Reise › Trüffel Trüffelarten Trüffelhund Österreich


Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 Östrreichs erstes Trüffelforum Forum

Forum von Trüffelhang - Österreichs erste Trüffelforum In Österreichs erstem Trüffelforum kannst du mit Trüffelbegeisterte verschiedene Themen rund um den Trüffel..üffelforum Trüffel Trüffelarten Trüffelhund Trüffelsuche Geschichte Trüffelbaum Trüffelanbau Tuber Italien Reise Trüffelhang Teil Romagnolo Trüffeln Seite
2 4WD Touren - Private Abenteuer Reisen

Gosnells Westaustralien
Diese Reisearten sind im Angebot:  Geländewagentouren als Tag Along Touren in Gruppen mit individuellen Fahrzeugen durch alle Geländewagenstrecken wie z.B. Canning.. Otto Stock Route Canning Australien Geländewagen Outback Reise Australian West Guiding Tour Kleingruppenreisen Geländewagentour Private
3 Herr Markus Karner Reisen

Bad st. Leonhard
Die Vorfreude ist die schönste Freude, so sagt der Volksmund. Das trifft sicher auch auf die schönste Zeit des Jahres.. Zeit Urlaub Markus Urlaubmarkus Urlaubsreisen Urlaubsziele Gratis Preisen Reise Price Saison Garantie Wer Reisebüro Kurzreisen
4 SFA Sprachreisen Sprachreisen

SFA Sprachreisen in Salzburg und Wien bieten Sprachreisen und Sprachferien in England, Frankreich und den USA in Englisch, Französisch, Italienisch.. Sprachreisen Jugendliche Erwachsene Sprachferien Wien Salzburg Ausland Schulklassen Angebote Katalog Sprache Reise St San Unterbringung
5 Hagleitner Touristik – Genuss Reisebüro

Zell am See
Wer auf der Suche nach Genussurlaub oder Gourmetreisen ist, ist beim Profi für Genussreisen Marion Hagleitner Touristik genau richtig. Hagleitner.. Gtgtgt Radreisen Genussreise Touristik Buchen Hagleitner Italien österreich Gourmetreisen Entdecken Deutschland Genussreisen Genuss Genussurlaub Datenleitung Sicherer Finden Adria
6 PromoMasters Online Marketing Wien Suchmaschinenoptimierung

PromoMasters Wien ist Spezialist für Suchmaschinenmarketing, Suchmaschinenoptimierung SEO, Suchmaschinenwerbung SEA und AdWords sowie Analytics. Die Agentur mit Sitz in Wien.. Google Promomasters Suchmaschinenoptimierung Blog Website Media Social Adwords Responsive Seo Tipps Schulung Open Relaunch Salzburg Reise Assistent Graph Tablets Suchmaschinenmarketing Tourismus
7 Gutscheine Gewinnspiele sowie Online-Shops aller Art Gutscheine Gewinnspiele sowie Online-Shops Werbeagentur

Weißkirchen in Steiermark
Discount Portal bietet seriöse, geprüfte Gutscheine und Gewinnspiele an, die täglich aktualisiert und ergänzt werden. Nebenbei werden Online-Shopping sehr leicht gemacht.. Gewinnspiele Gutscheine Discount Besten Urlaubsportale Portal Reise Gratis Testenz Produte
8 Flughafentaxi Wien Taxiunternehmen

Flughafentaxi Wien - Der kostengünstigste Reise ohne Stress Flughafentaxi Wien bedient seit über 5 Jahren den Transportbedarf des Flughafen in Wien... Flughafen Wien Reise Flughafentaxi Passagiere Kunden Schritt Handgepäck Koffer Fahrer Stk Faq Taxi Fahrt Bestellen Meeting Bustransferherumschlagen Transfer
9 Reisebus mieten Reise

Naderer bietet ein breitgefächertes Angebot von individuellen Tagesausflügen über organisierte Mehrtagesfahrten bis hin zu längeren Urlauben. Als Reisedienstleister plant.. Reise Bus Mieten Busreise Linz Naderer Reisebus Reisekalender Rückfahrt Kleinbus Anfrage Zusätzliche Angebot Preis Versicherungen Pauschalreisen Zeit Einzelzimmer Fahrzeiten Browser
10 Individualpädagogik Projekt Kanu bauen Kanutrekking Individualpädagogik Projekt Kanu bauen Individualpädagogik Sozialpädagogik

Wiener Neustadt
Eine erlebnispädagogische Reise mit dem Kanu - vom Selbstbau bis zur Ausfahrt Ich biete erlebnispädagogische Kanu Bau Workshops an, in welchen.. Kanu Kanus Kanubauen Bauen Angebot Trekking Pixeliode Kanutrekking Kinder Behinderung Erlebnispdagogik Stunde Stunden Jugendlichen Schiffsbau Sperrholz Zeta Preisanbotes Reise
11 Private Rundreisen auf Sri Reise

Individuelle Rundreisen und Ausflüge auf Sri Lanka - angeboten von Ihrem privaten Fahrer Kapila Bandara.. Lanka Holiday Kapila Bandara Tours Driver Sri Private Contact Reviews Culture Nature Kotalawala Kapila@hotmailcom Y
12 Reisesuchmaschine Reisevermittlung

Reisepreisvergleich, online Buchung und Beratung quer durch den Bereich Tourismus. Neben den Pauschalreisen, Flüge und Hotels gehören auch Rundreisen, Kreuzfahrten.. Reise Urlaub Anreise Eigene Flug Reisen Buchen Pauschalreisen Sommerurlaub Minute Italien Reisesuchmaschine Last Hotel Günstig Schweiz Paris
13 Ristorante il Cavallino Baden Italienisches Restaurant

… im Ristorante il Cavallino, dem neuen Badener Treffpunkt für alle Freunde der feinen italienischen Küche. Begeben Sie sich mit.. Ristorante Cavallino Zutaten Baden Restaurant Fotos Speisekarte Cucina Italienische Atmospäre Begeben Freunde Muss– Reise Welt
14 Christina Gritsch Altwaren Räumungen

Zeitreise, Historische Möbel, Antike Möbel, Räumungen, 50er, 60er, 70er, 80er, Schallplatten, Bücher, Teppiche, Antiquitäten, Gritsch, Puppen, Tische, Möbel, Regale, Verlassenschaften.. Zeitreise Herzlichst Platz Christina Spezialistin Glas Porzellan Möbel Mich Geschäft Reise Musik Angebot Gebrauchtwaren Schnitzelklopfer Verlassenschaft Epochen Lassen Ostern Möbel Kleinteile
15 Vorarlberg-Hotels Reise

Vorarlberg-Hotels ist ein unabhängiger Blog. Wir stellen Ihnen hier regelmässig Hotels im Ländle vor, die wir selbst getestet haben... Hotel Hotels Leave Posted Vorarlberg Kleinwalsertal Zimmer Hirschegg Montafon Dornbirn Schruns Bezau Silbertal Tagged Scesaplana
16 La Vida Bella - Lebensberatung

Ich nehme mir bewusst Zeit, für Sie hier zu sein, um Sie und Ihre Themen kennen zu lernen. Mit diversen.. Text Bitte Eingabefeld Mail Vinothchandar Schritt Reise Nachricht Entscheidung Vida Bella Unterstützt Name Webnode Ecke Reiki Mein Ch
17 Ferienwohnung Galtür Reise

Ferienwohnung Paznaun.. Tirol Urlaub Galtür Ferienwohnungen Oostenrijk Vakantiewoning Reizen Schönen Land Ferienwohnung Unser Ferienhäuser Ferienwohnungs Winterurlaubtirol Y
18 Koffer und Taschen Lederwaren

Ein Fachgeschäft für praktische Reisekoffer, Trollys, Reisetaschen und Reisebedarf für sicheres und bequemes reisen.Modische Taschen und Geldbörsen. Aktuell-Billig-Chick. Seit 25.. Lederwaren Wien Reise Taschen Reisetasche Geldtaschen Abc Koffer Freizeit Kabinengrösse Reisen Shopping Angebote Businessschule Reisegepäck Aktuell Billig Chic Lederbörsen Qualität
19 Koffer und Taschen Lederwaren

Ein Fachgeschäft für praktische Reisekoffer, Trollys, Reisetaschen und Reisebedarf für sicheres und bequemes reisen.Modische Taschen und Geldbörsen. Große Auswahl an.. Lederwaren Wien Reise Geldtaschen Taschen Abc Reisetasche Koffer Reiseaccesoires Reisekoffer Shopping Kabinengrösse Reisegepäck Angebote Reisen Modische Lederbörsen Laptoptaschen
20 Marokko Reisen vom Spezialisten Reiseveranstalter

