

besser REISEN Das Österreichische Reiseportal ... Home Auf Tour Österreich City-Trip Service Lifestyle Angebote besser REISEN-Tipps Printausgabe Besser Reisen Reisetipps LastMinute Kreuzfahrten
36 Günstig Reisen Reisen
Wien Günstig Reisen nah und fern Reisen für jedes Budget und Alter ... Reiseidee - Reisen weltweit Günstig Reisen nah und fern Asien Baden Tauchen Asien Indien Reisen Indonesien Reisen Reise Rundreisen Rundreise
37 Willkommen bei mit Reisen mit Reisen GmbH mit
mit Reisen bietet Ihnen Urlaubs Geschäfts und IncentiveReisen aus einer Hand. Bei uns stehen ... Sie Javascript und laden Sie die Seite neu! Home Was wir machen Reiseziele Team Kontakt Willkommen bei mit Reisen Mit Reisen Sommerurlaub Urlaub Linz
38 Reisebüro Kerschner Reisen Kerschner Reisen GmbH Reisebüro
Webauftritt des Reisebüro Kerschner Reisen. ... Navigation überspringen Start Kerschner Reisen Ski-Express Reiseangebote Event-Bus Kataloge Reisebüro Busunternehmen TUI Reise Center
39 RISA Reisen | Reisen gruppenreise
RISA Reisen ? Ihr Reiseveranstalter für Südamerika! Hier finden Sie Ideen für Reisen im Mietwagen ... + - inforisa-reisen RISA Reisen Reisen in Südamerika Gruppenreise Rundreise Reiseveranstalter Suedamerika Reisen Mietwagen Klei
40 Herzlich Willkommen bei Ratzenböck Reisebüro

Ratzenboeck Reisen stellt Sich das Reisebuero und die Reisen vor... Mit Freunden reisen! ... Sie über interessante Reisen informieren zu dürfen. Herzlich Willkommen bei Ratzenböck Reisen! Willkommen Wir freuen Reisebüro Autobus Reisebus Busreisen
41 Im Seekajak auf Reisen seekajak

Seekajak Reisen sind Aktiv Reisen mit einem Schuss Abenteuer. Im Seekajak kommt ihr an entlegene ... Seekajaktouren - Europa weltweit Start Im Kajak reisen? Seekajakreisen ? für wen? Seekajak Seekajak Seekajakreisen Aktiv Reisen Aktives
42 Mare Baltikum Reisen Christine Salten & Andres Vainumäe GbR reise
Mare Baltikum Reisen bietet Reisen nach Estland Lettland Litauen Skandinavien mit Finnland ... Lettland Litauen Finnland Polen Russland Norwegen Schweden Dänemark Reisen Gruppenreisen Kulturreisen Reise Baltikum Baltikum Reisen Reisen Im
43 Last Minute Touristik GmbH last
Last Minute Reisen mit persönlicher Beratung buchen ? günstige Reisen buchen ? Pauschalreisen mit Bestpreisgarantie ... Kreuzfahrten Ausflüge Kurzreisen Last Minute Last-Minute Reisen Reisen bis EUR - Pauschalreisen Günstige Last Minute Reisen Last Minute Urlaub
44 Jedek Reisen: Jedek Reisen jedek
JedekReisen: Ihr Spezialist für den etwas anderen Urlaub ... Pauschalreisen Mexico Home AGB Links Newsletter Jedek Reisen GmbH Jedek Reisen Jedekreisen Urlaub
45 NESS Reisen Ness

Wir sind gerne für Sie da: NESS Reisen GmbH. Dammstr. 6 1200 Wien ... NESS Reisen Menü Kontakt Kataloge online Newsletter Angebote Sonderangebote Online Buchungstool Ness Reisen NessReisen Ness Reisen
46 Magisch Reisen Magisch

Magisch Reisen Magisch Reisen
47 Gegg Reisen Exklusiv Luxus

Gegg Reisen Busreisen und vieles mehr! Leben ist Bewegung Bewegung ist Reisen ... AKTUELL Gegg Reisekatalog >Reiseträume < jetzt erhältlich Der neue Gegg-Reisen Katalog >Reiseträume Luxus Bistro Bistrobus Setra
48 Last Minute Reisen Angebote Holiday Smart GmbH Last
Last Minute Reisen Angebote im Überblick von allen Veranstaltern finden Sie hier. Ihr ... Last Minute Reisen Angebote Last Minute Reisen Angebote können Sie ganz einfach hier vergleichen Last Minute Angebote Last Minute Reisen Angebote
49 Reiseangebote im reisesuchmaschine

Flug reisen Luxusreisen billig reisen Pauschalreisen und auch eigene Anreise last ... Städtereisen Baustein-Reisen Mietwagen Kreuzfahrt Wellness Sonstige Angebote Sterne Luxusreisen Reisen Reisesuchmaschine Flugreisen Sommerurlaub Winterurlaub
50 Reisen direkt Reisen Ferien ferien

Ferien und Reisen zu Schnaeppchen Preisen reisedirekt: Direkt buchen direkt sparen. Grosser Reise und ...  Reisen direkt Reisen Ferien buchen - direkt sparen Inline HTML Online Reiseanfrage oder Live Ferien Reisen Urlaub
51 Reiseberichte auf Reiseziele

Reiseziele Reise Urlaub USA Reisebericht Reiseinfo ... auf Reise-Ziele! Reiseziele Reise Urlaub USA Reisebericht Reiseinfo
52 Romania Touristik / RotReisen Ihre

Ihre Reise Spezialistäten für gelungene maßgeschneiderte Reisen und Urlaube! ... lunii! Profitati de reducere % din preturile afisate! Gruppenangebote Reisen und sparen mit netter Ihre +Reise +Spezialisten Für Gelungene Maßgeschneiderte+ Reisen* Und
53 SchweizerReisen Startseite Schweizer

SchweizerReisen in Korneuburg bietet exquisite Studien und Kulturreisen ... Menu Startseite Startseite ÖCV und MKV Reisen ÖCV und MKV Reisen Allgäu und Vorarlberg Allgäu Schweizer Reisen Studienreisen Kulturreisen Busreisen
54 REISEaktuell Das österreichische CB-Verlags GesmbH Reise
REISEaktuell eines der attraktivsten Reisemagazine aus Österreich informiert mit Top News zum Thema ... Executive Club Herzlich Willkommen! REISE-aktuell das internationale Reise-Journal konkretisiert Reise Magazin Reisemagazin Reise Aktuell
55 Lifeearthreisen Home Reisen

LifeearthReisen ... im Regenwald von Madagaskar mit Blind Climber Andy Holzer Diesmal führt die Reise mit Andy Holzer Reisen Afrika Asien Amerika
56 Reisen Leben notizen
Notizen zu Freizeit Reisen Leben Arbeit ... Navigation Freizeit Notizen Reisen Notizen Leben Notizen Arbeit Notizen Allgemein Startseite Notizen At Freizeit Reisen
57 Weinstadt Reisebüro Fischer Reisen reisen

Fischer Touristik Reisen ... Fischer Touristik - Weinstadt Startseite Reisen Hotel Kreuzfahrten Ferienhaus/Wohnung Mietwagen Reisen Weinstadt Lastminute Pauschalreisen Fischer Touristik Kreuzfahrt
58 Lidl Reisen ...einfach Lidl E-Commerce International GmbH & Co. KG Lidl
LidlReisen sind spannende und erholsame Reisen zu unglaublich günstigen Preisen in die ganze Welt ...einfach ... um alle Funktionen unserer Seite nutzen zu können. Zur Navigation springen Zum Inhalt springen Lidl Reisen ...einfach Lidl Reisen LidlReisen Flugreisen
59 Weiss Reisen Reisebüro Weiss

Ihr Reisebüro WeissReisen Bus Schiffs und Flugreisen. 5280 Braunau ... Reisebüropartner Reiseversicherung Kontakt Herzlich Willkommen bei Weiss-Reisen in Braunau Weiss-Reisen Weiss Reisebüro Reisen Busreisen Flugreisen
60 Neuhuber Reisen Neuhuber
Neuhuber Reisen Österreichs erstes MOBILES REISEBÜRO mit Sitz in Villach Kärnten ... . Makunudu Malediven Ich sehe mich als Ihr Guide und persönlicher Reise-Berater durch den wirren Angebots Neuhuber Reisen Elke Neuhuber Reisebüro
61 Bixi: Ski Rennrad rennrad
Bixi's SlowRide rennrad reisen und skireisen Homepage ... Rennrad-Reisen zum Marathon Nove Colli - Cesenatico .. - .. Die Reise zum Maratona Rennrad Reisen Radmarathon Ski Tiefschnee Slowride Bixi
62 Pernsteiner Reisen: Startseite Pernsteiner GmbH Pernsteiner
Kirchberg ob der Donau
Pernsteiner Reisen Reisebüro Reiseberater Reiseführer ... Reisefotos Fahrpläne Neu aktuelle Reisen NEU! Musical Mary Poppins im Ronacher Theater Samstag . Dezember Pernsteiner Reisen Reisebüro Busreisen Tagesreisen
63 AusserfernReisen Bernhard Holaschke Reisen

Ausserfern Reisen Reisebüro in Ehrwald Tirol Bernhard Holaschke ... Freitag .. Start Ausserfern Reisen - Bernhard Holaschke Home News Kontakt Bilder Login Reisen Urlaub Winter Sommer
64 Die Website Weekend

Die Website rund um das Thema Reisen Urlaub in Österreich ReiseNews uvm.! ... Wir unternehmen je . Einwohnern die meisten Reisen darunter auch Fernreisen und geben mit die höchsten Weekend Österreich Navigator ReiseNews
65 Wien Reise Kurzreise

Die Reisen nach Wien werden immer in Erinnerung bleiben denn nach einem Besuch ... WWW.REISEN-WIEN.AT Infos und Tipps Reisen Wien Sehenswürdigkeiten Alltagskultur Infrastruktur Kurzreise Wien Wien Kurzreisen Wien Reisen
66 Mayerhofer Reisen Home Mayerhofer

Mayerhofer Reisen Reisebüro Reisebusse Taxi Personenbeförderung ... . >> www.europaeische Allgemeine Reisebedingungen Für unsere Reisen gelten die Allgemeinen Reisebedingungen (ARB Mayerhofer Reisen Mayerhofer Reisen Hubert
67 Alaska reisen alaskatravel
Willkommen bei ALASKA REISEN erleben Sie mit uns unvergessliche Reiseeindrücke ... alaska reisen Direkt zum Seiteninhalt Hauptmenü Homepage PROGRAMM FOTOGALERIE Album Album Alaskatravel Alaska Travel Alaskatravel Alaskareisen
68 Reise Stornoversicherung Reise
Reise Stornoversicherung Die Reiseversicherung für Österreich mit unserem Vergleichsrechner finden Sie schnell und ... Sie? Vergleichsrechner Reise - Stornoversicherung Vergleich Reise Stornoversicherung für Reisende aus Österreich Reise Stornoversicherung Reiseversicherung
69 Aydin Reisen Startseite Reisebüro
Aydin Reisen Reisebüro in Lustenau/Vorarlberg. Tel. 05577 89981 ... bei Aydin Reisen! Wir freuen uns Sie über aktuelle Reiseangebote informieren zu dürfen. Unser Personal steht Reisebüro Türkei Istanbul Reisen
70 Die schönsten Reisen zu Urlaub
W i e n
Die besten Anbieter für Ihre Reise vergleichen Sie die Preise es lohnt sich! ... Die schönsten Reisen zu besten Preisen! Flüge Die Flughhäfen der Welt - die günstigsten Flüge Urlaub Reisen Flüge Hotels
71 M.e.i.e.r Reisen Erleben Urlaubsreisen tür

Verreisen Sie mit M.e.i.e.r Reisen Türkeireisen zu günstigen Preisen. Jetzt zuschlagen und in der ... HOME TOP Angebote Dubai Infos zur Reise Termine Preise Türkei Termine Preise Infos zur Reise Urlaubsreisen Türkei Meier Reisen
72 Online Reise Billiger

Billiger Reisen günstiger fliegen Last Minute Angebote und Mietwagen Preisvergleich. Das alles finden ... www.ORP Online Reise Portal Hotelsuche Mietwagen Last-Minute Ski Snwoboard Billiger Reisen Günstiger Fliegen
73 Freund Reisen Mayrhofen Zillertal Freund

Freund Reisen Reisefreund das Reisebüro in Tirol ... Freund Reisen Mayrhofen Zillertal reisefreund Reisebuero online buchen Last Minute Freund Reisen Reisefreund Das Reisebüro In Tirol
74 Türkei Reise Urlaub ÖGER TOURS GmbH Türkei
Ihr Reiseanbieter für Türkei Urlaub Reisen Städtereisen und Hotels. Buchen Sie "günstige" Reiseangebote ... Preishits Reisen unter - ? Hoteltipp Türkei Toggle submenu Aktivurlaub Toggle submenu Ausflüge Türkei Reisen Türkeireisen Türkei Reisen Türkei Urlaub Türkeireisen
75 Vatkov Reisen Vatkov Vatkov