Erleben Sie die Vielfalt und Gastfreundlichkeit Marokkos auf einer Individual- oder Gruppenreise. Seit 39 Jahren sind wir darauf spezialisiert, Ihren.. Reisen Marokko Ritz Land Katalog Golfreisen Individuelle Leute Reise Golf Marokkoreisen Städtereisen Golfplätze Kontaktformular Vertragsbedingungen Reiseziel
21 Urlaub am Klopeinersee Reise

Wir von Einfach Klopeinersee bieten ausgewählte Unterkünfte in verschiedenen Preiskategorien am Klopeinersee an. Ob ein einfaches Zimmer im Zentrum.. Klopeinersee Einfach Klopeiner Deine Unterkünfte Urlaub Zimmer Pension Unterkunft Badesteg Funktionierts Google+ Hotel Faqs Unterkünften Sende
22 Satur reisen Satur

Satur reisen ... Satur reisen AKTUELL INDIVIDUELL UND GRUPPENREISEN Hohen Tatra Zipser Land Holzkirchen UNESCO Satur Reisen
23 KrennReisen krenn
Bad Gleichenberg
Krenn Reisen ... Krenn-Reisen Gesellig Aktiv Gourmet Busse mieten Suche Busse mieten? + Krenn Reise Reisen Gourmet Pilgern Wallfahrt Bus Shuttle
24 Individuelle Reisen weltweit | Reisen

Weltweite Reisen individuell zusammenstellen. MESO Reisen Ihr Reiseveranstalter für Fernreisen. ... oder infomeso-berlin Alternativ Tours GmbH MESO Reisen GmbH Reisebüro Berlin Otto-Suhr-Allee Reisen Individuell MESO Reisen MESO Reisen Berlin Weltweit
25 ClubReisen: Hier finden Sie ClubReisen

ClubReisen: Finden Sie aktuelle Angebote zu ClubReisen. Viele Infos und alle Angebote. Sparen Sie bis ...  Club-Reisen Hier finden Sie alles zu Club-Reisen Club-Reisen Club Aldiana Club Robinson Club ClubReisen
26 IslandReisen Ihr Islandreise Spezialist Island

IslandReisen Ihr Islandreise Spezialist Agentur für Reisen nach Island ... + - Kontakt Katalog Menu Pauschalreisen Minigruppen Reisen Island Reise Islandreise Islandreisen Island
27 Reisen Restplatz billig Urlaub traviaNET GmbH Urlaub
Urlaub Reisen Restplatz Italien Restplätze Reisen billig Günstige Reisen Portugal ... Restplätze Cancun Reisen Spanien Restplatz Türkei Billige Reisen Griechenland billig Reisen Kreta Urlaub Reisen Spanien Restplatz
28 Strohmeier Reisen Ihr Reisen

Mit Strohmeier Reisen reisen. Ihr Partner für entspanntes Reisen. ...  Strohmeier Reisen - Ihr Partner für entspanntes Reisen Ihr Partner für entspanntes Reisen Reisen Busfahrten Steiermark Wettmannstätten
29 ReiseInsider das österreichische Reise

Reise Insider ... Ein Roadtrip auf dem südlichsten Abschnitt des Highway in Florida - hier heißt es reisen statt... weiterlesen Reise Insider Reiseportal Reiseblog
30 GOSCH reisen Tagesfahrten Michaela und Franz Gosch OG GOSCH
GOSCH Reisen. Tagesfahrten. ... Highlights Reise-Highlights Reiseeindrücke Reisen Tagesfahrten Mehrtagesfahrten GOSCH Reisen Tagesfahrten
31 Reisebausteine Reisen weltweit reisebausteine

Auf finden Sie mehr als 6000 Angebote und Reise Ideen weltweit preiswert und mit ... ..... gleich geht es weiter zu den Reise Angeboten auf reisebausteine Reisebausteine Reisen Reise Urlaub
32 Besser REISEN das Besser

besser REISEN Das Österreichische Reiseportal ... Home Reise News Auf Tour Österreich City-Trip Service Lifestyle Angebote besser REISEN-Tipps Besser Reisen Reisetipps LastMinute Kreuzfahrten
33 Homepage Hietz Reisen Hietz

Hietz Bus Reisen ... . WILLKOMMEN auf unserer Homepage von Hietz Reisen Gerne Hietz Bus Reisen Autobus Ausflug
34 Hermann und Susanne auf Hermann

Hermann und Susanne auf Reisen ... Hermann und Susanne auf Reisen Main menu About Home Meta Log in Entries RSS Comments RSS Hermann Und Susanne Auf Reisen
35 Lastminute Reise lastminute

Last Minute Urlaub zu Schnaeppchen Preisen reisedirekt: Direkt buchen direkt sparen. Grosser Reise und ... Minute Flüge Cluburlaub Kreuzfahrten » Hochseekreuzfahrten » Flusskreuzfahrten Lastminute Reise Über Lastminute Reise
36 Lastminute Reisen lastminute

Last Minute Urlaub zu Schnaeppchen Preisen reisedirekt: Direkt buchen direkt sparen. Grosser Reise und ... Minute Flüge Cluburlaub Kreuzfahrten » Hochseekreuzfahrten » Flusskreuzfahrten Lastminute Reisen Über Lastminute Reisen
37 Besser REISEN das Besser

besser REISEN Das Österreichische Reiseportal ... Home Auf Tour Österreich City-Trip Service Lifestyle Angebote besser REISEN-Tipps Printausgabe Besser Reisen Reisetipps LastMinute Kreuzfahrten
38 Günstig Reisen Reisen
Wien Günstig Reisen nah und fern Reisen für jedes Budget und Alter ... Reiseidee - Reisen weltweit Günstig Reisen nah und fern Asien Baden Tauchen Asien Indien Reisen Indonesien Reisen Reise Rundreisen Rundreise
39 Willkommen bei mit Reisen mit Reisen GmbH mit
mit Reisen bietet Ihnen Urlaubs Geschäfts und IncentiveReisen aus einer Hand. Bei uns stehen ... Sie Javascript und laden Sie die Seite neu! Home Was wir machen Reiseziele Team Kontakt Willkommen bei mit Reisen Mit Reisen Sommerurlaub Urlaub Linz
40 Reisebüro Kerschner Reisen Kerschner Reisen GmbH Reisebüro
Webauftritt des Reisebüro Kerschner Reisen. ... Navigation überspringen Start Kerschner Reisen Ski-Express Reiseangebote Event-Bus Kataloge Reisebüro Busunternehmen TUI Reise Center
41 RISA Reisen | Reisen gruppenreise
RISA Reisen ? Ihr Reiseveranstalter für Südamerika! Hier finden Sie Ideen für Reisen im Mietwagen ... + - inforisa-reisen RISA Reisen Reisen in Südamerika Gruppenreise Rundreise Reiseveranstalter Suedamerika Reisen Mietwagen Klei
42 Herzlich Willkommen bei Ratzenböck Reisebüro

Ratzenboeck Reisen stellt Sich das Reisebuero und die Reisen vor... Mit Freunden reisen! ... Sie über interessante Reisen informieren zu dürfen. Herzlich Willkommen bei Ratzenböck Reisen! Willkommen Wir freuen Reisebüro Autobus Reisebus Busreisen
43 Im Seekajak auf Reisen seekajak

Seekajak Reisen sind Aktiv Reisen mit einem Schuss Abenteuer. Im Seekajak kommt ihr an entlegene ... Seekajaktouren - Europa weltweit Start Im Kajak reisen? Seekajakreisen ? für wen? Seekajak Seekajak Seekajakreisen Aktiv Reisen Aktives
44 Mare Baltikum Reisen Christine Salten & Andres Vainumäe GbR reise
Mare Baltikum Reisen bietet Reisen nach Estland Lettland Litauen Skandinavien mit Finnland ... Lettland Litauen Finnland Polen Russland Norwegen Schweden Dänemark Reisen Gruppenreisen Kulturreisen Reise Baltikum Baltikum Reisen Reisen Im
45 Last Minute Touristik GmbH last
Last Minute Reisen mit persönlicher Beratung buchen ? günstige Reisen buchen ? Pauschalreisen mit Bestpreisgarantie ... Kreuzfahrten Ausflüge Kurzreisen Last Minute Last-Minute Reisen Reisen bis EUR - Pauschalreisen Günstige Last Minute Reisen Last Minute Urlaub
46 Jedek Reisen: Jedek Reisen jedek
JedekReisen: Ihr Spezialist für den etwas anderen Urlaub ... Pauschalreisen Mexico Home AGB Links Newsletter Jedek Reisen GmbH Jedek Reisen Jedekreisen Urlaub
47 NESS Reisen Ness

Wir sind gerne für Sie da: NESS Reisen GmbH. Dammstr. 6 1200 Wien ... NESS Reisen Menü Kontakt Kataloge online Newsletter Angebote Sonderangebote Online Buchungstool Ness Reisen NessReisen Ness Reisen
48 Magisch Reisen Magisch

Magisch Reisen Magisch Reisen
49 Gegg Reisen Exklusiv Luxus

Gegg Reisen Busreisen und vieles mehr! Leben ist Bewegung Bewegung ist Reisen ... AKTUELL Gegg Reisekatalog >Reiseträume < jetzt erhältlich Der neue Gegg-Reisen Katalog >Reiseträume Luxus Bistro Bistrobus Setra
50 Last Minute Reisen Angebote Holiday Smart GmbH Last
Last Minute Reisen Angebote im Überblick von allen Veranstaltern finden Sie hier. Ihr ... Last Minute Reisen Angebote Last Minute Reisen Angebote können Sie ganz einfach hier vergleichen Last Minute Angebote Last Minute Reisen Angebote
51 Reiseangebote im reisesuchmaschine

Flug reisen Luxusreisen billig reisen Pauschalreisen und auch eigene Anreise last ... Städtereisen Baustein-Reisen Mietwagen Kreuzfahrt Wellness Sonstige Angebote Sterne Luxusreisen Reisen Reisesuchmaschine Flugreisen Sommerurlaub Winterurlaub
52 Reisen direkt Reisen Ferien ferien

Ferien und Reisen zu Schnaeppchen Preisen reisedirekt: Direkt buchen direkt sparen. Grosser Reise und ...  Reisen direkt Reisen Ferien buchen - direkt sparen Inline HTML Online Reiseanfrage oder Live Ferien Reisen Urlaub
53 Reiseberichte auf Reiseziele

Reiseziele Reise Urlaub USA Reisebericht Reiseinfo ... auf Reise-Ziele! Reiseziele Reise Urlaub USA Reisebericht Reiseinfo
54 Romania Touristik / RotReisen Ihre

Ihre Reise Spezialistäten für gelungene maßgeschneiderte Reisen und Urlaube! ... lunii! Profitati de reducere % din preturile afisate! Gruppenangebote Reisen und sparen mit netter Ihre +Reise +Spezialisten Für Gelungene Maßgeschneiderte+ Reisen* Und
55 SchweizerReisen Startseite Schweizer

SchweizerReisen in Korneuburg bietet exquisite Studien und Kulturreisen ... Menu Startseite Startseite ÖCV und MKV Reisen ÖCV und MKV Reisen Allgäu und Vorarlberg Allgäu Schweizer Reisen Studienreisen Kulturreisen Busreisen
56 REISEaktuell Das österreichische CB-Verlags GesmbH Reise
REISEaktuell eines der attraktivsten Reisemagazine aus Österreich informiert mit Top News zum Thema ... Executive Club Herzlich Willkommen! REISE-aktuell das internationale Reise-Journal konkretisiert Reise Magazin Reisemagazin Reise Aktuell
57 Lifeearthreisen Home Reisen

LifeearthReisen ... im Regenwald von Madagaskar mit Blind Climber Andy Holzer Diesmal führt die Reise mit Andy Holzer Reisen Afrika Asien Amerika
58 Reisen Leben notizen
Notizen zu Freizeit Reisen Leben Arbeit ... Navigation Freizeit Notizen Reisen Notizen Leben Notizen Arbeit Notizen Allgemein Startseite Notizen At Freizeit Reisen
59 Weinstadt Reisebüro Fischer Reisen reisen

Fischer Touristik Reisen ... Fischer Touristik - Weinstadt Startseite Reisen Hotel Kreuzfahrten Ferienhaus/Wohnung Mietwagen Reisen Weinstadt Lastminute Pauschalreisen Fischer Touristik Kreuzfahrt
60 Lidl Reisen ...einfach Lidl E-Commerce International GmbH & Co. KG Lidl
LidlReisen sind spannende und erholsame Reisen zu unglaublich günstigen Preisen in die ganze Welt ...einfach ... um alle Funktionen unserer Seite nutzen zu können. Zur Navigation springen Zum Inhalt springen Lidl Reisen ...einfach Lidl Reisen LidlReisen Flugreisen
61 Weiss Reisen Reisebüro Weiss

Ihr Reisebüro WeissReisen Bus Schiffs und Flugreisen. 5280 Braunau ... Reisebüropartner Reiseversicherung Kontakt Herzlich Willkommen bei Weiss-Reisen in Braunau Weiss-Reisen Weiss Reisebüro Reisen Busreisen Flugreisen
62 Neuhuber Reisen Neuhuber
Neuhuber Reisen Österreichs erstes MOBILES REISEBÜRO mit Sitz in Villach Kärnten ... . Makunudu Malediven Ich sehe mich als Ihr Guide und persönlicher Reise-Berater durch den wirren Angebots Neuhuber Reisen Elke Neuhuber Reisebüro
63 Bixi: Ski Rennrad rennrad
Bixi's SlowRide rennrad reisen und skireisen Homepage ... Rennrad-Reisen zum Marathon Nove Colli - Cesenatico .. - .. Die Reise zum Maratona Rennrad Reisen Radmarathon Ski Tiefschnee Slowride Bixi
64 Pernsteiner Reisen: Startseite Pernsteiner GmbH Pernsteiner
Kirchberg ob der Donau
Pernsteiner Reisen Reisebüro Reiseberater Reiseführer ... Reisefotos Fahrpläne Neu aktuelle Reisen NEU! Musical Mary Poppins im Ronacher Theater Samstag . Dezember Pernsteiner Reisen Reisebüro Busreisen Tagesreisen
65 AusserfernReisen Bernhard Holaschke Reisen

Ausserfern Reisen Reisebüro in Ehrwald Tirol Bernhard Holaschke ... Freitag .. Start Ausserfern Reisen - Bernhard Holaschke Home News Kontakt Bilder Login Reisen Urlaub Winter Sommer
66 Die Website Weekend

Die Website rund um das Thema Reisen Urlaub in Österreich ReiseNews uvm.! ... Wir unternehmen je . Einwohnern die meisten Reisen darunter auch Fernreisen und geben mit die höchsten Weekend Österreich Navigator ReiseNews
67 Wien Reise Kurzreise

Die Reisen nach Wien werden immer in Erinnerung bleiben denn nach einem Besuch ... WWW.REISEN-WIEN.AT Infos und Tipps Reisen Wien Sehenswürdigkeiten Alltagskultur Infrastruktur Kurzreise Wien Wien Kurzreisen Wien Reisen
68 Mayerhofer Reisen Home Mayerhofer

Mayerhofer Reisen Reisebüro Reisebusse Taxi Personenbeförderung ... . >> www.europaeische Allgemeine Reisebedingungen Für unsere Reisen gelten die Allgemeinen Reisebedingungen (ARB Mayerhofer Reisen Mayerhofer Reisen Hubert
69 Alaska reisen alaskatravel
Willkommen bei ALASKA REISEN erleben Sie mit uns unvergessliche Reiseeindrücke ... alaska reisen Direkt zum Seiteninhalt Hauptmenü Homepage PROGRAMM FOTOGALERIE Album Album Alaskatravel Alaska Travel Alaskatravel Alaskareisen
70 Reise Stornoversicherung Reise
Reise Stornoversicherung Die Reiseversicherung für Österreich mit unserem Vergleichsrechner finden Sie schnell und ... Sie? Vergleichsrechner Reise - Stornoversicherung Vergleich Reise Stornoversicherung für Reisende aus Österreich Reise Stornoversicherung Reiseversicherung
71 Aydin Reisen Startseite Reisebüro
Aydin Reisen Reisebüro in Lustenau/Vorarlberg. Tel. 05577 89981 ... bei Aydin Reisen! Wir freuen uns Sie über aktuelle Reiseangebote informieren zu dürfen. Unser Personal steht Reisebüro Türkei Istanbul Reisen
72 Die schönsten Reisen zu Urlaub
W i e n
Die besten Anbieter für Ihre Reise vergleichen Sie die Preise es lohnt sich! ... Die schönsten Reisen zu besten Preisen! Flüge Die Flughhäfen der Welt - die günstigsten Flüge Urlaub Reisen Flüge Hotels
73 M.e.i.e.r Reisen Erleben Urlaubsreisen tür

Verreisen Sie mit M.e.i.e.r Reisen Türkeireisen zu günstigen Preisen. Jetzt zuschlagen und in der ... HOME TOP Angebote Dubai Infos zur Reise Termine Preise Türkei Termine Preise Infos zur Reise Urlaubsreisen Türkei Meier Reisen
74 Online Reise Billiger

Billiger Reisen günstiger fliegen Last Minute Angebote und Mietwagen Preisvergleich. Das alles finden ... www.ORP Online Reise Portal Hotelsuche Mietwagen Last-Minute Ski Snwoboard Billiger Reisen Günstiger Fliegen
75 Freund Reisen Mayrhofen Zillertal Freund