??????????? ????????????? ???????? VATKOV REISEN GmbH ?????????? ??????? ???????? ????????? ? ??????? ??????????? ?????????? ... No images ??????? ???????? ????????? ????????? ??????? VATKOV REISEN GmbH + Vatkov Reisen ????????????? ???????? ???????????
76 Schröfelbauer reisen Schröfelbauer
Ich lege großen Wert auf Qualität das heißt bei allen unseren Reisen sind genug ... Reiseecke in Gaming Schröfelbauer Reisen Gaming Markt Gaming Telefon texing Schröfelbauer; Schroefelbauer; Reisen; Texingtaler Taxi; Texing; Texingtal; Taxi

Mit Taxi Heidis Reisen reisen Sie bequemer von A nach B. ... HOME FUHRPARK KRANKENTRANSPORT KONTAKT > CHEFSACHE > CATS DOGS TAXI HEIDIS REISEN - die feinere Taxi Tranfser Flughafentaxi Jugendtaxi Businessfahrzeug Krankentransport Kinderg
78 Busch Pedit Reisen Busreisen

Busreisen Reisen Bus Busch Pedit Mietbusse BusCharter ... BUSUNTERNEHMEN mit sehr dynamischer Entwicklung und haben unsere Tätigkeit unter das Motto REISEN MIT SERVICE Busreisen Reisen Busunternehmen Innsbruck
79 MusicCorn WorkshopReisen 2014 Corn GmbH Workshop
"MusicCorn Reisen" ist ein Angebot des Musikhauses MusicCorn. Wir bieten WorkshopReisenGesamtpakete: Anreise Unterkunft ... Musik-Workshop-Reisen Reisen Kontakt ARB Workshop-Reise Gitarre .. - . Workshop; Reise; Reisen; Urlaub; Workshop; Kurs; Seminar; Musik
80 SportivReisen vereint Urlaub mit Sportreisen
SportivReisen vereint Urlaub mit Fitness. ... Das Team FSC Sport-Shop Kontakt Sportiv-Reisen vereint Urlaub mit Fitness. Sportivreisen intern Sportreisen Sport Reisen Afterwork Training
81 Hammertinger Reisen .:. Home Reisen
Frankenburg am Hausruck
Hammertinger Reisen in Frankenburg. Ihr Spezialist für Reisen Kurreisen Wallfahrten Badefahrten ... Reisen Tagesfahrten Adventsfahrten Wellnessreisen Musikfahrten Flugreisen Kreuzfahrten Wallfahrten Reisen Kurreisen Wallfahrten Badefahrten
82 MairReisen Wattens Willkommen Mair Reisen GmbH Mair
MairReisen Wattens Ihr Partner wenn Sie ein Busunternehmen mit viel Komfort suchen. Vom ... -Race in Schladming Firmenevents oder Vereinsausflüge - mit Mair-Reisen ist eine entspannte Mair Reisen Bus Reise
83 Egons Reise Egons
Egons verrückte Reise Ein Hörbuch mit Liedern und Dialogen von Simon Kräutler Michael Schefts ... Egons verrückte Reise Egons Familie Facebook Downloads Kontakt Kontakt Egons verrückte Egons Reise Egon´s Reise Egon´s Verrückte
84 Reisen nach Südamerika INTI Tours e.K. Reisen
INIT Tours ist ein spezialisierter Reiseveranstalter für nachhaltige Reisen nach Südamerika Mittelamerika und in ... Eisenbahnromantik Studienreisen ? INTI Tours > Reisen nach Südamerika Mittelamerika und in die Karibik Herzlich Reisen Nach Südamerika Reisen Nach Mittelamerika
85  sabtours Reisen sabtours

sabtours bietet Busreisen Flugreisen Kreuzfahrten Pauschalreisen und vieles mehr. In unseren 18 ... zum Reiseblog erweiterte Suche sab-reisen Busreisen Flugreisen Städtereisen Fernreisen Badereisen Sabtours Reisen Sabreisen Sabcruises Sabbusse
86 INTER VEGA REISEN I.V.R Reisebüro GmbH Intervegareisen
Intervegareisen Ihr zuverlässiger Partner für jede Reise dieser Welt! ... Sofia City Break Rundreise Bulgarien Tage Sommelier Trip Matura Reise nach Bulgarien Intervegareisen INTERVEGAREISEN Inter Vega
87  sabtours Reisen sabtours

sabtours bietet Busreisen Flugreisen Kreuzfahrten Pauschalreisen und vieles mehr. In unseren 18 ... erweiterte Suche sab-reisen Busreisen Flugreisen Städtereisen Fernreisen Badereisen Vital Sabtours Reisen Sabreisen Sabcruises Sabbusse
88 Was ist .reise? dotreise-registry GmbH
.reise die neue TopLevelDomain der Reisewirtschaft ... Über .reise Was ist .reise? Vision Vorteile von .reise Google wird .reise-Domains lieben Grusswort
89 Reisen24Online | günstig reisen günstig
Sankt Martin an der Raab
Reisesuchmaschine günstig Reisen | Preisvergleich und Angebote für Flüge Hotels und Ferienwohnungen ... News REISEGEWINNSPIEL REISE-NEWSLETTER Ausgezeichnet als "BestNewsletter"! Aktuelle Reiseangebote Günstig Reisen Billige Flüge Billige Hotels
90 Tromayer Reisen Bruchmann Alois e.U. Stefan
Stefan Tromayer Reisen Mönichwald Bus Taxi unternehmen für Eventreisen Ausflüge Krankentransporte ... mit Ihnen! Steigen Sie ein und fahren Sie mit uns. Â Gelo Systems Tromayer Reisen officetromayer-reisen Stefan Tromayer Tromayer Stefan Stefan
91  sabtours Reisen sabtours

sabtours bietet Busreisen Flugreisen Kreuzfahrten Pauschalreisen und vieles mehr. In unseren 18 ... Rufen Sie uns an für persönliche Beratung! Mo bis Sa ? sab-reisen Reisehits Sabtours Reisen Sabreisen Sabcruises Sabbusse
92 Lastminute Reisen Lastminute

Hier finden Sie Reise Angebote mit Tiefstpreisgarantie! ... Städtereisen Hotels . Wellness Wellness Reisen . The s.mile Family Reiseführer . Info-Service Auswertiges-Amt Lastminute Reiseangebote LastMinute Billigreise
93 Siebler Reisen Der siebler
Siebler Reisen ? Der Drautaler | Der Ansprechpartner für Ihre Reise Busreisen Taxi ... Siebler Reisen - Der Drautaler Reisebüro Busreisen Taxi Mietwagen Siebler Reisen Home Siebler Reisen Der Drautaler Irschen
94 Vietnam reisen individuel geführt ho

vietnam reisen individuel geführt mekong delta hanoi halon bay ... auf meiner Seite und viel Spass beim Anschauen und Auswählen +++ Wer sich auf die Reise nach Vietnam begibt Ho Chi Minh Hanoi Halong Bay Mui Ne
95 Schenker Reisen Schenker
Schenker Reisen Ihr Reisebüro für Ihren perfekten Urlaub reibungslose Geschäftsreise aufregende Gruppenreise ...  Schenker Reisen Startseite Kontakt Newsletter Unsere Website ist nicht für Schenker Reisebüro Innsbruck Urlaub
96 GloboReisen Erlebnisreisen Indonesien Kleines

Kleines Reisebüro Reisen nach Indonesien Reisen nach Bali Reisen nach Lomok Erlebnisreisen ... Sie den Vorteil dass ich selbst gerne reise! Kleines Reisebüro Gruppenreise Chile Chilereise
97 URLAUB IN BESTEN HÄNDEN Schauinsland-Reisen GmbH Schauinsland
Lastminute Pauschal nur Hotel oder nur Flug Angebote von SchauinslandReisen ... Teneriffa Hotel Iberostar Anthelia Schauinsland-Reisen GmbH Startseite Service Sitemap Anfahrt Schauinsland Reisen Urlaub Angebote Hotel Flug Pauschal Lastminute
98 Eine Reise zu sich Angelika

Erleben Sie mit den Klangschalen von Angelika Nagele in Klagenfurt eine Reise zu sich selbst ... Schenken sie sich und Ihren Lieben eine besondere Reise zu sich! Angelika Nagele Klangschalen Angelika Nagele Klangschalen Tiefenentspannung Schwingung Klagenfurt Reise Zus
99 SILMAR Reisen Start/home Sylvia

SILMAR Reisen ist Ihr kompetenter Reisebüro unweit von Wien! Bei Fragen oder Anregungen nehmen ... Reisen Journeys ..auf zu neuen Horizonten! new horizones! Reisen Journeys ..auf zu neuen Sylvia Gabauer Silmar Reisen Reisebüro Silmar
100 Canaren Reisebüro Fischer Reisen canaren

Fischer Touristik Canaren Reisen ... Fischer Touristik - Canaren - Kanaren Startseite Kanaren Reisen Hotel Kreuzfahrten Ferienhaus Canaren Canarischen Inseln Reisen Pauschalreisen Langzeiturlaub Canarische Insel
101 Über das Reisen Asien

Über das Reisen und Entdecken. Reisegeschichten Wolfgang Emerich aus Wien ... du auf meiner Seite gelandet bist. Ich publiziere hier Erlebnisse und Erfahrungen meiner Reisen nach Thailand Asien Südostasien Indien Thailand
102 Reise Reisen reise

Reise Reisen Lastminute Lastminutereisen zu TOP Preisen Urlaub pur mit Bestpreisgarantie ... Reise - Reisen - Lastminute - Lastminutereisen zu TOP Preisen - Urlaub pur mit Bestpreisgarantie Reise Reisen Lastminute Last Minute Lastminute Reisen Urlaub
103 ReisePreisvergleich Terracus Last

Aktuelle Urlaubsangebote Lastminute more Flug Hotel Mietwagen und preiswerte Reisen ... am um Urlaubsziel Dauer Erwachsene Kinder vom bis Reise- Lastminute-Angebote Rückruf-Service Last Minute Lastminute Reisen Urlaub
104 RATZ REISEN Reisen

Ratz Reisen ist Ihr verläßlicher Partner für BusReisen und Ausflugsfahrten. Auch Taxifahrten und Krankentransporte gehören ... Sie sicher ans Ziel INFO Das aktuelle Ausflugsprogramm finden Sie im Menü Angebote Ratz Reisen Taxi Reisen Ratz Ausflugsfahrten Busreisen
105 Reisen | Reisezeit ist Unterkunft
Unterkunft Anreise Kreuzfahrten Singlereisen Reisen mit Kindern Fastenreisen Rucksackreisen ... Benutzerdefinierte Suche Reise Unterkunft Anreise Kreuzfahrten Singlereisen Reisen mit Kindern Unterkunft Anreise Kreuzfahrten Singlereisen
106 Urlaub Reisen direkt urlaub
|? Urlaub amp; Reisen mit Qualität bei TUI buchen ? Direkt beim ... Urlaub Reisen direkt beim Reiseveranstalter buchen ? TUI TUI verwendet Cookies Urlaub Reisen Reiseveranstalter TUI
107 Billig Reisen buchen Last Billig

Die besten Reiseschnäppchen con Last Minute reisen und billig Reisen und Pauschalreisen sowie Flugreisen ... Reisen online buchen Lastminute Reisen Pauschalreisn Reisen buchen Urlaub Flugreisen Last Minute Reisen Billig Reisen Last Minute Reisen Billig
108 123start auf ins Radtouren

123start auf ins ReiseAbenteuer Reiseberichte unserer Radtouren Abenteuerreisen und Expeditionen Karin ... - Budapest . . - . . Abenteuer-Reisen (Karin und Clemens ohne Rad Radtouren Abenteuerreisen Expeditionen Reisen Karin Und Clemens Scheidhammer
109 Urlaub und Meer flüge

Buchen Sie Ihren Urlaub oder Ihre Reise günstig in Ihrem Online Reisebüro. Alle Flüge und ... Service Buchungsinformationen Home Flug Hotel Last Minute Pauschal- reisen Mietwagen Reise Flüge Billigflieger Hotels Urlaub
110 Asien Reisen Afrika reisen

Europa Reisen Reisen weltweit Reisepartnerbörse Reisen Südamerika Asien USA ... Startseite Reiseziele - Reisen Reisearten Ferienhaus Hotel Flug Transfer Mietwagen Camper Bahn Reisen Erlebnisreisen Rundreisen Südamerika
111 ::Franzl Reisen und Taxi Franzl
Franzl Reisen Ihr Reisepartner und Taxibetrieb in Niederau Wildschönau ... Home Busreisen Reisebüro Taxi-Kleinbus Kontakt Pension Herzlich willkommen bei Franzl Reisen Franzl Reisen Ausflugsreisen Tagesreisen Reisebüro
112 ITS BILLA REISEN Jung von Matt/Neckar GmbH Flüge
Willkommen bei ITS BILLA REISEN Lastminute Reisen sofort online buchen und in wenigen Tagen ... BILLA REISEN Startseite ITS BILLA REISEN Startseite Meine Merkliste Einen Moment bitte! Verfügbare Flüge Online Buchen Reisen Online Buchen
113 Kories Reisen Urlaub... Boutique
Sie suchen etwas Besonderes mit dem gewissen Etwas? Dann sind Sie bei uns richtig ... bei Kories Reisen. Sie suchen etwas Besonderes mit dem gewissen Etwas? Dann sind Sie bei uns richtig Boutique BoutiqueReisen Reise Reisen
114 Startseite Gansberger Reisen Impressum Gansberger Reisen GmbH Gansberger
Gansberger Reisen Niederrussbach Busreisen Busreise Flugreisen Flugreise Schiffsreise ... Herbst - Winter Gutschein anfordern Gansberger Reisen GmbH I Horner A- Niederrußbach I Tel Gansberger Reisen Niederrussbach Busreisen Busreise
115 Last Minute Reisen last

Urlaub im TÜV geprüften ReiseVergleich von Travel24 finden +++ Hier beim Spezialist Reisen Last ... Ihr Partner für Last Minute Reisen - Last Minute Urlaub buchen - Last Minute Last Minute Reisen Last Minute Last
116 Urlaub mit Schauinsland schauinsland-reisen gmbh Reisen
Urlaub mit SchauinslandReisen Lastminute Pauschal nur Hotel oder Flug Angebote ... . Mit großem Erfolg Kundenchampion Sri Lanka Clubhotel Dolphin Schauinsland-Reisen GmbH Startseite Reisen Urlaub Schauinsland Angebote Hotel Flug Pauschal Lastminute
117 NEWFOODLAND KULINARISCHE REISEN:  Jürgens & Bjaoui GbR Kulinarikreisen
Newfoodland bringt Menschen mit Passion für gutes Essen erlebnisreiches Reisen und Kultur zu den ... START DARUM REISEN GENUSS KONTAKT Venedig Kulinarischer Segeltörn Wein aus der Lagune private Kulinarikreisen Kulinarik Kulturreisen Kulinarische Reisen
118 TopTours Ihr Reisebüro Top Tours GmbH Toptours
Toptours Ihr Reisebüro für spezielle Reisen. Planen Sie mit uns Ihre ins Weltall ... Incentives Virgin Galactic Top Tours Reisen in Europa Lernen Sie Europa kennen. Städtetrips Badeurlaub Toptours Stingl Reisebüro Reise
119 ReiseAktuell Das österreichische Reisemagazin CB-Verlags GesmbH Kulinarik
REISEaktuell eines der attraktivsten Reisemagazine aus Österreich informiert mit Top News zum Thema ... Travel Lifestyle Luxus Gourmet Menü Top News On Tour Reisen Hotels Hideaways Österreich Kulinarik Gourmet Haubenküche Sterneküche
120 Fremdsprachenreisen Sprachenreise Fremdsprachenreis

Glas Busreisen der Spezialist fürFremdsprachenreisen Sprachenreise Sprachen lernen Sprach Busreisen Sprachen ...  Fremdsprachenreisen Sprachenreise Sprachen lernen Sprach Busreisen Sprachen und Reisen Fremdsprachenreisen Sprachenreise Sprachen Lernen Sprach
121 Urlaub Suchmaschine Reiseangebote billig

Preisvergleich für Reisen und Urlaub vom billig Urlaub bis zum Luxusurlaub jetzt online ... Flug Eigene Anreise Ferienhaus Städtereisen Mietwagen Blog Reiseangebote Reisen bis Euro Reisen Billig Urlaub Reisesuchmaschine Reisepreisvergleich Lastminute
122 Günstige Last Minute Reisen Last

Günstige Last Minute Reisen buchen ? Sie am besten bei uns! Tolle Angebote für günstige ... Reisen GmbH Alle Rechte vorbehalten. Kontakt Newsletter AGB von billigweg Veranstalter AGB Datenschutz Last Minute Reisen Günstig Reisen Urlaub
123 Autohaus Reiser Autohaus Reiser - ABR Automobilvertriebs GmbH VW
Autohaus Reiser Ihr Spezialist für VW Audi Skoda Seat und Gebrauchtwagen ... BILDERGALERIE .. Autohaus Reiser ... wie alles begann ... Interessente Bilder von "damals" und "heute VW Audi Skoda Seat
124 J A www.thermenlinie. Busreisen JANDRISEVITS Reisen GesmbH Dt. Tschantschendorf ... www.thermenlinie Aktuelle Reisen Kontakt Downloads Plan als PDF Plan als XLS Besucher REISEN Busreisen JANDRISEVITS Reisen GesmbH
125 China Reisen und China China
Als führender China Spezialist organisieren wir China Reisen und China Rundreisen. Wir bieten China Gruppenreisen ... Stopover China Reisen China Rundreisen Garantierte China Reisen mit Rabatten und zum Tiefpreis China Reisen China Rundreisen China Individualreisen
126 Kolumbien. Reisen. Individual. Individuelle. kolumbien

Kolumbien Reisen ist ein Tourveranstalter der individuelle Erlebnisreisen und Individualtourismus im faszinierendsten Land Lateinamerikas ... + Skype colombiaviajes Kolumbien Reisen â Kolumbien Reisen Individualreisen Individualtourismus
127 Murtal Express Oldtimer Oldtimer

Auf Oldtimer Reisen finden Sie Oldtimer Bus Reisen Hochzeitsfahrten und Oldtimer Fahrten zu besonderen ... Navigation überspringen Oldtimer Reisen Reisebus Oldtimer für Ihr Fest OldtimerEvents Bilder Saurer Oldtimer Lastkraftwagen Diesel Max Max
128 Metz SaharaReisen :: Tunesien Metz

SaharaReisen Saharareisen Geführte Erlebnisreisen mit dem Geländewagen oder zu Fuß Tunesien erleben. ... WILLKOMMEN BEI SAHARA-REISEN ... der privaten website der Familie Metz Metz Sahara Saharareisen SaharaReisen
129 PRIMA REISEN: Home Italien

PRIMA REISEN ? Ihr Spezialist für Finnland Irland Italien Jersey Norwegen ... Gruppenabteilung Bewerbung Buchungszentrale PRIMA REISEN Presse PRIMA REISEN Finnland -Winterzauber Italien Ferienwohnungen In Italien Appartements
130 Startseite Holiday Reisen Reisebüro
Reisen nach Wunsch Ihr erfahrener Reiseveranstalter und Reisebüro in Linz organisiert Pauschalreisen und ... Willkommen bei Holiday Reisen Holiday Reisen ist ein österreichisches Unternehmen und hat sich auf Fernreisen Reisebüro Reiseveranstalter Pauschalurlaub Individualreise
131 Die große ReiseUmfrage rund Österreich GmbH Reise
ReiseCommunity! Bestimmen Sie die Trends Produkte und Dienstleistungen der Zukunft. Einfach Umfrage beantworten und ... Reise-Umfrage Startseite Umfrage Gewinne Gewinner Mehr Umfragen Teilnahmebedingungen Die große Reise Gewinnspiel Gewinn Gewinnen
132 Hotelbewertungen Urlaub Hotelbewertungen Ihr Portal für Hotelbewertungen. Erst vergleichen dann buchen und sparen. Hier buchen Sie ... Hotelbewertung Urlaubsbilder Pauschalreisen All inklusive Reisen bis - Euro Wellness Clubreisen Hotelbewertungen Hotelbewertung Hotels Hotel
133 die ReiseInformationsplattform LuxuryTravel die ReiseInformationsplattform für anspruchsvolle Genießer ... Vielen Dank unseren Business Partnern Herzlich Willkommen bei LuxuryTravel die Reise LuxuryTravel Strahner Mag. Karin Strahner Ambassador Reisen Travel

Urlaub Last Minute Reisen Restplatz Reisen Kreuzfahrten und Städtereisen mit Hotelbewertungen und ...  CS SEVEN SEAS - Urlaub Last Minute Reisen günstiger buchen CS Seven Seas 7CS Reisen
135 Brandstetter Reisen

Brandstetter Reisen ... Reisen Tagesfahrten Fuhrpark Mietwagen/Airport Bussharing Galerien Unternehmen Anfragen Suche
136 EbnerReisen Aktuelles Reiseprogramm ebner

Ebner Reisen Busreisen Aktuelles Reiseprogramm Ebner Reisen Busreisen Reiseprogramm
137 Home Raiffeisen Reisen Reisen

RaiffeisenReisen persönlich: Über uns Raiffeisen Family Raiffeisen Aktiv Reiseziele Weltweit Themenreisen ... Raiffeisen Reisen Logo Über uns Leitbild Vision Geschäftsleitung Team Standorte Filiale Wollzeile Reisen Weltweit Über Uns Family
138 Pensionisten Reisen Reisen Pensionisten

Pensionisten Reisen Reisen für Rentner Busreisen Pensionisten und Renter busreisen für alte ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage Pensionisten Reisen Reisen Für Rentner Busreisen
139 Malerei Reisen Malerei und Reisen und Texte Reisen journaille Lebenslauf k.u.k. ... einmal mit Rosinante...einmal ohne Sancho... Natürlich versuche ich auch meine Reisen zu dokumentieren - Reisen ans Malerei Und Reisen Und Texte
140 Individuelle Kanada Reise mit Kanada
Bad Bevensen
Buchen Sie Ihre KanadaReise direkt beim KanadaSpezialReiseveranstalter. Einfach online mit kompetenter Beratung und professionellem Service. ... Kanada Reisen Wohnmobil-Reisen Wohnmobil-Preisvergleich Alle Vermieter Modelle Kanada Reise Buchen Reiseveranstalter
141 Wellcomeonline. Das Internet Wellcome

Wellcomeonline ist das Internet Reise und GourmetMagazin für die schönen Seiten des Lebens. ... Toulouse-Lautrec Der Weg in die Moderne ?Eine Reise durch Marrakech? in der Tiroler Zugspitz Arena Wellcome Online Magazin Reisen
142 Urlaub Last minute Reisen Urlaub

Urlaub Reisen Last Minute: Günstige Reisen in schöne Hotels garantieren einen unvergesslichen Urlaub. ... Sie sind hier Urlaub Reisen Last Minute Urlaub mit HolidayTrex - Sun up your life! Buchen Urlaub Last Minute Reisen Pauschalreisen Kurzurlaub Busfahrt Hotel
143 Rolarika auf Reisen Rolarika

Rolarika auf Reisen ... deactivated. Successful Error Rolarika auf Reisen All albums Login Herzlich Willkommen auf unserer Rolarika
144 Günstige Reisen travelport Billige Flüge Hotels Mietwagen sowie billige Reiseangebote für Pauschalreisen und LastminuteReisen ... travelport - Reisen travelport Service Center + - dt. Festnetz Startseite Travelport Österreich Urlaub Ferienwohnung Ferienhaus
145 Schmidhofer Reisen Kulturreisen Schmidhofer

Schmidhofer Reisen ist Ihr Spezialist für Kultur und Bildungsfahrten Wander oder Städtereisen. Wir bieten ... -reisen Startseite Über uns Chronik Unser Team Fuhrpark Aktuelle Reisen Linienverkehr Bilder Bilder Schmidhofer Reisen Schmidhofer Reisen Innervillgraten
146 Island ProTravel Ihr Island

Vielfältige Angebote für Ihren Urlaub in Island! Island Reisen mit dem Reiseveranstalter für Gruppenreisen ... für alle die individuell reisen wollen. Grönland Erleben Die größte Insel der Welt lädt dazu ein Tradition und Kultur Island Urlaub Reise Island Reisen Reiseveranstalter Island Protravel
147 BELMONDO REISEN reisebüro

Belmondo Reisen Kufstein Österreich Reisebüro Kufstein Reise Türk
148 Reisebetreuung Reisebetreuung für Reisebetreuung

Reisebetreuung Reisebetreuung für alte Menschen Reisebetreuung für Behinderte Pensionisten Reisen Reisen ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage Reisebetreuung Reisebetreuung Für Alte Menschen Reisebetreuung
149 Gullivers Reisen

Gullivers Reisen ...  Gullivers Reisen Kontakt Wien Wien Wallnerstraße Palais Esterhazy + - -
150 Weltjugendtag 2008 in Sydney Weltjugendtag

AkzenteReisen bietet Euch Gruppenreisen zum XXIII. Weltjugendtag in Sydney Australien ... Teilnahme Reise mit Flug Angebot Angebot Angebot Reise ohne Flug Angebot Angebot Nur Flug Weltjugendtag 2008 Sydney Australien
151 Gullivers Reisen

Gullivers Reisen ... officegulliversreisen Papageno Touristik - Die Kunst des Reisens … Pottendorferstraße
152 Losfliegen.AT die ReisePreisvergleichsSuchmaschine losfliegen