Freund Reisen Reisefreund das Reisebüro in Tirol ... Freund Reisen Mayrhofen Zillertal reisefreund Reisebuero online buchen Last Minute Freund Reisen Reisefreund Das Reisebüro In Tirol
76 Türkei Reise Urlaub ÖGER TOURS GmbH Türkei
Ihr Reiseanbieter für Türkei Urlaub Reisen Städtereisen und Hotels. Buchen Sie "günstige" Reiseangebote ... Preishits Reisen unter - ? Hoteltipp Türkei Toggle submenu Aktivurlaub Toggle submenu Ausflüge Türkei Reisen Türkeireisen Türkei Reisen Türkei Urlaub Türkeireisen
77 Vatkov Reisen Vatkov Vatkov

??????????? ????????????? ???????? VATKOV REISEN GmbH ?????????? ??????? ???????? ????????? ? ??????? ??????????? ?????????? ... No images ??????? ???????? ????????? ????????? ??????? VATKOV REISEN GmbH + Vatkov Reisen ????????????? ???????? ???????????
78 Schröfelbauer reisen Schröfelbauer
Ich lege großen Wert auf Qualität das heißt bei allen unseren Reisen sind genug ... Reiseecke in Gaming Schröfelbauer Reisen Gaming Markt Gaming Telefon texing Schröfelbauer; Schroefelbauer; Reisen; Texingtaler Taxi; Texing; Texingtal; Taxi

Mit Taxi Heidis Reisen reisen Sie bequemer von A nach B. ... HOME FUHRPARK KRANKENTRANSPORT KONTAKT > CHEFSACHE > CATS DOGS TAXI HEIDIS REISEN - die feinere Taxi Tranfser Flughafentaxi Jugendtaxi Businessfahrzeug Krankentransport Kinderg
80 Busch Pedit Reisen Busreisen

Busreisen Reisen Bus Busch Pedit Mietbusse BusCharter ... BUSUNTERNEHMEN mit sehr dynamischer Entwicklung und haben unsere Tätigkeit unter das Motto REISEN MIT SERVICE Busreisen Reisen Busunternehmen Innsbruck
81 MusicCorn WorkshopReisen 2014 Corn GmbH Workshop
"MusicCorn Reisen" ist ein Angebot des Musikhauses MusicCorn. Wir bieten WorkshopReisenGesamtpakete: Anreise Unterkunft ... Musik-Workshop-Reisen Reisen Kontakt ARB Workshop-Reise Gitarre .. - . Workshop; Reise; Reisen; Urlaub; Workshop; Kurs; Seminar; Musik
82 SportivReisen vereint Urlaub mit Sportreisen
SportivReisen vereint Urlaub mit Fitness. ... Das Team FSC Sport-Shop Kontakt Sportiv-Reisen vereint Urlaub mit Fitness. Sportivreisen intern Sportreisen Sport Reisen Afterwork Training
83 Hammertinger Reisen .:. Home Reisen
Frankenburg am Hausruck
Hammertinger Reisen in Frankenburg. Ihr Spezialist für Reisen Kurreisen Wallfahrten Badefahrten ... Reisen Tagesfahrten Adventsfahrten Wellnessreisen Musikfahrten Flugreisen Kreuzfahrten Wallfahrten Reisen Kurreisen Wallfahrten Badefahrten
84 MairReisen Wattens Willkommen Mair Reisen GmbH Mair
MairReisen Wattens Ihr Partner wenn Sie ein Busunternehmen mit viel Komfort suchen. Vom ... -Race in Schladming Firmenevents oder Vereinsausflüge - mit Mair-Reisen ist eine entspannte Mair Reisen Bus Reise
85 Egons Reise Egons
Egons verrückte Reise Ein Hörbuch mit Liedern und Dialogen von Simon Kräutler Michael Schefts ... Egons verrückte Reise Egons Familie Facebook Downloads Kontakt Kontakt Egons verrückte Egons Reise Egon´s Reise Egon´s Verrückte
86 Reisen nach Südamerika INTI Tours e.K. Reisen
INIT Tours ist ein spezialisierter Reiseveranstalter für nachhaltige Reisen nach Südamerika Mittelamerika und in ... Eisenbahnromantik Studienreisen ? INTI Tours > Reisen nach Südamerika Mittelamerika und in die Karibik Herzlich Reisen Nach Südamerika Reisen Nach Mittelamerika
87  sabtours Reisen sabtours

sabtours bietet Busreisen Flugreisen Kreuzfahrten Pauschalreisen und vieles mehr. In unseren 18 ... zum Reiseblog erweiterte Suche sab-reisen Busreisen Flugreisen Städtereisen Fernreisen Badereisen Sabtours Reisen Sabreisen Sabcruises Sabbusse
88 INTER VEGA REISEN I.V.R Reisebüro GmbH Intervegareisen
Intervegareisen Ihr zuverlässiger Partner für jede Reise dieser Welt! ... Sofia City Break Rundreise Bulgarien Tage Sommelier Trip Matura Reise nach Bulgarien Intervegareisen INTERVEGAREISEN Inter Vega
89  sabtours Reisen sabtours

sabtours bietet Busreisen Flugreisen Kreuzfahrten Pauschalreisen und vieles mehr. In unseren 18 ... erweiterte Suche sab-reisen Busreisen Flugreisen Städtereisen Fernreisen Badereisen Vital Sabtours Reisen Sabreisen Sabcruises Sabbusse
90 Was ist .reise? dotreise-registry GmbH
.reise die neue TopLevelDomain der Reisewirtschaft ... Über .reise Was ist .reise? Vision Vorteile von .reise Google wird .reise-Domains lieben Grusswort
91 Reisen24Online | günstig reisen günstig
Sankt Martin an der Raab
Reisesuchmaschine günstig Reisen | Preisvergleich und Angebote für Flüge Hotels und Ferienwohnungen ... News REISEGEWINNSPIEL REISE-NEWSLETTER Ausgezeichnet als "BestNewsletter"! Aktuelle Reiseangebote Günstig Reisen Billige Flüge Billige Hotels
92 Tromayer Reisen Bruchmann Alois e.U. Stefan
Stefan Tromayer Reisen Mönichwald Bus Taxi unternehmen für Eventreisen Ausflüge Krankentransporte ... mit Ihnen! Steigen Sie ein und fahren Sie mit uns. Â Gelo Systems Tromayer Reisen officetromayer-reisen Stefan Tromayer Tromayer Stefan Stefan
93  sabtours Reisen sabtours

sabtours bietet Busreisen Flugreisen Kreuzfahrten Pauschalreisen und vieles mehr. In unseren 18 ... Rufen Sie uns an für persönliche Beratung! Mo bis Sa ? sab-reisen Reisehits Sabtours Reisen Sabreisen Sabcruises Sabbusse
94 Lastminute Reisen Lastminute

Hier finden Sie Reise Angebote mit Tiefstpreisgarantie! ... Städtereisen Hotels . Wellness Wellness Reisen . The s.mile Family Reiseführer . Info-Service Auswertiges-Amt Lastminute Reiseangebote LastMinute Billigreise
95 Siebler Reisen Der siebler
Siebler Reisen ? Der Drautaler | Der Ansprechpartner für Ihre Reise Busreisen Taxi ... Siebler Reisen - Der Drautaler Reisebüro Busreisen Taxi Mietwagen Siebler Reisen Home Siebler Reisen Der Drautaler Irschen
96 Vietnam reisen individuel geführt ho

vietnam reisen individuel geführt mekong delta hanoi halon bay ... auf meiner Seite und viel Spass beim Anschauen und Auswählen +++ Wer sich auf die Reise nach Vietnam begibt Ho Chi Minh Hanoi Halong Bay Mui Ne
97 Schenker Reisen Schenker
Schenker Reisen Ihr Reisebüro für Ihren perfekten Urlaub reibungslose Geschäftsreise aufregende Gruppenreise ...  Schenker Reisen Startseite Kontakt Newsletter Unsere Website ist nicht für Schenker Reisebüro Innsbruck Urlaub
98 GloboReisen Erlebnisreisen Indonesien Kleines

Kleines Reisebüro Reisen nach Indonesien Reisen nach Bali Reisen nach Lomok Erlebnisreisen ... Sie den Vorteil dass ich selbst gerne reise! Kleines Reisebüro Gruppenreise Chile Chilereise
99 URLAUB IN BESTEN HÄNDEN Schauinsland-Reisen GmbH Schauinsland
Lastminute Pauschal nur Hotel oder nur Flug Angebote von SchauinslandReisen ... Teneriffa Hotel Iberostar Anthelia Schauinsland-Reisen GmbH Startseite Service Sitemap Anfahrt Schauinsland Reisen Urlaub Angebote Hotel Flug Pauschal Lastminute
100 Eine Reise zu sich Angelika

Erleben Sie mit den Klangschalen von Angelika Nagele in Klagenfurt eine Reise zu sich selbst ... Schenken sie sich und Ihren Lieben eine besondere Reise zu sich! Angelika Nagele Klangschalen Angelika Nagele Klangschalen Tiefenentspannung Schwingung Klagenfurt Reise Zus
101 SILMAR Reisen Start/home Sylvia

SILMAR Reisen ist Ihr kompetenter Reisebüro unweit von Wien! Bei Fragen oder Anregungen nehmen ... Reisen Journeys ..auf zu neuen Horizonten! new horizones! Reisen Journeys ..auf zu neuen Sylvia Gabauer Silmar Reisen Reisebüro Silmar
102 Canaren Reisebüro Fischer Reisen canaren

Fischer Touristik Canaren Reisen ... Fischer Touristik - Canaren - Kanaren Startseite Kanaren Reisen Hotel Kreuzfahrten Ferienhaus Canaren Canarischen Inseln Reisen Pauschalreisen Langzeiturlaub Canarische Insel
103 Über das Reisen Asien

Über das Reisen und Entdecken. Reisegeschichten Wolfgang Emerich aus Wien ... du auf meiner Seite gelandet bist. Ich publiziere hier Erlebnisse und Erfahrungen meiner Reisen nach Thailand Asien Südostasien Indien Thailand
104 Reise Reisen reise

Reise Reisen Lastminute Lastminutereisen zu TOP Preisen Urlaub pur mit Bestpreisgarantie ... Reise - Reisen - Lastminute - Lastminutereisen zu TOP Preisen - Urlaub pur mit Bestpreisgarantie Reise Reisen Lastminute Last Minute Lastminute Reisen Urlaub
105 ReisePreisvergleich Terracus Last

Aktuelle Urlaubsangebote Lastminute more Flug Hotel Mietwagen und preiswerte Reisen ... am um Urlaubsziel Dauer Erwachsene Kinder vom bis Reise- Lastminute-Angebote Rückruf-Service Last Minute Lastminute Reisen Urlaub
106 RATZ REISEN Reisen

Ratz Reisen ist Ihr verläßlicher Partner für BusReisen und Ausflugsfahrten. Auch Taxifahrten und Krankentransporte gehören ... Sie sicher ans Ziel INFO Das aktuelle Ausflugsprogramm finden Sie im Menü Angebote Ratz Reisen Taxi Reisen Ratz Ausflugsfahrten Busreisen
107 Reisen | Reisezeit ist Unterkunft
Unterkunft Anreise Kreuzfahrten Singlereisen Reisen mit Kindern Fastenreisen Rucksackreisen ... Benutzerdefinierte Suche Reise Unterkunft Anreise Kreuzfahrten Singlereisen Reisen mit Kindern Unterkunft Anreise Kreuzfahrten Singlereisen
108 Urlaub Reisen direkt urlaub
|? Urlaub amp; Reisen mit Qualität bei TUI buchen ? Direkt beim ... Urlaub Reisen direkt beim Reiseveranstalter buchen ? TUI TUI verwendet Cookies Urlaub Reisen Reiseveranstalter TUI
109 Billig Reisen buchen Last Billig

Die besten Reiseschnäppchen con Last Minute reisen und billig Reisen und Pauschalreisen sowie Flugreisen ... Reisen online buchen Lastminute Reisen Pauschalreisn Reisen buchen Urlaub Flugreisen Last Minute Reisen Billig Reisen Last Minute Reisen Billig
110 123start auf ins Radtouren

123start auf ins ReiseAbenteuer Reiseberichte unserer Radtouren Abenteuerreisen und Expeditionen Karin ... - Budapest . . - . . Abenteuer-Reisen (Karin und Clemens ohne Rad Radtouren Abenteuerreisen Expeditionen Reisen Karin Und Clemens Scheidhammer
111 Urlaub und Meer flüge

Buchen Sie Ihren Urlaub oder Ihre Reise günstig in Ihrem Online Reisebüro. Alle Flüge und ... Service Buchungsinformationen Home Flug Hotel Last Minute Pauschal- reisen Mietwagen Reise Flüge Billigflieger Hotels Urlaub
112 Asien Reisen Afrika reisen

Europa Reisen Reisen weltweit Reisepartnerbörse Reisen Südamerika Asien USA ... Startseite Reiseziele - Reisen Reisearten Ferienhaus Hotel Flug Transfer Mietwagen Camper Bahn Reisen Erlebnisreisen Rundreisen Südamerika
113 ::Franzl Reisen und Taxi Franzl
Franzl Reisen Ihr Reisepartner und Taxibetrieb in Niederau Wildschönau ... Home Busreisen Reisebüro Taxi-Kleinbus Kontakt Pension Herzlich willkommen bei Franzl Reisen Franzl Reisen Ausflugsreisen Tagesreisen Reisebüro
114 ITS BILLA REISEN Jung von Matt/Neckar GmbH Flüge
Willkommen bei ITS BILLA REISEN Lastminute Reisen sofort online buchen und in wenigen Tagen ... BILLA REISEN Startseite ITS BILLA REISEN Startseite Meine Merkliste Einen Moment bitte! Verfügbare Flüge Online Buchen Reisen Online Buchen
115 Kories Reisen Urlaub... Boutique
Sie suchen etwas Besonderes mit dem gewissen Etwas? Dann sind Sie bei uns richtig ... bei Kories Reisen. Sie suchen etwas Besonderes mit dem gewissen Etwas? Dann sind Sie bei uns richtig Boutique BoutiqueReisen Reise Reisen
116 Startseite Gansberger Reisen Impressum Gansberger Reisen GmbH Gansberger
Gansberger Reisen Niederrussbach Busreisen Busreise Flugreisen Flugreise Schiffsreise ... Herbst - Winter Gutschein anfordern Gansberger Reisen GmbH I Horner A- Niederrußbach I Tel Gansberger Reisen Niederrussbach Busreisen Busreise
117 Last Minute Reisen last

Urlaub im TÜV geprüften ReiseVergleich von Travel24 finden +++ Hier beim Spezialist Reisen Last ... Ihr Partner für Last Minute Reisen - Last Minute Urlaub buchen - Last Minute Last Minute Reisen Last Minute Last
118 Urlaub mit Schauinsland schauinsland-reisen gmbh Reisen
Urlaub mit SchauinslandReisen Lastminute Pauschal nur Hotel oder Flug Angebote ... . Mit großem Erfolg Kundenchampion Sri Lanka Clubhotel Dolphin Schauinsland-Reisen GmbH Startseite Reisen Urlaub Schauinsland Angebote Hotel Flug Pauschal Lastminute
119 NEWFOODLAND KULINARISCHE REISEN:  Jürgens & Bjaoui GbR Kulinarikreisen
Newfoodland bringt Menschen mit Passion für gutes Essen erlebnisreiches Reisen und Kultur zu den ... START DARUM REISEN GENUSS KONTAKT Venedig Kulinarischer Segeltörn Wein aus der Lagune private Kulinarikreisen Kulinarik Kulturreisen Kulinarische Reisen
120 TopTours Ihr Reisebüro Top Tours GmbH Toptours
Toptours Ihr Reisebüro für spezielle Reisen. Planen Sie mit uns Ihre ins Weltall ... Incentives Virgin Galactic Top Tours Reisen in Europa Lernen Sie Europa kennen. Städtetrips Badeurlaub Toptours Stingl Reisebüro Reise
121 ReiseAktuell Das österreichische Reisemagazin CB-Verlags GesmbH Kulinarik
REISEaktuell eines der attraktivsten Reisemagazine aus Österreich informiert mit Top News zum Thema ... Travel Lifestyle Luxus Gourmet Menü Top News On Tour Reisen Hotels Hideaways Österreich Kulinarik Gourmet Haubenküche Sterneküche
122 Fremdsprachenreisen Sprachenreise Fremdsprachenreis

Glas Busreisen der Spezialist fürFremdsprachenreisen Sprachenreise Sprachen lernen Sprach Busreisen Sprachen ...  Fremdsprachenreisen Sprachenreise Sprachen lernen Sprach Busreisen Sprachen und Reisen Fremdsprachenreisen Sprachenreise Sprachen Lernen Sprach
123 Urlaub Suchmaschine Reiseangebote billig

Preisvergleich für Reisen und Urlaub vom billig Urlaub bis zum Luxusurlaub jetzt online ... Flug Eigene Anreise Ferienhaus Städtereisen Mietwagen Blog Reiseangebote Reisen bis Euro Reisen Billig Urlaub Reisesuchmaschine Reisepreisvergleich Lastminute
124 Günstige Last Minute Reisen Last