Losfliegen.AT bietet Ihnen aktuelle Urlaubsangebote Lastminute More Flüge hotels Mietwagen ... am um Urlaubsziel Dauer Erwachsene Kinder vom bis Reise- Lastminute-Angebote Rückruf-Service Losfliegen Schnell Losfliegen Günstige Flüge
153 Home Nefer Reisen Nefer Reisen GmbH Ägypten
Nefer Reisen bietet Ihnen einmalige Entdeckungsreisen nach Ägypten und Rundreisen in den Orient. Unsere Programme ... einer faszinierenden Kultur Dubai und Oman – die märchenhafte Welt Arabiens Nefer Reisen bietet Ihnen einmalige Ägypten Kulturreisen Ägypten Studienreisen Ägypten Erlebnisreisen Ägypten Nefer
154 Aupair Reisen und Ausflüge Aupair

AupairReisen für Aupairs und Studenten: Stadtführungen Reisen und Ausflüge nach Wien Rom ... ein besseres Kennenlernen des Gastlandes und seiner Umgebung. Als Reise- Ausflugs- und Stadtführung -Agentur Aupair Aupairs Führung Österreich
155 Namibia Reisen Selbstfahrreisen Selbstfahrer Namibia

Individuelle Selbstfahrreise Namibia Reise für Selbstfahrer mit dem füe Sie persönlich zusammengestellten TourenLogbuch ... auch Sie von über Jahren Reise-Erfahrung sowie leistungsstarken Partnern vor Ort! Unser Spezialgebiet Namibia Reise Selbstfahrreise Individuell
156 Reisen Tickets Events :: Urlaub

Reisen Urlaub Sprachreisen Hotelbewertung Freizeit LastMinute Schnäppchen und Pauschalreisen ... -Angebote Flüge Hotels Mietwagen Sportreisen Wellnessreisen Ferienhäuser Tickets Versicherung Reise-Magazin Urlaub Reise Reisen Ferien
157 :: Anspruchsvoll reisen mit | Urlaub wishline

Hochwertige Reisen von ausgewählten Reiseveranstaltern: Abenteuerreisen Aktivurlaub Erlebnisreisen Expeditionen Gourmetreisen ... Urlaub Ferien Reisen - Reiseangebote für Reiseziele weltweit! Die Website ist aktuell in Ã Wishline Wishline Reisen Wishlinereisen Reisen Reise Urlaub Ferien
158 Sritours | Sri Lanka sri

Private Rundreisen Kleingruppenreisen und maßgeschneiderter Badeurlaub für jedes Budget. Urlaub Reisen auf Sri ... -tours bietet Ihnen qualitativ hochwertige maßgeschneiderte Sri Lanka Reisen für jedes Budget Sri Lanka Reise Sri Lanka Reisen
159 Mauritius Urlaub Hotels Heiraten Mauritius

Mauritius Urlaub | Angebote von L'Evasion Tours Ihrem Mauritius Reiseveranstalter Mauritius Reisen Urlaub Hotels ... Mauritius Urlaub Reisen Hotels Heiraten Golfreisen Kreuzfahrten Mauritius Urlaub Golfreisen Mauritius Urlaub Reisen Urlaub
160 Ayurveda for health Ayurveda

Entdecken Sie mit uns als Spezialist für Ayurveda Reisen inkl. Yoga die besten Ayurveda Resorts ... Home Die besten Destinationen Kombinationen Ayurveda Reisen Aktuelle Angebote Ayurveda Ayurveda Reisen Inkl. Yoga
161 Yoga Retreats Reisen Yoga

Yoga Retreats Reisen. Der Ratgeber für Regionale Yogareisen in Europa Asien und Afrika für ... www.retreat Yoga Retreats Reisen Kontakt Ayurveda und Yoga am Meer in Südindien . Yoga Retreats Reisen YogaReisen YogaUrlaub
162 Pölzl Reisen Reisebüro Pölzl
Pölzl Reisen Reisebüro in Gmünd. Busreisen Flugreisen Städtereisen Thermenaufenthalte Theaterfahrten ... hat sie nicht die Reisesehnsucht und den Wunsch die schönsten Regionen der Welt auf einer sorgenfreien Reise kennen zu lernen Pölzl Poelzl Reisen Reisebüro
163 Starte durch mit CONSUL Radsportferien

Erlebnisreiche und unbeschwerte Radsportferien mit Consul Reisen. Erleben Sie Mallorca Andalusien und ausgesuchte Radsportgebiete ... für den Winter! Reinschauen lohnt sich! Consul Reisen Günther Gausch Ges.m.b.H.Co.KG A- Wels Hafergasse E Radsportferien Radferien Radfernfahrten Radtouren
164 Lastminute Reisen DomainQuadrat Marketing GmbH
lastminute last minutes reise reisen ... last-minutes Übersicht von Lastminute Reisen Sie können die Domain last-minutes kaufen
165 billigereise DomainQuadrat Marketing GmbH billige
Links zu billige reisen und billigreisen ... Hinweis Bei diesen Inhalten handelt es sich nicht um das Angebot der Verkehrsbüro Ruefa Reisen Billige Reise Billigereise Billigreisen Reisen
166 Fuchs Reisen: Fuchs Reisen Busreisen
Fuchs Reisen Ihr BusreisenSpezialist. Busreisen zu Traumpreisen. ... Home Reisen Reisekalender Tagesfahrten Kurzreisen Rundreisen Große Reisen Wandern Wohlfühltage Busreisen Reisebüro Taxi Einzelreisen
167 Flugbörse die günstigste Art flugbörse

Weltweit günstig Reisen. Flüge Hotels Leihwagen Rundreisen ... Bei uns finden Sie ... Reisen - Weltweit! Wir können auf eine Datenbank mit über . verschiedenen Tarifen zugreifen Flugbörse Flugreisen Flugbüro Weltweit Checkfelix
168 Pension Berggeist sölden tirol pension

pension Berggeist in sölden tirol reisen in tirol österreich m/o Kinder zum sport wandern klettern ... für reisen und klettern ski in sölden tirol reisen pension pension Berggeist in sölden tirol reisen in tirol Pension Sölden Tirol Reisen
169 Reisefeeling Toller Urlaub Reisefeeling

Reisefeeling Toller Urlaub Reisegefühle Luxusurlaub Reisen und Busreisen Traumurlaube ...  Reisefeeling Toller Urlaub Reisegefühle Luxusurlaub Reisen und Busreisen Traumurlaube Reisefeeling Toller Urlaub Reisegefühle Luxusurlaub
170 Kerngast Reisen im Vulkanland Kerngast Reisen GmbH Reisen
Mettersdorf a. S.
Ihr Reisepartner im Vulkanland ... Aktuelles Reisen Buchen Fahrzeuge Über Uns Links Kontakt Herzlich Willkommen bei Kerngast Reisen Reisen Fernreisen Kerngast
171 Luxusreisen LuxusReise Luxusreisen

Glas Busreisen der Spezialist für Luxusreisen LuxusReise Luxusreise Luxusbus Luxusbusse ...  Luxusreisen Luxus-Reise Luxusreise Luxusbus Luxusbusse Traumbus Topbus Luxusbusse Luxusreisen LuxusReise Luxusreise Luxusbus
172 SEND James ohne SEND JAMES ist ein Premium-Dienst der KEP AG Koffer
Reisen Sie zu den schönsten Plätzen in Deutschland Österreich Schweiz Südtirol ... Stets zu Diensten Ihr Reise Gepäck- und Koffer-Service Kontakt Gepäck Zielort Abholung Rückreise Koffer Versenden Gepäck Versenden Gepäck Verschicken
173 UngerReisen BistroBus leistbarer BistroBus

UngerReisen BistroBus leistbarer Luxus und unübertroffener Komfort ... Sie sich für eine UNGER-REISE! Wir freuen uns auf Sie ... BistroBus Bistrobus Reisebüro Individualreisen
174 Pölzl Reisen Busreisen PölzlReisen

PölzlReisen Busreisen Mooskirchen Steiermark Ausflugsfahrten Vereinsfahrten Einkaufsfahrten Badereisen ... Home Drucken A A A Buchungshotline - Aktuelle Reisen Bade- und Einkaufsfahrten PölzlReisen Busreisen Mooskirchen Steiermark Ausflugsfahrten Vereinsfahrten Eink
175 Last Minute und Reise das neue Reiseportal für Ihren Last Minute Urlaub mit vielen Reise ... Kreta ab - Euro Alle Lastminute Reise Angebote Last Minute nur Flugangebote Hin- und Rückflug ab Rom Lastminute Last Minute Pauschalreisen
176 Hofer Reisen Hofer Reisen GmbH & Co KG
Gute Reise gute Preise bei Hofer Reisen. Günstiger Reisen ? Mehr von der Welt ... Merkliste Angebote Hofer Reisen Da bin ich mir sicher. Buchungs-Hotline täglich ?
177 Philippinen Reisen preiswert und flytocebu

Philippinen mit Fly to Cebu Reisen Individuell und sicher ... Philippinen- Reisen hier klicken Flytocebu Philippinen Cebu
178 Reisebüro Kerschner Reisen Kerschner Reisen GmbH
Webauftritt des Reisebüro Kerschner Reisen. ... ARB Kontakt Facebook + - wieselburgkerschner Kerschner Reisen
179 Estland Urlaub Tallinn Hotels eesti

Reiseinformationen über Estland. Baltikum Reisen und Urlaub Eesti Tallinn und Estonia laden ein ... » Landesinformationen » Städte Regionen » Kultur » Urlaubtipps » Wissenswertes » Reiseberichte » Adressen » Reisen Eesti Estonia Estland Tallinn
180 > Home :: ::

:: :: Motorradumbauten und Reisen ... Motorrad - ROADBOOK Alles über meine Reisen und Umbauten Home Motorrad T Bully Reisen Kontakt :: :: Michael Wögerer Hubrauerweiterung
181 Last Minute Urlaub Restplatzbörse

Urlaub zum Bestpreis: Last Minute Reisen und Hotels von über 70 Veranstaltern! Flugtickets Last ... und weltbekannte Sehenswürdigkeiten locken viele Urlauber an. ab ? Türkei Last Minute Reisen Antalya Side Restplatzbörse Urlaub Reisen Last Minute Hotels Flugtickets Reisebüro
182 Abenteuer Reisen Motorrad Motorradabenteuer

Abenteuer mit dem Motorrad Fahrrad eBike! Abenteuer Reisen Leben = das ist für ... Wunderhecke Sichtschutz mal anders.. . Gewächshaus- Update Abenteuer - Reisen - Leben Motorradabenteuer Motorrad Ebike Abenteuer
183 Segelreisen Segelurlaub Kaya Lodge Touristik GmbH segelreisen
Segelreisen online buchen: Segelurlaub Mitsegeln auf Segeltörns Kojencharter Blaue Reise auf Mallorca ... Mallorca Mitsegeln Segelschule Türkei Blaue Reise Alle Ziele Griechenland Kroatien Türkei Hausbootreisen Segelreisen Segelurlaub Kojencharter Mitsegeln
184 Reise ins Glück Angebot
Reise ins Glück Pfarrwerfen ... Segelyacht Admiral mieten Reise ins Glück - Urlaub Reise ins Glück - Auszeit Reise ins Glück - Erlebnisdate Angebot Kompetenz Beratung
185 Last Minute Click und Flieg OHG Lastminute
Günstige Last Minute Reisen und Reiseangebote bequem online buchen mit Preisgarantie von click und ... Top Beratung Sicher buchen Hotelbewertungen Reisebüro Click und Flieg Unsere Reise-Experten beraten Lastminute Reisen Pauschalreisen Urlaub
186 Reisebü Lastminute Ferien Reisebüro

Reisebü Lastminute Ferien Reisen günstige Reiseangebote im Internet Reisebüro online buchen! Arrangement ... Reisebü Lastminute Ferien Reisen Günstige Reiseangebote kannst Du hier im Internet Reisebüro Reiseburo Reisebuero Lastminute
187 Travel Reisen urlaub

Wer gerne reist steuert immer weider verschiedene Reiseziele an. Urlaub an der Sonne oder im ... Travel Reisen Direkt zum Seiteninhalt Hauptmenü Homepage Afrika Asien Australien Europa Urlaub Reisen Ferien
Voila Kärnten Reisen bietet Ihnen einfach alles was das Urlauberherz höher schlagen läßt. Von ... - NALGIETOUR „Durch die ehemalige DDR“ ..-.. – Infos bei Voilà Reisen Voila Urlaub Reisen Kärnten
189 Yoga Reisen Yogareisen Yoga
Yoga Reisen. Yogareisen und Retreats in Marokko Portugal Italien Indien Ibiza Deutschland Österreich. Der Ratgeber ... Österreich Yoga Reisen Kontakt Ayurveda im Thermenhof in Österreich www.Thermenhof Im Ayurveda Yoga Reisen Yogareisen Yoga Reisen
190 Schörgenhuber Schlager Reisen Schörgenhuber

Schörgenhuber Schlager Reisen Einsteigen Platz nehmen und wohlfühlen Busreisen Mehrtagesfahrten ... Schörgenhuber Schlager Reisen Einsteigen Platz nehmen und wohlfühlen Busreisen - Mehrtagesfahrten Schörgenhuber Schlager Reisen Einsteigen Platz Nehmen
191 Reiseorganisation Reise organisieren Reiseorganisation