Günstige Last Minute Reisen buchen ? Sie am besten bei uns! Tolle Angebote für günstige ... Reisen GmbH Alle Rechte vorbehalten. Kontakt Newsletter AGB von billigweg Veranstalter AGB Datenschutz Last Minute Reisen Günstig Reisen Urlaub
125 Autohaus Reiser Autohaus Reiser - ABR Automobilvertriebs GmbH VW
Autohaus Reiser Ihr Spezialist für VW Audi Skoda Seat und Gebrauchtwagen ... BILDERGALERIE .. Autohaus Reiser ... wie alles begann ... Interessente Bilder von "damals" und "heute VW Audi Skoda Seat
126 J A www.thermenlinie. Busreisen JANDRISEVITS Reisen GesmbH Dt. Tschantschendorf ... www.thermenlinie Aktuelle Reisen Kontakt Downloads Plan als PDF Plan als XLS Besucher REISEN Busreisen JANDRISEVITS Reisen GesmbH
127 China Reisen und China China
Als führender China Spezialist organisieren wir China Reisen und China Rundreisen. Wir bieten China Gruppenreisen ... Stopover China Reisen China Rundreisen Garantierte China Reisen mit Rabatten und zum Tiefpreis China Reisen China Rundreisen China Individualreisen
128 Kolumbien. Reisen. Individual. Individuelle. kolumbien

Kolumbien Reisen ist ein Tourveranstalter der individuelle Erlebnisreisen und Individualtourismus im faszinierendsten Land Lateinamerikas ... + Skype colombiaviajes Kolumbien Reisen â Kolumbien Reisen Individualreisen Individualtourismus
129 Murtal Express Oldtimer Oldtimer

Auf Oldtimer Reisen finden Sie Oldtimer Bus Reisen Hochzeitsfahrten und Oldtimer Fahrten zu besonderen ... Navigation überspringen Oldtimer Reisen Reisebus Oldtimer für Ihr Fest OldtimerEvents Bilder Saurer Oldtimer Lastkraftwagen Diesel Max Max
130 Metz SaharaReisen :: Tunesien Metz

SaharaReisen Saharareisen Geführte Erlebnisreisen mit dem Geländewagen oder zu Fuß Tunesien erleben. ... WILLKOMMEN BEI SAHARA-REISEN ... der privaten website der Familie Metz Metz Sahara Saharareisen SaharaReisen
131 PRIMA REISEN: Home Italien

PRIMA REISEN ? Ihr Spezialist für Finnland Irland Italien Jersey Norwegen ... Gruppenabteilung Bewerbung Buchungszentrale PRIMA REISEN Presse PRIMA REISEN Finnland -Winterzauber Italien Ferienwohnungen In Italien Appartements
132 Startseite Holiday Reisen Reisebüro
Reisen nach Wunsch Ihr erfahrener Reiseveranstalter und Reisebüro in Linz organisiert Pauschalreisen und ... Willkommen bei Holiday Reisen Holiday Reisen ist ein österreichisches Unternehmen und hat sich auf Fernreisen Reisebüro Reiseveranstalter Pauschalurlaub Individualreise
133 Die große ReiseUmfrage rund Österreich GmbH Reise
ReiseCommunity! Bestimmen Sie die Trends Produkte und Dienstleistungen der Zukunft. Einfach Umfrage beantworten und ... Reise-Umfrage Startseite Umfrage Gewinne Gewinner Mehr Umfragen Teilnahmebedingungen Die große Reise Gewinnspiel Gewinn Gewinnen
134 Hotelbewertungen Urlaub Hotelbewertungen Ihr Portal für Hotelbewertungen. Erst vergleichen dann buchen und sparen. Hier buchen Sie ... Hotelbewertung Urlaubsbilder Pauschalreisen All inklusive Reisen bis - Euro Wellness Clubreisen Hotelbewertungen Hotelbewertung Hotels Hotel
135 die ReiseInformationsplattform LuxuryTravel die ReiseInformationsplattform für anspruchsvolle Genießer ... Vielen Dank unseren Business Partnern Herzlich Willkommen bei LuxuryTravel die Reise LuxuryTravel Strahner Mag. Karin Strahner Ambassador Reisen Travel

Urlaub Last Minute Reisen Restplatz Reisen Kreuzfahrten und Städtereisen mit Hotelbewertungen und ...  CS SEVEN SEAS - Urlaub Last Minute Reisen günstiger buchen CS Seven Seas 7CS Reisen
137 Brandstetter Reisen

Brandstetter Reisen ... Reisen Tagesfahrten Fuhrpark Mietwagen/Airport Bussharing Galerien Unternehmen Anfragen Suche
138 EbnerReisen Aktuelles Reiseprogramm ebner

Ebner Reisen Busreisen Aktuelles Reiseprogramm Ebner Reisen Busreisen Reiseprogramm
139 Home Raiffeisen Reisen Reisen

RaiffeisenReisen persönlich: Über uns Raiffeisen Family Raiffeisen Aktiv Reiseziele Weltweit Themenreisen ... Raiffeisen Reisen Logo Über uns Leitbild Vision Geschäftsleitung Team Standorte Filiale Wollzeile Reisen Weltweit Über Uns Family
140 Pensionisten Reisen Reisen Pensionisten

Pensionisten Reisen Reisen für Rentner Busreisen Pensionisten und Renter busreisen für alte ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage Pensionisten Reisen Reisen Für Rentner Busreisen
141 Malerei Reisen Malerei und Reisen und Texte Reisen journaille Lebenslauf k.u.k. ... einmal mit Rosinante...einmal ohne Sancho... Natürlich versuche ich auch meine Reisen zu dokumentieren - Reisen ans Malerei Und Reisen Und Texte
142 Individuelle Kanada Reise mit Kanada
Bad Bevensen
Buchen Sie Ihre KanadaReise direkt beim KanadaSpezialReiseveranstalter. Einfach online mit kompetenter Beratung und professionellem Service. ... Kanada Reisen Wohnmobil-Reisen Wohnmobil-Preisvergleich Alle Vermieter Modelle Kanada Reise Buchen Reiseveranstalter
143 Wellcomeonline. Das Internet Wellcome

Wellcomeonline ist das Internet Reise und GourmetMagazin für die schönen Seiten des Lebens. ... Toulouse-Lautrec Der Weg in die Moderne ?Eine Reise durch Marrakech? in der Tiroler Zugspitz Arena Wellcome Online Magazin Reisen
144 Urlaub Last minute Reisen Urlaub

Urlaub Reisen Last Minute: Günstige Reisen in schöne Hotels garantieren einen unvergesslichen Urlaub. ... Sie sind hier Urlaub Reisen Last Minute Urlaub mit HolidayTrex - Sun up your life! Buchen Urlaub Last Minute Reisen Pauschalreisen Kurzurlaub Busfahrt Hotel
145 Rolarika auf Reisen Rolarika

Rolarika auf Reisen ... deactivated. Successful Error Rolarika auf Reisen All albums Login Herzlich Willkommen auf unserer Rolarika
146 Günstige Reisen travelport Billige Flüge Hotels Mietwagen sowie billige Reiseangebote für Pauschalreisen und LastminuteReisen ... travelport - Reisen travelport Service Center + - dt. Festnetz Startseite Travelport Österreich Urlaub Ferienwohnung Ferienhaus
147 Schmidhofer Reisen Kulturreisen Schmidhofer

Schmidhofer Reisen ist Ihr Spezialist für Kultur und Bildungsfahrten Wander oder Städtereisen. Wir bieten ... -reisen Startseite Über uns Chronik Unser Team Fuhrpark Aktuelle Reisen Linienverkehr Bilder Bilder Schmidhofer Reisen Schmidhofer Reisen Innervillgraten
148 Island ProTravel Ihr Island

Vielfältige Angebote für Ihren Urlaub in Island! Island Reisen mit dem Reiseveranstalter für Gruppenreisen ... für alle die individuell reisen wollen. Grönland Erleben Die größte Insel der Welt lädt dazu ein Tradition und Kultur Island Urlaub Reise Island Reisen Reiseveranstalter Island Protravel
149 BELMONDO REISEN reisebüro

Belmondo Reisen Kufstein Österreich Reisebüro Kufstein Reise Türk
150 Reisebetreuung Reisebetreuung für Reisebetreuung

Reisebetreuung Reisebetreuung für alte Menschen Reisebetreuung für Behinderte Pensionisten Reisen Reisen ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage Reisebetreuung Reisebetreuung Für Alte Menschen Reisebetreuung
151 Gullivers Reisen

Gullivers Reisen ...  Gullivers Reisen Kontakt Wien Wien Wallnerstraße Palais Esterhazy + - -
152 Weltjugendtag 2008 in Sydney Weltjugendtag

AkzenteReisen bietet Euch Gruppenreisen zum XXIII. Weltjugendtag in Sydney Australien ... Teilnahme Reise mit Flug Angebot Angebot Angebot Reise ohne Flug Angebot Angebot Nur Flug Weltjugendtag 2008 Sydney Australien
153 Gullivers Reisen

Gullivers Reisen ... officegulliversreisen Papageno Touristik - Die Kunst des Reisens … Pottendorferstraße
154 Losfliegen.AT die ReisePreisvergleichsSuchmaschine losfliegen

Losfliegen.AT bietet Ihnen aktuelle Urlaubsangebote Lastminute More Flüge hotels Mietwagen ... am um Urlaubsziel Dauer Erwachsene Kinder vom bis Reise- Lastminute-Angebote Rückruf-Service Losfliegen Schnell Losfliegen Günstige Flüge
155 Home Nefer Reisen Nefer Reisen GmbH Ägypten
Nefer Reisen bietet Ihnen einmalige Entdeckungsreisen nach Ägypten und Rundreisen in den Orient. Unsere Programme ... einer faszinierenden Kultur Dubai und Oman – die märchenhafte Welt Arabiens Nefer Reisen bietet Ihnen einmalige Ägypten Kulturreisen Ägypten Studienreisen Ägypten Erlebnisreisen Ägypten Nefer
156 Aupair Reisen und Ausflüge Aupair

AupairReisen für Aupairs und Studenten: Stadtführungen Reisen und Ausflüge nach Wien Rom ... ein besseres Kennenlernen des Gastlandes und seiner Umgebung. Als Reise- Ausflugs- und Stadtführung -Agentur Aupair Aupairs Führung Österreich
157 Namibia Reisen Selbstfahrreisen Selbstfahrer Namibia

Individuelle Selbstfahrreise Namibia Reise für Selbstfahrer mit dem füe Sie persönlich zusammengestellten TourenLogbuch ... auch Sie von über Jahren Reise-Erfahrung sowie leistungsstarken Partnern vor Ort! Unser Spezialgebiet Namibia Reise Selbstfahrreise Individuell
158 Reisen Tickets Events :: Urlaub

Reisen Urlaub Sprachreisen Hotelbewertung Freizeit LastMinute Schnäppchen und Pauschalreisen ... -Angebote Flüge Hotels Mietwagen Sportreisen Wellnessreisen Ferienhäuser Tickets Versicherung Reise-Magazin Urlaub Reise Reisen Ferien
159 :: Anspruchsvoll reisen mit | Urlaub wishline

Hochwertige Reisen von ausgewählten Reiseveranstaltern: Abenteuerreisen Aktivurlaub Erlebnisreisen Expeditionen Gourmetreisen ... Urlaub Ferien Reisen - Reiseangebote für Reiseziele weltweit! Die Website ist aktuell in Ã Wishline Wishline Reisen Wishlinereisen Reisen Reise Urlaub Ferien
160 Sritours | Sri Lanka sri

Private Rundreisen Kleingruppenreisen und maßgeschneiderter Badeurlaub für jedes Budget. Urlaub Reisen auf Sri ... -tours bietet Ihnen qualitativ hochwertige maßgeschneiderte Sri Lanka Reisen für jedes Budget Sri Lanka Reise Sri Lanka Reisen
161 Mauritius Urlaub Hotels Heiraten Mauritius

Mauritius Urlaub | Angebote von L'Evasion Tours Ihrem Mauritius Reiseveranstalter Mauritius Reisen Urlaub Hotels ... Mauritius Urlaub Reisen Hotels Heiraten Golfreisen Kreuzfahrten Mauritius Urlaub Golfreisen Mauritius Urlaub Reisen Urlaub
162 Ayurveda for health Ayurveda

Entdecken Sie mit uns als Spezialist für Ayurveda Reisen inkl. Yoga die besten Ayurveda Resorts ... Home Die besten Destinationen Kombinationen Ayurveda Reisen Aktuelle Angebote Ayurveda Ayurveda Reisen Inkl. Yoga
163 Yoga Retreats Reisen Yoga

Yoga Retreats Reisen. Der Ratgeber für Regionale Yogareisen in Europa Asien und Afrika für ... www.retreat Yoga Retreats Reisen Kontakt Ayurveda und Yoga am Meer in Südindien . Yoga Retreats Reisen YogaReisen YogaUrlaub
164 Pölzl Reisen Reisebüro Pölzl
Pölzl Reisen Reisebüro in Gmünd. Busreisen Flugreisen Städtereisen Thermenaufenthalte Theaterfahrten ... hat sie nicht die Reisesehnsucht und den Wunsch die schönsten Regionen der Welt auf einer sorgenfreien Reise kennen zu lernen Pölzl Poelzl Reisen Reisebüro
165 Starte durch mit CONSUL Radsportferien

Erlebnisreiche und unbeschwerte Radsportferien mit Consul Reisen. Erleben Sie Mallorca Andalusien und ausgesuchte Radsportgebiete ... für den Winter! Reinschauen lohnt sich! Consul Reisen Günther Gausch Ges.m.b.H.Co.KG A- Wels Hafergasse E Radsportferien Radferien Radfernfahrten Radtouren
166 Lastminute Reisen DomainQuadrat Marketing GmbH
lastminute last minutes reise reisen ... last-minutes Übersicht von Lastminute Reisen Sie können die Domain last-minutes kaufen
167 billigereise DomainQuadrat Marketing GmbH billige
Links zu billige reisen und billigreisen ... Hinweis Bei diesen Inhalten handelt es sich nicht um das Angebot der Verkehrsbüro Ruefa Reisen Billige Reise Billigereise Billigreisen Reisen
168 Fuchs Reisen: Fuchs Reisen Busreisen
Fuchs Reisen Ihr BusreisenSpezialist. Busreisen zu Traumpreisen. ... Home Reisen Reisekalender Tagesfahrten Kurzreisen Rundreisen Große Reisen Wandern Wohlfühltage Busreisen Reisebüro Taxi Einzelreisen
169 Flugbörse die günstigste Art flugbörse

Weltweit günstig Reisen. Flüge Hotels Leihwagen Rundreisen ... Bei uns finden Sie ... Reisen - Weltweit! Wir können auf eine Datenbank mit über . verschiedenen Tarifen zugreifen Flugbörse Flugreisen Flugbüro Weltweit Checkfelix
170 Pension Berggeist sölden tirol pension

pension Berggeist in sölden tirol reisen in tirol österreich m/o Kinder zum sport wandern klettern ... für reisen und klettern ski in sölden tirol reisen pension pension Berggeist in sölden tirol reisen in tirol Pension Sölden Tirol Reisen
171 Reisefeeling Toller Urlaub Reisefeeling

Reisefeeling Toller Urlaub Reisegefühle Luxusurlaub Reisen und Busreisen Traumurlaube ...  Reisefeeling Toller Urlaub Reisegefühle Luxusurlaub Reisen und Busreisen Traumurlaube Reisefeeling Toller Urlaub Reisegefühle Luxusurlaub
172 Kerngast Reisen im Vulkanland Kerngast Reisen GmbH Reisen
Mettersdorf a. S.
Ihr Reisepartner im Vulkanland ... Aktuelles Reisen Buchen Fahrzeuge Über Uns Links Kontakt Herzlich Willkommen bei Kerngast Reisen Reisen Fernreisen Kerngast
173 Luxusreisen LuxusReise Luxusreisen

Glas Busreisen der Spezialist für Luxusreisen LuxusReise Luxusreise Luxusbus Luxusbusse ...  Luxusreisen Luxus-Reise Luxusreise Luxusbus Luxusbusse Traumbus Topbus Luxusbusse Luxusreisen LuxusReise Luxusreise Luxusbus
174 SEND James ohne SEND JAMES ist ein Premium-Dienst der KEP AG Koffer
Reisen Sie zu den schönsten Plätzen in Deutschland Österreich Schweiz Südtirol ... Stets zu Diensten Ihr Reise Gepäck- und Koffer-Service Kontakt Gepäck Zielort Abholung Rückreise Koffer Versenden Gepäck Versenden Gepäck Verschicken
175 UngerReisen BistroBus leistbarer BistroBus

UngerReisen BistroBus leistbarer Luxus und unübertroffener Komfort ... Sie sich für eine UNGER-REISE! Wir freuen uns auf Sie ... BistroBus Bistrobus Reisebüro Individualreisen
176 Pölzl Reisen Busreisen PölzlReisen

PölzlReisen Busreisen Mooskirchen Steiermark Ausflugsfahrten Vereinsfahrten Einkaufsfahrten Badereisen ... Home Drucken A A A Buchungshotline - Aktuelle Reisen Bade- und Einkaufsfahrten PölzlReisen Busreisen Mooskirchen Steiermark Ausflugsfahrten Vereinsfahrten Eink
177 Last Minute und Reise das neue Reiseportal für Ihren Last Minute Urlaub mit vielen Reise ... Kreta ab - Euro Alle Lastminute Reise Angebote Last Minute nur Flugangebote Hin- und Rückflug ab Rom Lastminute Last Minute Pauschalreisen
178 Hofer Reisen Hofer Reisen GmbH & Co KG
Gute Reise gute Preise bei Hofer Reisen. Günstiger Reisen ? Mehr von der Welt ... Merkliste Angebote Hofer Reisen Da bin ich mir sicher. Buchungs-Hotline täglich ?
179 Philippinen Reisen preiswert und flytocebu