Reiseorganisation Reise organisieren Busreise organisieren Busreise managen Busreise empfehlen ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage Reiseorganisation Reise Organisieren Busreise Organisieren
192 Ernst Uschi Wagners events

private homepage über musikalisches im musiccorner wissenswertes über unsere reisen urlaub events ... MusicCorner EVENTS REISEN WIEN LINKS Gästebuch Wir beide das sind I und Er Wagner Events Urlaub Reisen Amerika
193 Reisen in DomainQuadrat Marketing GmbH
dominikanische republik reise urlaub ... -minute Reisen bis zu -% buchen Ihre Traumreisen buchen. Sonderangebote bis % g www.ab
194 Mauritius La Réunion Mauritius

Islands4more seit Jahrzehnten der Reiseveranstalter für Reisen in den Indischen Ozean bietet individuelle Reisen ... für Reisen in den Indischen Ozean Islandsmore ist der Veranstalter für den Indischen Ozean. Mauritius Mauritius Madagaskar La Réunion Reunion
195 Grisu auf Reisen

Unsere Reisen mit dem Wohnmobil Albanien und Griechenland Mystras Geocaching Thermeninfo ... Grisu auf Reisen Direkt zum Seiteninhalt Hauptmenü Home Ueber Uns Fahrzeuge Zelt/Wohnwagen
196 Nilkreuzfahrten Last Minute Nilkreuzfahrten

Lastminute Nilkreuzfahrten Reisen aller Reiseveranstalter im Preisvergleich mit Bestpreis Garantie. LastMinute Nilkreuzfahrt bis 65 ... für die nächte Flugreise ... mehr Info Lastminute Reisen Pauschalreisen Ferienhaus/Wohnung Charterflüge Mietwagen Nilkreuzfahrten Nilkreuzfahrt Aegypten Lastminute
197 Island Reisen Grönland NORDWIND REISEN GmbH Grönland
Urlaubsreisen nach Grönland Island und Spitzbergen ... Ihr Urlaubsspezialist für Island Grönland und Spitzbergen Reisen NORDWIND Beratungshotline + Grönland Reisen Island Reisen Island Urlaub
198 Vorderegger Reisen Busreisen Vorderegger GmbH Reisen
Zell am See
Vorderegger Reisen der kompetente Partner. Reisebüro. Flug Schiff Bahn. Busreisen und Incoming in ... . Hier gehts zum Urlaub Vorderegger Reisen - ein voll konzessioniertes selbstständiges Reisebüro Reisen Bus Flug Incoming
199 Moderne Reisen modernereisen Moderne

Reisebüro und Busreisen Glas. Moderne Reisen modernereisen moderne busreisen moderner urlaub ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage Moderne Reisen Modernereisen Moderne Busreisen
200 PolarAdventures | Kreuzfahrten und kreuzfahrt

Seit 1996 organisiert PolarAdventures Kreuzfahrten und Flüge in die Arktis und Antaktis. Die aktuellen Angebote ... Expeditionen Kreuzfahrten und See-Reisen mit Eisbrechern Polarschiffen und Seglern in die Arktis Kreuzfahrt Antarktis Polar Spitzbergen
201 Reisephilosophie Philosophie der Philosophie

Das Buch Reisephilosophie. Inhalt Autorin Buchbestellung. ... Reisephilosophie Startseite Buchinhalt Autorin Abstract Buchbestellung Über das Reisen Philosophie Der Reise Reisen Reisephilosophie Apodemik Kunst Reisetheorie
202 Services Reisen services

... Vorarlberg Wien ARBÖ-Mitglied werden Aktionen Mitgliedschaft ARBÖ erleben Services Reisen Auto Motor Rad Services Verkehrsinfos Reisen Spritpreise Tools
203 Das Sonnenleben [Reisen zum sonnenleben

das Sonnenleben [Reise zum Licht] Seminare ... -Reisen zum Licht! Für körperliche Beschwerden oder einfach als Selbsterkenntnis Seminar Sonnenleben Rosemarie Seminare Meditation Licht Reiki Reikimeisterin Kroatien
204 ReiseMovies Reisenbuchen ReisebuchungTravelMovies Reisetipp

ReiseMovies Reisen in Österreich ? Reisetipp Hotels für Ihre Reisen buchen. Reisebuchung in Österreich ... Wenn einer eine Reise tut dann kann er viel erzählen ... Hier auf Reise Movies finden Sie Urlaubs
205 Trendreisen Reisetrends Trendreisen

Fachbatrieb für Trendreisen Reisetrends Reiseziele Reisetipps Reise Emphelungen Reisemessen ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage Trendreisen Reisetrends Reiseziele Reisetipps
206 Resietrends Reiseziele Resietrends

Resietrends Reiseziele Reisetipps Reise Empfehlungen Reisemessen Busreisen Busreise Trends ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage Resietrends Reiseziele Reisetipps Reise Empfehlungen
207 Reiseplanung für Gruppen und Reiseplanung

Reiseplanung für Gruppen und Vereine Reise planen Busreise planen Vereinsreise planen ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage Reiseplanung Für Gruppen Und Vereine Reise Planen
208 Reiseplanung für Firmen und Reiseplanung

Reiseplanung für Firmen und Betriebe Reise planen Busreise planen Vereinsreise planen ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage Reiseplanung Für Firmen Und Betriebe Reise Planen
209 Reiseplanung für Gruppen und Reiseplanung

Reiseplanung für Gruppen und Vereine Vereinsreisen Busfahrten für Vereine Ausflugsfahrten im Bus für ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage Reiseplanung Für Gruppen Und Vereine Vereinsreisen Busfahrten
210 INDIA Film Reisen Indien

Die Homepage beschreibt einzelne Reisen durch Indien die der Inhaber von INDIA Film aus Indien Erfahrungsberichte Bilder Reisen
211 Afrika Reisen Urlaub Afrika

Afrika Reisen Urlaub und Ferienportal ... Afrika Reisen Hier finden Sie ab demnächst unser AFRIKA REISEN Portal mit vielen interessanten Afrika Africa Südafrika Reisetips
212 Korsika Urlaub Hotels Ferienhäuser Korsika

Korsika Urlaub | Angebote von L'Evasion Tours Korsika Angebote von L'Evasion Tours Ihrem ... Korsika Urlaub Hotels Ferienhäuser Villen Ferienwohnungen Reisen Rundreisen Selbstfahrtouren Korsika Reisen Urlaub Hotels
213 Gasteintaxi Rudigier Reisen Taxi

Gasteintaxi bei uns reisen Sie First Class. Vom einfachen Airport Transfer vom Flughafen in die ... Gasteintaxi ? Rudigier Reisen ? Taxi ? Stefan Rudigier ? Panoramareisen ? Taxitransfer Taxi Gastein Gasteintaxi Rudigier Reisen
214 SCHARINGER REISEN Busreisen Reisen

Herzlich willkommen beim Reisebüro Scharinger Ihrem Partner für Busreisen Flugreisen Schiffsreisen ... Run Herren Weiß reisen aktuelles kontakt/öffnungszeiten über uns service bestellung Scharinger Reisen Reisebüro Reisebuero Oberösterreich
215 GTI Reisen Reisebüro: GTI-Reisen GmbH Reisebüro
Hopfgarten in Tirol
GTIReisen Ihr Reisespezialist im Brixental bietet Flugreisen Pauschalreisen Last Minute Angebote ... Minute Hotels Weltweit Hotelangebote Hotelbeschreibungen Reisen in einer Gruppe bis zu Teilnehmer Reisebüro Reisebuero Reisen Flugreisen
216 Ihre Reisen Online! Ganz Weltreise

Reiseberichte Tipps und Tricks die das Reisen leichter machen! Weltreise Langzeitreise Worldtrip Weltreiseplanung
217 Urlaubsberatung Urlaub beraten Urlaubsberatung

Urlaubsberatung Urlaub beraten Reiseberatung Reiseplanung Beratung und Planung von Reisen ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage Urlaubsberatung Urlaub Beraten Reiseberatung Reiseplanung
218 Willkommen bei Wiegele Reisen Johann Wiegele & Söhne GmbH Bus
Bad Bleiberg
Das Busunternehmen Wiegele Reisen bietet Ihnen eine umfangreiche Auswahl an Reisearten. Von Tagesfahrten über Klassenfahrten ... Buchen Anfahrt Willkommen bei Wiegele Reisen! Wir wünschen all unseren Kunden Bus Reisebus Reisebüro Villach
219 Reisen kann so schön reise

portal für reiseberichte ... Reisen kann so schön sein EUROPA AFRIKA AMERIKA ASIEN AUSTRALIEN NEWS Startseite Kontakt Reise Ausland Innland Afrika
220 Reiseplanung Reise planen Reiseplanung

Reiseplanung Reise planen Busreise planen Vereinsreise planen Gruppenreise Planen Schulwoche ...  Reiseplanung Reise planen Busreise planen Vereinsreise planen Gruppenreise Planen Reiseplanung Reise Planen Busreise Planen
221 Doggydayz Reisen mit Reisen

Doggydayz die Reiseagentur für Reisen mit Hund Piratenhäuser Seeräubervillen Hüttenurlaub Reisen Mit Hund Urlaub Mit Hund
222 Lastminute Urlaub | Super lastminute

Lastminute Urlaub Mit dem Restplatzshop haben Sie sich für den Spezialisten zum Thema Reisen Lastminute Urlaub Super Last Minute Reisen
223 Gabriele Reis Gabrielereis

... Gabriele Reis Direkt zum Seiteninhalt Hauptmenü × Homepage Erklärung Beratungsfelder Über Gabrielereis Gabriele Reis Reis Gabriele
224 SAHARASTERN Saharastern

Saharastern Reisen Wüste Marokko ... Landschaft verzaubern und tauchen Sie in das Leben der Maghrib ein! Eine Reise durch das Königreich Saharastern Reisen Wüste Marokko
225 Bösch Reisen Busfahrten Bamp;ouml;sch

Bösch Busreisen Reisen mit besonderem Flair Gruppenreisen für Halbtages und Tagesfahrten Wochenausflügen ... Bösch Reisen GesmbH Co KG A- Lustenau Hagstraße + - Bamp;ouml;sch Bamp;ouml;schreisen Busreisen Reiseveranstalter
226 Bus | Busreisen | Bus

Sicher organisieren Sie für das Jahr 2010 Tagesausflüge Theater Opernfahrten oder mehrtägige Ausflüge ... Busreisen Reisen mit dem Bus Liebe Kunden Wir haben unseren Busbetrieb im Jahr eingestellt Bus Reisen Busreisen Reisen Mit
227 Werner Predota Home werner

Werner Predota geht auf Reisen ... Werner Predota begleitet Sie auf Reisen Home Reisen Extrablatt Videos von Werner Predota Presse Werner Predota Reisen Seniorenreisen
228 Ferienlager Feriencamps Ferienlager

Reisen sowie Urlaub speziell für Kinder und Jugendliche: Die Ferienlager Sommercamps Feriencamps ... ! Diätcamp Multi Activity Camp Reit- und Pferdecamp "Gipsy" Vor der Reise Anreisemöglichkeiten Ferienlager Feriencamps Reisen Urlaub
229 Camping Wohnwagen Camping

Private Homepage mit dem Hauptinhalt Camping ... aber wie? Wohnwagen und Stellplatz Ausflüge und Reisen .. bis .. Baia Domizia . bis .. Kärnten Camping Wohnwagen Reisen
230 Seychellen Urlaub Reisen Hotels Seychellen

Seychellen Urlaub | Angebote von L'Evasion Tours Ihrem Seychellen Reiseveranstalter Reisen Urlaub Hotels Heiraten ... Seychellen Urlaub Reisen Heiraten Hochzeit Flitterwochen Hotels Privat-Inseln Kreuzfahrten Seychellen Reisen Urlaub Mahé
231 Herburger Reisen: Home Urlaub

Willkommen bei Herburger Ihr starker Reisepartner in Vorarlberg ... ob Familienurlaub oder Gruppenreise Fernreisen oder Last-Minute mit Herburger Reisen sind Sie richtig beraten Urlaub Reisen Reisebüro
232 Chamäleon Die Reise

Reisen mit höchstens 12 Teilnehmern – Afrika Amerika Asien Ozeanien ... Unsere Art des Reisens Unsere Geschichte Veranstaltungen Reisesicherheit Fotowettbewerb Jobs Chamäleon
233 Home Greimel

Greimel Reisen Ihr Reiseprofi aus Passail ... Home Unsere aktuellen Reisehits Christkindlmarkt Wien Sa. . Dez. ? - Greimel Reisen Ges.m.b.H Greimel Reisen Passail
234 Wolf Reisen GmbH Wolf
... Wolf Reisen GmbH - Trautmannsdorf Wolf Ausflüge Reisen Machen Sie Ihren Urlaub Wolf Reisen Busunternehmen Reisen Tagesausflug Ausflug
235 Herburger Reisen: Home Urlaub

Willkommen bei Herburger Ihr starker Reisepartner in Vorarlberg ... . Egal ob Familienurlaub oder Gruppenreise Fernreisen oder Last-Minute mit Herburger Reisen Urlaub Reisen Reisebüro
236 Start (DUSCHLBAUER Reisen
DUSCHLBAUER Reisen Bustouristik Linienverkehr in Freistadt. ... DUSCHLBAUER Reisen Bustouristik Linienverkehr in Freistadt. Start News Linienverkehr Downloads
237 Herzlich Willkommen auf der putzreisen

Putz Reisen Die Website des Unternehmers Raimund Putz ... Start PUTZ Reisen Hauptmenü Startseite Aktuelle Veranstaltungen Unser Unternehmen Fuhrpark Kontakte Putzreisen Raimund Putz
238 Afrika ist DomainQuadrat Marketing GmbH
afrika südafrika suedafrika urlaub reise safari ... -deko.westwing Afrika Reisen Spezialist Individuelle Beratung www.thobareisen/afrika afrika reisen Ergebnisse
239 Onlineholidays Reisen Kultur und Rundreise

Kulturelle Rundreisen preiswert und mit Niveau Busrundreisen Gruppenreisen Reisen mit Arzt Studienreisen Architekturreisen Städtereisen ... weltweit Budget Hotels Reiseschutz Travelcard Mietwagen Inseln Wellness - Reisen Frauen auf Reisen Tiere Rundreise Busreise Deutschsprechende Gruppenreise Gruppenreisen Fachreisen Archi
240 InselReisen ihr Reisespezialist Bus

InselReisen ihr Reisespezialist für Stadt und Rundfahrten ... ! Insel-Reisen Schon immer an einen spontanen Kurzurlaub zu den Feiertagen gedacht? Für ein paar Tage Bus Busdesign Bus Design Stadrundfahrten Flughafenstransfers Auslandsreisen Tage
241 Riedler Reisen Home Riedler Reisen & Touristik GmbH Taxidienst
Ihr Weg ist unser Ziel! Ihre ReiseveranstalterFamilie Riedler und Mitarbeiter Home %mod_search% Katalog Download Laden ... sdfdsdf Home Reisen Inlandreisen Auslandsreisen Taxidienst Wandertaxi Rodeltaxi Jugendtaxi Taxidienst Regionalverkehr Reiseverkehr Anmietverkehr
242 Kreuzfahrten Reisen Kreuzfahrten

Reisen Sie mit zu den schönsten Orten der Welt. Wundervolle Kreuzfahrten und Schiffsreisen günstig ... Download Kontakt Home Online Buchen Sagmeister Reisen Reisebüro Autobusbetrieb Team Unsere Geschichte Kreuzfahrten Kreuzfahrt Schiffsreisen
243 :: Proksch Reisen :: reisebüro

Prokschreisen Reisebüro Proksch. Ihr Reisepartner für Bus Flug Bahn und Schiff. ... phoc . Proksch Reisen - Inh. Waltraud Schalud. mail schwechatprokschreisen Reisebüro Reise Reisen Gulet
244 Reisen in Salzburg Reisen

Reisen in Salzburg Salzburg Österreich Unterkünfte Urlaub Ferien Tourismusinformation Hotels ... Reisen in Salzburg - Salzburg Österreich Unterkünfte Urlaub Ferien Tourismusinformation Hotels Reisen Salzburg Österreich Tourismusinformation
245 Startseite EnergieReise EnergieReise

... ? Energetiks Energie-Reise - Vesseling Reiki im Raum Wiesbaden Frankfurt und Wien - "Die reinste EnergieReise Vesseling Reiki In Wien
246 Travel Partner Reisen GmbH Travel Partner Reisen GmbH Angebot
Travel Partner Reisen GmbH Ellmau ... Sonne See und frischer Luft haben. Druckversion Sitemap Travel Partner Reisen GmbH Login Logout Angebot Kompetenz Beratung
247 Willkommen bei Tierra Incognita Tierra

... japanisches Sprichwort Wir über uns Reisen Service Fotogalerie Gästebuch Partner Tierra Incognita Reisen Tierra Incognita Reisen Fernreisen
248 Hernuss Reisen : Hernuß Hernuß

... Hernuss Reisen Tillmitsch bei Leibnitz Steingrub T + F + - Hernuß Einem Reisen Handicap Oder Unsere Sind Unternehmen
249 Willkommen bei Biblische Reisen Biblische Reisen GmbH
Biblische Reisen Österreich: Veranstalter von ökumenischen Studienreisen Kulturreisen und Begegnungsreisen; Reisen in den Nahen ... Links Allgemeine Reiseinfos Reisen für Ihre Gruppe Aktuelles Angebotsanfrage Unsere Reiseziele Naher
250 OZEAN Studentenreisen reise

Ozean Reisen Studenten ... Reisen? genau richtig! Das alles wird bei uns Angeboten zu einem günstigen Preis so dass Reise Ozean Student Travel
251 Moser Reisen Pilgerreisen moser

... Leserreisen Messeflüge Musikreisen ORF Reisen Seniorenreisen Studien- und Pilgerreisen Urlaub Ferien Last Moser Reisen
252 REISEN | Tipps für Ausflug

REISEN ist Österreichs Magazin für Urlaub und Freizeit in Österreich Europa und Übersee. Die ... . » mehr lesen .. .. REISEN-Magazin Herbst Jetzt mit großem Gewinnspiel Ausflug Wandern Urlaub Reisen
253 In Afrika Hotels direkt allafricahotels.d

Bei und AfricanWorld Reisen finden Sie Ihr Hotel Camps Lodges ... ¤ltig zusammengestellt. Beginnen Sie Ihre Reise nach Afrika schon jetzt auf unserer Webseite! Afrika AfricanWorld Reisen Westafrika Angola Benin
254 Reise durch Kärnten Reise

Reise durch Kärnten Österreich Hotels Unterkünfte Urlaub Ferien Tourismusinformation ... Reise durch Kärnten - Österreich Hotels Unterkünfte Urlaub Ferien Tourismusinformation Reise Kärnten Österreich Hotels
255 ReiseNetzwerk

Das ReiseNetzwerk bietet Infos zu weltweiten Destinationen und speziellen Reisearten; ReiseInspirator und Bildergalerien machen ... nach Göteborg Es gibt kaum eine schönere Art zu Reisen um die unverwechselbare Landschaft des Nordens
256 Am liebsten Reisen Kreuzfahrten

Reiseblog ? Reisenews ? Fernreisen ? Städtereisen ? Reiseberichte ? ReiseReporter ? ... Mittwoch September Am liebsten Reisen In der Welt Zuhause Start Fotoblog Afrika Kreuzfahrten Seereisen Kreuzfahrtinspektor Seereisen
257 Naderer Reise Bus

Bus und Flugreisen ? Wir schneidern Ihre Reise nach Maß! Naderer Bustouristik in Linz und ... Naderer Reise Bus Bus- und Flugreisen ? Wir schneidern Ihre Reise nach Maß! Naderer Bustouristik
258 Sabines Reisebüro | Lastminute last

TOURPORT ist ihr Partner für Last Minute Reisen. Last Minute Urlaub günstig buchen mit einer Last Minute Reisen Last Minute Last
259 ä Ägyptenreisen Ägypten

Ägypten Reisen In Die Wärme ... ägyptenreise Ihre Reise Nach Ägypten Websearch Wir durchsuchen für Sie das Internet! Aktuelle Ägypten Reisen All Inklusive Kairo
260 TRAVEL MED CENTER :: Malaria

Reisen zählt zu den beliebtesten Freizeitbeschäftigungen eine gesunde Heimkehr sollte der krönende Abschluss jeder Malaria Gelbfieber Impfung Angst
261 MAG Reisen Reisebüro Grandits: kroatien
Gründung der MAG Seefahrtschule in Österreich
MAG Reisen Reisebüro Grandits: unsere Angebote: Kroatien: Hotels Appartements Bungalows Ferienhäuser ... Holzyachten Luxusyachten Gulets - Inselhüpfen FKK - Tauchkreuzfahrten » Blaue Reise Yacht Crew Kroatien Istrien Dalmatien Kroatien Hotels Adria österreich Austria
262 Busreisen Tirol RuefReisen Busreisen

Busreisen mit RuefaReisen Tirol Sicher und mit Komfort an den Urlaubsort. Wir fahren Sie ... Zum Inhalt Zur Navigation Home Unternehmen Reisen Kontakt Anfrage http//static.clearsense Busreisen Tirol
263 PichlerReisen :: Ausflüge | judenburg

PichlerReisen Wir lassen niemanden im Regen stehen! ... -REISEN Schulbusfahrten Familienausflüge diverse Kurierdienste Fahrten mit Kleinbussen Judenburg Steiermark österreich Austria
264  Diese Website steht zum

Diese Website steht zum Verkauf! ist die beste Quelle für alle Informationen die ... reisen-preisvergleich Domain erwerben This domain is FOR SALE - Diese Domain steht ZUM VERKAUF
265 Malta Gozo Reise malta

Malta Gozo online Reisen UrlaubsPortal. Infos günstige Buchung von Hotels in Malta ... HOME Multimedia Bildagentur Forum Videos Reisen Ausflüge Touren Ferienwohnungen Ferienhäuser Malta Gozo Reisen Urlaub
266 Willkommen in der Webheimat webheimat Urlaub Reise und Freizeit ... » Reise-Tipps Top Links » Lotto » EuroMillionen » Kreuzworträtsel » Mitglieder » Partnerbörse » Chat Webheimat Urlaub Reise Freizeit
267 Kreta Reisen Urlaub Kreta Kreta Ihr Partner in Sachen Ferienwohnung Ferienhaus Reisen ... Herzlich Willkommen bei kreta-reisen startanibittewarten Angebot der Woche Kreta Kreativ Reise- führer Kreta Reisen Kreta Reisen Griechenland Urlaub Auf Kreta
268 Willkommen bei PRO Reisen PRO Reisen GmbH PRO
Ihr Kreuzfahrtspezialist seit über 20 Jahren! ...  Willkommen bei PRO Reisen Nützen Sie den PRO Reisen Kreuzfahrtenfinder. Ihre individuellen PRO Reisen Pro Reisen PRO
269 Columbus Reisen Startseite Studienreisen
Entdecken Sie die Welt mit Columbus Reisen. Ob langersehnt oder kurzentschlossen. Bei uns gibt es ... ? Details Italienische Adriaküste Preis-Wert-Reise an die Adria. Seebäder Kunststädte Meer Studienreisen Städtereisen Rundreisen Kreuzfahrten Last Minute Kulturreisen
270 Reisen bilde(r)t Claudia
Claudias und Georgs Weltreisen ... an uns Österreichbild Downloads Bananaboot-Ride Links Wikinger Reisen Ikarus Reisen Wigwam Reisen Regenwald Claudia Und Georg Reisen Bildet Reisen
271 Angel Reisen Angelreisen

Angelreise Portal weltweit ... Angel Reisen Hier finden Sie ab demnächst unser ANGEL REISEN Portal mit vielen interessanten Angelreisen Angel Reisen Angelreise Angelurlaub
272 Informationen zum ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-ratgeber Weitere Links Domain erwerben Sie können die Domain reise-ratgeber kaufen
273 Sunseeking Reiseblog und

Willkommen bei Sunseeking´s ReiseBlog. Reist mit uns an die schönsten Plätze der Welt. ... Reise-Blog Thailand-Blog Home Thailand Chiang Mai Koh Samui Khao Lak Koh Chang Krabi Phuket Trang
274 Home :: ReisenWandernTauchen
Breitenfurt bei Wien
Reiseberichte Wandertouren Tauchplätze und vieles mehr bei ReisenWandernTauchen ... Wird geladen... Teilen Du befindest Dich hier Home ? Willkommen bei Reisen-Wandern-Tauchen
275 Meine Reise Urlaub text/html

News Preise Reportagen und Tipps zum Thema Reise. Aktuelle Nachrichten und Berichte aus ... Vergünstigungen - Mein Schiff wird kommen - Reisen von Rhône bis Wolga - Studienreisen Mit Schiff und Jet Text/html; Charset=iso88591
276 Home Angelika

Angelika Reisen Busunternehmen Angelika Kluksarics ... Home Aktuelle Angebote Kontakt Angelika Reisen Wir bringen Sie ihrem Traumziel näher Angelika Reisen Bus Busreisen
... Reisebus Webcam Links Anfrage Kontakte Sie sind hier >> Startseite FELNER REISEN Zitronenfest in Menton 2380 Perchtoldsdorf Plättenstrasse 21 Taxi Bus Autobus Felner
278 Webkatalog für Österreich mit Airberlin

Webkatalog und Suchmaschine mit geprüften Links aus Österreich Urlaub Reisen Hotels Banken Versicherungen ... Ihr Webkatalog und Suchmaschine mit geprüften Links aus Österreich. Infos zu Urlaub Reisen Hotels Beruf Airberlin Suchmaschine Webkatalog Österreich Finanzen Wirtschaft Urlaub Reisen
279 Die besten Reise Urlaub Schnäppchen
Wir machen Urlaub günstiger und finden täglich alle Reise und Last Minute Schnäppchen Egal Schnäppchen Urlaub Last Minute Lastminute
280 Travel Doc | Ärztlich

Ärztlich begleitete Reisen haben eine besondere Qualität und zeichnen sich für jeden Reiseteilnehmer durch ein ... ? Main Menu ?Home Verein Ärzte Reisen - Tagesreisen - Busreisen - Flugreisen - Wellnessreisen
281 Informationen zum ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-katalog Weitere Links Domain erwerben Sie können die Domain reise-katalog kaufen
282 Informationen zum ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-angebote Weitere Links Domain erwerben Sie können die Domain reise-angebote kaufen
283 FragolloReisen Reisen

Reisebüro Fragollo ... Startseite Unternehmen Chronik Team Fuhrpark Standort Reisen Tagesfahrten Ausflüge Reisen Reisebüro Steiermark Bus
284 Traumreisender Entlang der Donau Reisen

Alles um Reisen Wandern Lesen ... auf der Donau Herzlich Willkommen! Freue mich dass ich Dich hier begrüssen kann.Dies soll Dir helfen Reisen Reisen Irland Radfahren Wandern Lesen Donau Ungarn
285 Preiswert Reisen mit PEP pepXpress Touristik & Marketing GmbH pep
pepXpress ist Ihr SpezialReiseveranstalter für weltweite PEP und ExpedientenReisen ... - Interline- und Expedienten-Reisen Alle unsere Reiseangebote dienen der Fort- und Weiterbildung sowie Pep Expedienten Expedientenreise
286 Schwebach Reisen Frankenmarkt
Willkommen bei Schwebach Fischer Reisen in Frankenmarkt Oberösterreich. Wir fahren sie ins Fischerparadies und wieder ... ? Wilkommen bei Schwebach Reisen GmbH. ? Busse für jeden Bedarf und in jeder Preisklasse. Ob Betriebsausflug
287 Tom Reisen | TaxiTom taxi

... Home News Reisen Taxi Kontakt » Fuhrpark » Team » Reisen » Taxi » Busanmietung » Links » Taxi Taxitom Taxi Tom Dienstleistung
288 Kardamom Auf einer

Kardamom Auf Einer Reise.
289 8 ZIELE 8

8 ZIELE 8 LAENDER Eine Reise durch Lateinamerika ... HOME . Menü DAS BUCH ZUR REISE ACHT ZIELE DER UNO ORGANISATIONEN . User CP User name Password
290 Reisemeer: Ihr Reisebüro in

Reisemeer ? Reisen mit und ohne Handicap ? Ihr Reisebüro in Linz für Behinderten gerechte ... Reisemeer Für Menschen mit und ohne Handicap Barrierefreies Reisen - Behindertengerechter Urlaub
291 Informationen zum ist Ihre erste und beste Informationsquelle über reisefalke Hier finden Sie auch weitere ... reise-falke Domain erwerben This domain is FOR SALE - Diese Domain steht ZUM VERKAUF Domain
292 Informationen zum ist Ihre erste und beste Informationsquelle über reisenhofer Hier finden Sie auch weitere ... reisen-hofer Domain erwerben This domain is FOR SALE - Diese Domain steht ZUM VERKAUF Domain
293 GranCanaria DomainQuadrat Marketing GmbH
grancanaria grancanaria kanaren kanarische inseln reise urlaub ... Weitere Infos Sponsored Links zum Thema Gran Canaria Reise Reisen beim Testsieger finden Gran
294 Lastminute Börse Reisen Lastminute

Lastminute Börse Reisen günstige Reiseangebote im Internet Reisebüro online vergleichen buchen! Arrangement Lastminute Börse Reisen Günstige
295 Informationen zum ist Ihre erste und beste Informationsquelle über Reisen buchen Hier finden Sie auch ... Domain erwerben infodomcollect DE US reisen
296 WILLKOMMEN Reinsberger Reisen GMBH Reisebüro
Herzlich Willkommen bei Reinsberger Reisen in Weitensfeld ... REISEN ORGANISIERT Wir organisieren jede gewünschte Reise und erstellen Ihnen nach Ihren Wünschen Reisebüro Taxi Urlaub Buchen Reise
297 Ein Herz für Singles Reisen

Singles suchen Singles um gemeinsam zu verreisen. Das Portal " EIn Herz für Singles ... und Alleinreisende - die etwas andere Partnerbörse - kennenlernen um gemeinsam zu reisen - oder vielleicht auch mehr Reisen Singlebörse Kreuzfahrten Clubreisen
298 Informationen zum ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-versicherung Domain erwerben DOMAIN ERWERBEN DOMAIN FOR SALE Bei Interesse klicken
299 FlixBus ? Günstig mit
Reise mit dem Fernbus in über 900 Städte in Europa. Hol Dir jetzt Dein Busticket ... )TürkçeDeutschNederlandsFrançais?e?tinaSvenska?????????Român?DanskMagyarSloven?inaSloven??inaHrvatski???????EspañolPolskiNederlandsFrançais Go Günstige Fernbus-Reisen ab ? von wählen nach wählen hin zurück Erwachsene Kinder Fahrräder
300 Startseite  OMEGAReisen GMBH Omega

OMEGA Reisen GMBH Rosenweg 22 5164 Seeham Austria ... Toggle navigation Startseite Unsere Reiseziele Golfreisen ProGolf Reisen Individualreisen PRO's Omega Reisen Golf
Pulay Reisen Ges.m.b.H BUSUNTERNEHMEN REISEBÜRO MIETWAGEN Familienbetrieb mit einer über 50jährigen Erfahrung ... KONTAKT BUSANFRAGEN REISEN WANDERN Wir begrüßen Sie auf unserer neuen Homepage! Es freut uns dass BUSUNTERNEHMEN REISEBÜRO MIETWAGEN
302 GranCanaria DomainQuadrat Marketing GmbH
grancanaria grancanaria kanaren kanarische inseln reise urlaub ... Karin Steinberg-Be... Gran Canaria Street Map Dubbele EUR Maremonto Reise- und Wanderf Martin
303 :: LÄNGENGRAD Expeditionen Offroad

Expeditionen Reisen Touren und Outdoor wir organisieren Veranstaltungen sowie Events Beratungen und Offroad Allrad Outdoor Geländewagen
304 Schipp Reisen GmbH busse

Ihr Spezialist für Busreisen ... Startseite Unternehmen Unsere Busse Anfragen Kontakt Herzlich Willkommen bei Schipp Reisen OG Busse Bus Busreisen Reisen
305 Für die Veröffentlichung von

Der kostenlose Service für PR und Öffentlichkeitsarbeit rund um Reisen ... Schöner Reisen ist ein kostenloses Webportal zur Förderung der Reiselust. Wir laden
306 Kleine Zeitung Gute Reise Anzeigen und Marketing Kleine Zeitung GmbH & Co KG urlaub
Über 500 Nah und Fernziele online suchen und buchen! ... Zur klassischen Ansicht der Reiseplattform wechseln Kleine Zeitung Gute Reise - Das Urlaubsportal Urlaub Reise Gute Reise Kleine
307 GenussReisen Österreich: GourmetReisen netwerk Kreidl GmbH & Co KG GenussReisen
Stumm im Zillertal
GenussReisen Österreich: GourmetReisen Gourmet Hotels und GenussUrlaub in Österreich wählen Sie nach Lust ... Einkaufen Unterkünfte Genussvoll reisen in Österreich Ihre Anfrage Sie haben eine Frage zu den Genuss Reisen GenussReisen Österreich GenussUrlaub Österreich Gourmet Hotels
308 Kreuzfahrten Reisen Kreuzfahrten

Reisen Sie mit zu den schönsten Orten der Welt. Wundervolle Kreuzfahrten und Schiffsreisen günstig ... Download Kontakt Home Mit uns Reisen Begleitete Kreuzfahrten Reiseleiter Buchung und Reiseablauf FAQ Warum Kreuzfahrten Kreuzfahrt Schiffsreisen
309 Startseite Prammer

Prammer Reisen In und Auslandsreisen Mietwagen ... Newsletter Startseite Über Uns Geschichte Kontakt Team Alles Grün Reisen Wellness Kultur Events Prammer Reisen Reiseunternehmen Busse Inlandsreisen Auslandsreisen
310 Blaue Reisen Türkei Blaue

... Kontakt Türkei-Links Willkommen bei Pera Air Travel Service ! BLAUE REISEN - SOMMER Unsere Routen Blaue Reisen Türkei Pera Air Travel
311 Intertravel Reisebüro GmbH in

Intertravel Reisebüro GmbH in 1010 Wien bietet Ihnen ein breites Angebot an unterschiedlichen Reisen wie ... Reservierung Reise?Länderinfo Traveldoc Visum Wetter Routenplaner Miles More BA-CA Währungsumrechner
312 Informationen zum ist Ihre erste und beste Informationsquelle über reiseversicherungen Hier finden Sie auch weitere ... + reise-versicherungen Weitere Links Der Inhaber dieser Domain parkt diese beim
313 Informationen zum ist Ihre erste und beste Informationsquelle über reiseausruestung Hier finden Sie auch weitere ... + reise-ausruestung Weitere Links Der Inhaber dieser Domain parkt diese beim Domain
314 Informationen zum ist Ihre erste und beste Informationsquelle über reisebueros Hier finden Sie auch weitere ... + reise-bueros Weitere Links Der Inhaber dieser Domain parkt diese beim Domain
315 Busreisen Steiermark Menapace Menapace

Gerne stellen wir Ihnen uns unsere Leistungen und unser Reiseprogramm mit dem dazugehörigen Service ... von Menapace Reisen. weiter http//static.clearsense//upload/imgproc/bg.jpg Reisevorschau Menapace Reisen Busreisen Steiermark Reisebusunternehmen
316 Unsere Reisen nach Kuba Reisebericht
St. Andrä i. S.
Reisebericht unserer Reisen nach London Paris Amsterdam Rom Kuba Aegypten ... Gerhard und Bianca Hallo Leute das ist die Reise-Homepage von Gerhard und Bianca. Hier könnt Reisebericht USA Kalifornien Travel Barcelona
317 Reisesuchmaschine Reisepreisvergleich Reisesuchmaschine

Online günstig Urlaub buchen Reise Preisvergleich inklusive Discount Reiseangebote Mallorca Urlaub aktuell super ... Flug Eigene Anreise Städtereisen Baustein-Reisen Mietwagen Reiseangebote Dynamische Pauschalreisen Reisesuchmaschine Reiseangebote Günstig Urlaub Buchen
318 Grenzenlos Barrierefrei Reisen barrierefrei
Bad Gleichenberg
Ob im Sommer oder Winter aktiv oder gemütlich hier finden Sie barrierefreien Urlaub ... BARRIEREFREI REISEN begrüßt Sie recht herzlich! Barrierefreiheit Wunderschöne Reisen für Menschen Barrierefrei Reisen Grenzenlos Fauster
319 Home Gabriele Bernsdeiner Gabriele

Kraftvolle und berührende Reisen in Asturien ... Kraftreisen in Asturien menu Home Reisen Energia-Asturias Naturaleza-Asturias Tierra-Asturias Gaia Gabriele Bernsdeiner Shiatsu Oviedo Asturien
320 ATV Akademischer Turnverein Linz ATV
ATV Akademischer Turnverein Linz turnen geräteturnen laufen freundschaft verbindung kultur sport schitour gemeinschaft bewegung leichtathletik ... verbindung kultur sport schitour gemeinschaft bewegung leichtathletik reisen berg wandern tradition ball ATV Akademischer Turnverein Linz Geräteturnen Laufen Freundschaft Verbindung
321 Neuen Weg zu meinem Mental

Es geht um Gefuehrte Mental Reise Mental Training Lebensberatung ... ------------------------- www.gefuehrtementalreise/ Startseite - Geführte Mental Reise ? Geführte Mental Reise Geführte Mental Reise Mentaltraining Mental Training Beratung Lebensberatung Gluecksberatung
322 Flüge | Flug flug
Olching - München
Buchen Sie Flüge online. Flug und Reise einfach buchen. ... Flug Home Flüge Hotel Hotels Wien Hotels Salzburg Reisen Last Minute Mietwagen Länder Informationen Flug Flüge Reisen Buchen
323 Home: Trident Travel Pauschalreisen

Trident Travel Ihr Partner bei Reisen aller Art in 1050 Wien ... Trident Travel Aktiv Reisen Hier finden Sie alle Infos zu unseren Skitourenreisen Wanderurlaub Erlebnis Pauschalreisen Cluburlaub Fernreisen Hitflüge Städtereisen Rundreisen Wellness K
324 Badminton badminton
Hier informiert Sie MaxPhilipp Reisener aus Lüneburg über die Sportart Badminton ... Reisener zum Thema Badminton Badminton Max Reisener Maxphilipp Philipp Reisener
325 Reisen mit Karawane: EntdeckenErlebenErholen Touristik-Versicherungs-Service GmbH
Reisen nach Australien Neuseeland Südsee Afrika Südamerika USA Kanada ... Länderkombinationen Äthiopien Äthiopien Reisen Länderhinweise Botswana Besondere Angebote Mietwagenreisen WD
326 Home | Inspirierende gesunde und nachhaltige Reisen und Unterkünfte weltweit. Garantierte Nachhaltigkeit der Angebote durch ... Kunst und Kultur Städtereisen Kulinarische Reisen Sprachreisen Kunstreisen Alte Zivilisationen Musik
327 Busreisen Vorarlberg Fechtig Busreisen

Willkommen bei Fechtig Busreisen in Vorarlberg freuen Sie sich auf sichere komfortable und ... Fechtig Reisen - Ihr Partner in Vorarlberg! Profitieren Sie von unserer langjährigen Erfahrung Busreisen Vorarlberg
328 Magazin Fußball Ströer Digital Media GmbH Sport
Hamburg ist das Magazin für Reportage und Fotos aus Fußball Fankultur Radsport Sport Fußball Fankultur Radsport
329 BeratungCoaching Veraenderung Verbesserung: Mental
Maria Enzersdorf
Es geht um Gefuehrte Mental Reise Mental Training Lebensberatung ... ------------------------- www.beratungfuermich .at Startseite - Beratung für mich ? Beratung Coaching Workshops und Seminar Mental Training Beratung Lebensberatung Gluecksberatung
330 Lastminute Ferien Reisen Lastminute

Lastminute Ferien Reisen günstige Reiseangebote im Internet Reisebüro online vergleichen buchen! Arrangement Lastminute Ferien Reisen Günstige
331 Nur Reisen

... Reiselinks Startseite Reisen Billigflüge Ferienwohnungen Lastminute Kreuzfahrten Buchungshotline
332 Lufthansa City Center ? Flights

Lufthansa City Center günstige Lastminute Reisen Flüge Hotels Städtereisen Mietwagen ... Reisen HomePage Bevorzugte Partner Online- Buchungen Flüge Low-cost Carrier Hotel Mietauto Ihre Anfrage Flights Worldwide
333 Reisebüro Traunwieser GmbH Reisebüro Traunwieser GmbH Reisebüro
Seekirchen am Wallersee
Reisebüro Mietwagen Traunwieser Seekirchen St.Gilgen Herzlich Willkommen im Urlaub ... Nützliche Wichtige Links Kontakt Newsletter Kontakt So finden Sie uns Datenschutz Reise suchen Reisebüro Mietwagen Traunwieser Seekirchen St.Gilgen Urlaub Reisen Ferien
334 LAGUNA REISEN Ihr Laguna

... Laguna Reisen Angebote Restplatz Magic Life Lastminute Hotel online Hotel online Mietwagen online Laguna Reisen Laguna Reisen ÖVT OEVT WIN Win
335 Flüge vergleichen und günstig urlaub

Reisen zu günstigen Preisen sofort online buchen +++ Top Angebote für Ihren Urlaub ... Wochen HP im DZ Jetzt schon ab € Reisen Frühbucher Pauschalreisen All Inclusive Beauty Wellness Urlaub Reise Urlaub Günstig Urlaub
336 Pera Air Travel Pera

... Sommerakademie Blaue Reisen Türkei-Links Willkommen bei Pera Air Travel Service ! ANTALYA/WIEN Januar ab Eur Pera Tuerkei Reisen
337 Lastminute Reise Angebote

Verreisen Sie gemeinsam mit Urlaubsreise24 in interessante Länder reizvolle Ferienregionen erlebnisreiche Städte. Top ... » Costa Azahar » Costa Blanca » Costa Brava » Costa Del Almeria » Costa Del La Luz » Reisen Costa Del Sol
338 Zeisen Spezialreisen Europäische Reiseversicherung AG Spezialreisen
Zeisen Spezialreisen ist der renommierte Reiseveranstalter für Individual und Spezialreisen. Zusammen Reisen > ZEISEN ... Highlights ? China Thailand Europa USA Österreich Spezialreisen ? Sprachreisen Kung-fu Reisen Spezialreisen Individual China Österreich
339 Seelensprache Willkommen Heilung
Innsbruck Austria
Heilsame Reisen ins Innere ... weiterhin erfolglos im Außen zu suchen trat ich nun meine spannendste und gleichzeitig heilvollste Reise Heilung Melanie Rienzner Journey Dana
340 Startseite Reise

Naturwissenschaftliche Reisen und Exkursionen ans Mittelmeer zur Meeresschule aber auch an andere Destinationen. ... Heimische Exkursionen Kontakt Biete deine eigene Exkursion mit NaWi-Reisen an Meer erleben - Mehr begreifen Reise Exkursionen Meeresschule Gretschel
341 Der Natur Kultur Wandern
Trekking Welten Kultur und Wander Reisen ... nach Allgemein Startseite Vor der Reise Schwierigkeitsgrade Über uns Nachhaltigkeit Neues Restplätze (Auswahl Wandern Trekking Reisen Himalaja
342 Start (PUM Reisen
St. Leonhard bei Freistadt
PUM Reisen Reisedienst Willi Pum in St. Leonhard bei Freistadt. ... PUM Reisen Reisedienst Willi Pum in St. Leonhard bei Freistadt. Start Über uns Team Historie
343 Medibus ein Unternehmen medibus

medibus ist ein moderner Bus der in der Lage ist Patienten oder Personen zu befördern ... Home Krankentransporte sorgenlos Reisen aktuelle Reisen Tagesfahrten Mehrtagesfahrten Unternehmen Medibus Krankentransporte Reisen
344 Musensohn

Der Musensohn Mag. Erich Koroschetz und seine Konzerte seine Schauspielerei und seine Reisen... ... Schauspielerei Konzerte Reisen Über den Musensohn Service Newsletter-Service Bleiben Sie am Laufenden! Tragen Musensohn Erich Koroschetz Konzerte Schauspielerei Reisen Und Mehr
345 Marco Reisen :: Ihr Reisebüro
Marco Reisen :: Ihr unabhängiges Qualitätsreisebüro im Tiroler Oberland :: Reisebüro im Tiroler Oberland ... Reisenewsletter melden Sie sich hier an Kontakt WALSER TOURISTIK SERVICES marco reisen Thomas Walch a Reisebüro Tirol Walser Touristik
346 Maierhofer Reisen | Reisebüro Busreisen

Die Firma Maierhofer Reisen gilt als zuverlässiger Partner für alle Reiseangelegenheiten ... Reiseanfrage Aktuelles Home Die Firma Maierhofer Reisen gilt als zuverlässiger Partner für Busreisen Schülertransporte Taxi Mietwagen
347 Reisen für Alle

... Zur Navigation Zum Inhalt Reisen für Alle Darstellung anpassen Kontrast Schriftgröße Navigation
348 Aktuelles ÖJD OTöne

ÖJD Österreichischer Journalistendienst die Downloadseite für Radiojournalisten zum Thema Reise ... Aktuelles Themen Kultur Reise Kontakt MENU Aktuelles Themen- Kultur- Reise Kontakt OTöne OTon Radio Radiojournalist
349 Profi Reisen Verlagsgesellschaft m.b.H. tourismus

Profi Reisen Verlagsgesellschaft m.b.H. Touristischer Fachverlag Österreich ... Österreichs größter touristischer Fachverlag Mit den Produkten des Profi Reisen Verlags erreichen Tourismus News Trousimusnews Touristik News
350 ADWmagazin Reisen Freizeit Kultur Info

Information Hotel Termine Reisebericht Wellnes Auto Oldimer Motosport ... Home Reisen Auto Kulinarik Events Kultur Bildgalerie Immobilien Shop Kontakt Home Reisen Auto Info Wochenende Weekend Wellness
351 Sturmgut Österreich österreich

Willkommen in Österreich beim Familien und Wanderspezialisten Berghof Sturmgut. österreich reisen urlaube lastminute österreich Kinder Kinderurlaub Kinderhotel
352 deutsche Version Gemüse Gemüse (ohne Reis) Gemischter Teller/Asia Mix Abend Bento Mittags Bento Suppen ... Ihr Warenkorb ist leer. Mittagsmenü Vorspeisen Salate Suppen Nudelsuppentopf Speise in der Box Reis Gemüse (ohne Reis) Gemischter Teller/Asia Mix Abend Bento
353 Ihr online PROTOURS Reisebüro Ges.m.b.H. eticket24
Buchen Sie Ihren Traumurlaub bei! Last Minute Reisen Urlaub Flug ... Sie uns auf Facebook! Bei ihrem Online Reisebüro haben Sie eine große Auswahl von Angebote Eticket24 Airplane Ticket Online Booking
354 OnlineReisebüro in Österreich ?

Herzlich willkommen in Ihrem Reisebüro in 2353 Guntramsdorf. Kommen Sie bei DUO Sport Reisen ... Leistungen Maßgeschneiderte Reise Pauschalreise Erlebnis- Studienreise Reiseempfehlungen
355 Reisen von Lisi

Reisen Reiseberichte Lisi Elisabeth Steininger Linz Österreich PickUp Geocar Kabine Offroad Sahara ... S T O N E S T O U R S Reisen off the beaten tracks von Lisi Martin AKTUELL GEOCARTREFFEN
356 Finnland und Lappland Reisen

Finnland und Lappland Reisen vom Spezialisten Finnland Reise Lappland Reisen Finnland Urlaub ... Kulinarischer Genuss Lapplands Familienreisen Reisen für Paare Für Alleinreisende Schnupperreisen
357 Usability Optimierung philipp
Hier informieren wir Sie über das Thema Usability Optimierung und Website Optimierung Artikel von ... Sie Informationen von Philipp Reisener zum Thema Usability Optimierung Philipp Reisener Usability Optimierung
358 Finnland und Lappland Reisen

Finnland und Lappland Reisen vom Spezialisten Finnland Reise Lappland Reisen Finnland Urlaub ... Kulinarischer Genuss Lapplands Familienreisen Reisen für Paare Für Alleinreisende Schnupperreisen
359 Startseite (Reise)Homepage von

Reiseberichte und Fotos unserer Reisen und Ausflüge der vergangenen Jahre. Island Namibia Slowenien ... So?a Flusstauchen Traun Reisen Rumänien Rumänien Island Südengland
360 Auswahl Reisebüro

Singlereisen Reisen für Alleinstehende Alleinreisende Reisen Reisebüro Single Partner Gruppenreisen Gruppe Gruppen ... Philosophie Ich habe Fragen Zur Reise anmelden ARB ARB Garantie Spiele Platin Reisebüro Travel Travelcenter Reisen
361 Urlaub Reisen buchen reisen

Ihr günstiges Online Reiseportal Tausende HotelAngebote Lastminute Deals billige Urlaubs Angebote ... Hotels Jetzt kostenlos anmelden! Zum Hauptinhalt springen Menü anzeigen Reisen buchen Home Hotel Flug Reisen Reiseportal Onlinereisebüro Onlinereisen
362 Busunternehmen Wildschönau Busunternehmen
Riedmann Reisen ihr Wildschönauer Busunternehmer aus Tirol bringt Sie mit modernen Bussen sicher zu Busunternehmen Wildschönau Bus Busreisen
363 Der HaushaltWasserfilter von Aquasy® aquasy

Der HaushaltWasserfilter von Aquasy® Der günstige Haushalt und Reisewasserfilter für Haushalt Reisen oder ... Wasserfilter Sauberes Wasser für jeden Haushalt AT CH DE EN ES FR IT PT Home Aquasy Haushaltwasserfilter Trink Wasser Filter Filtert
364 Finnland und Lappland Reisen

Finnland und Lappland Reisen vom Spezialisten Finnland Reise Lappland Reisen Finnland Urlaub ... Kulinarischer Genuss Lapplands Familienreisen Reisen für Paare Für Alleinreisende Schnupperreisen

Reise Reisen Safari Individualreisen Reise - Die Öffnungszeiten können zu Feiertagen Karneval, Valentinstag, Ostern (Karfreitag Ostersonntag Ostermontag), Tag der Arbeit und Himmelfahrt abweichen. Statistiken:
StadtBranche Punkte für "Reise " - In die Bewertung wird die Anzahl der Besucher und Erfahrungsberichte dieser Themenseite mit einbezogen. Reise › Reisen Safari Individualreisen Österreich - Reise Bewertungen Öffnungszeiten und Erfahrungen. Stand: 2020

Neuer Eintrag 

Der Begriff Reise bedeutet im Sinne der Verkehrswirtschaft die Fortbewegung von Personen über eine längere Zeit zu Fuß oder mit Verkehrsmitteln außerhalb des Warenverkehrs, um ein einzelnes Ziel zu erreichen oder mehrere Orte kennenzulernen . Auch im Wirtschaftsverkehr werden Reisen unternommen . Im fremdenverkehrswirtschaftlichen Sinne umfasst eine Reise sowohl die Ortsveränderung selbst als auch den Aufenthalt am Zielort. Die verwendeten Verkehrsmittel bilden hierbei eine sogenannte Reisekette . Reise Öffnungszeit und Erfahrungen

△ nach oben kostenfreier Eintrag Datenschutz