Philippinen mit Fly to Cebu Reisen Individuell und sicher ... Philippinen- Reisen hier klicken Flytocebu Philippinen Cebu
180 Reisebüro Kerschner Reisen Kerschner Reisen GmbH
Webauftritt des Reisebüro Kerschner Reisen. ... ARB Kontakt Facebook + - wieselburgkerschner Kerschner Reisen
181 Estland Urlaub Tallinn Hotels eesti

Reiseinformationen über Estland. Baltikum Reisen und Urlaub Eesti Tallinn und Estonia laden ein ... » Landesinformationen » Städte Regionen » Kultur » Urlaubtipps » Wissenswertes » Reiseberichte » Adressen » Reisen Eesti Estonia Estland Tallinn
182 > Home :: ::

:: :: Motorradumbauten und Reisen ... Motorrad - ROADBOOK Alles über meine Reisen und Umbauten Home Motorrad T Bully Reisen Kontakt :: :: Michael Wögerer Hubrauerweiterung
183 Last Minute Urlaub Restplatzbörse

Urlaub zum Bestpreis: Last Minute Reisen und Hotels von über 70 Veranstaltern! Flugtickets Last ... und weltbekannte Sehenswürdigkeiten locken viele Urlauber an. ab ? Türkei Last Minute Reisen Antalya Side Restplatzbörse Urlaub Reisen Last Minute Hotels Flugtickets Reisebüro
184 Abenteuer Reisen Motorrad Motorradabenteuer

Abenteuer mit dem Motorrad Fahrrad eBike! Abenteuer Reisen Leben = das ist für ... Wunderhecke Sichtschutz mal anders.. . Gewächshaus- Update Abenteuer - Reisen - Leben Motorradabenteuer Motorrad Ebike Abenteuer
185 Segelreisen Segelurlaub Kaya Lodge Touristik GmbH segelreisen
Segelreisen online buchen: Segelurlaub Mitsegeln auf Segeltörns Kojencharter Blaue Reise auf Mallorca ... Mallorca Mitsegeln Segelschule Türkei Blaue Reise Alle Ziele Griechenland Kroatien Türkei Hausbootreisen Segelreisen Segelurlaub Kojencharter Mitsegeln
186 Reise ins Glück Angebot
Reise ins Glück Pfarrwerfen ... Segelyacht Admiral mieten Reise ins Glück - Urlaub Reise ins Glück - Auszeit Reise ins Glück - Erlebnisdate Angebot Kompetenz Beratung
187 Last Minute Click und Flieg OHG Lastminute
Günstige Last Minute Reisen und Reiseangebote bequem online buchen mit Preisgarantie von click und ... Top Beratung Sicher buchen Hotelbewertungen Reisebüro Click und Flieg Unsere Reise-Experten beraten Lastminute Reisen Pauschalreisen Urlaub
188 Reisebü Lastminute Ferien Reisebüro

Reisebü Lastminute Ferien Reisen günstige Reiseangebote im Internet Reisebüro online buchen! Arrangement ... Reisebü Lastminute Ferien Reisen Günstige Reiseangebote kannst Du hier im Internet Reisebüro Reiseburo Reisebuero Lastminute
189 Travel Reisen urlaub

Wer gerne reist steuert immer weider verschiedene Reiseziele an. Urlaub an der Sonne oder im ... Travel Reisen Direkt zum Seiteninhalt Hauptmenü Homepage Afrika Asien Australien Europa Urlaub Reisen Ferien
Voila Kärnten Reisen bietet Ihnen einfach alles was das Urlauberherz höher schlagen läßt. Von ... - NALGIETOUR „Durch die ehemalige DDR“ ..-.. – Infos bei Voilà Reisen Voila Urlaub Reisen Kärnten
191 Yoga Reisen Yogareisen Yoga
Yoga Reisen. Yogareisen und Retreats in Marokko Portugal Italien Indien Ibiza Deutschland Österreich. Der Ratgeber ... Österreich Yoga Reisen Kontakt Ayurveda im Thermenhof in Österreich www.Thermenhof Im Ayurveda Yoga Reisen Yogareisen Yoga Reisen
192 Schörgenhuber Schlager Reisen Schörgenhuber

Schörgenhuber Schlager Reisen Einsteigen Platz nehmen und wohlfühlen Busreisen Mehrtagesfahrten ... Schörgenhuber Schlager Reisen Einsteigen Platz nehmen und wohlfühlen Busreisen - Mehrtagesfahrten Schörgenhuber Schlager Reisen Einsteigen Platz Nehmen
193 Reiseorganisation Reise organisieren Reiseorganisation

Reiseorganisation Reise organisieren Busreise organisieren Busreise managen Busreise empfehlen ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage Reiseorganisation Reise Organisieren Busreise Organisieren
194 Ernst Uschi Wagners events

private homepage über musikalisches im musiccorner wissenswertes über unsere reisen urlaub events ... MusicCorner EVENTS REISEN WIEN LINKS Gästebuch Wir beide das sind I und Er Wagner Events Urlaub Reisen Amerika
195 Reisen in DomainQuadrat Marketing GmbH
dominikanische republik reise urlaub ... -minute Reisen bis zu -% buchen Ihre Traumreisen buchen. Sonderangebote bis % g www.ab
196 Mauritius La Réunion Mauritius

Islands4more seit Jahrzehnten der Reiseveranstalter für Reisen in den Indischen Ozean bietet individuelle Reisen ... für Reisen in den Indischen Ozean Islandsmore ist der Veranstalter für den Indischen Ozean. Mauritius Mauritius Madagaskar La Réunion Reunion
197 Grisu auf Reisen

Unsere Reisen mit dem Wohnmobil Albanien und Griechenland Mystras Geocaching Thermeninfo ... Grisu auf Reisen Direkt zum Seiteninhalt Hauptmenü Home Ueber Uns Fahrzeuge Zelt/Wohnwagen
198 Nilkreuzfahrten Last Minute Nilkreuzfahrten

Lastminute Nilkreuzfahrten Reisen aller Reiseveranstalter im Preisvergleich mit Bestpreis Garantie. LastMinute Nilkreuzfahrt bis 65 ... für die nächte Flugreise ... mehr Info Lastminute Reisen Pauschalreisen Ferienhaus/Wohnung Charterflüge Mietwagen Nilkreuzfahrten Nilkreuzfahrt Aegypten Lastminute
199 Island Reisen Grönland NORDWIND REISEN GmbH Grönland
Urlaubsreisen nach Grönland Island und Spitzbergen ... Ihr Urlaubsspezialist für Island Grönland und Spitzbergen Reisen NORDWIND Beratungshotline + Grönland Reisen Island Reisen Island Urlaub
200 Vorderegger Reisen Busreisen Vorderegger GmbH Reisen
Zell am See
Vorderegger Reisen der kompetente Partner. Reisebüro. Flug Schiff Bahn. Busreisen und Incoming in ... . Hier gehts zum Urlaub Vorderegger Reisen - ein voll konzessioniertes selbstständiges Reisebüro Reisen Bus Flug Incoming
201 Moderne Reisen modernereisen Moderne

Reisebüro und Busreisen Glas. Moderne Reisen modernereisen moderne busreisen moderner urlaub ... Kontakt Anfrage Fragen zu unseren Reisen und Leistungen? Schicken Sie uns einfach Ihre Anfrage Moderne Reisen Modernereisen Moderne Busreisen
202 PolarAdventures | Kreuzfahrten und kreuzfahrt

Seit 1996 organisiert PolarAdventures Kreuzfahrten und Flüge in die Arktis und Antaktis. Die aktuellen Angebote ... Expeditionen Kreuzfahrten und See-Reisen mit Eisbrechern Polarschiffen und Seglern in die Arktis Kreuzfahrt Antarktis Polar Spitzbergen

Reise Trüffel Trüffelarten Trüffelhund Bewertung:

Die Öffnungszeiten können zu Feiertagen Pfingsten, Fronleichnam, Reformationstag und Allerheiligen abweichen.
Ergebnisse der Auswertung: 76 Bewertungen ergeben 3 StadtBranche Punkte

Neuer Eintrag 

Der Begriff Reise bedeutet im Sinne der Verkehrswirtschaft die Fortbewegung von Personen über eine längere Zeit zu Fuß oder mit Verkehrsmitteln außerhalb des Warenverkehrs, um ein einzelnes Ziel zu erreichen oder mehrere Orte kennenzulernen . Auch im Wirtschaftsverkehr werden Reisen unternommen . Im fremdenverkehrswirtschaftlichen Sinne umfasst eine Reise sowohl die Ortsveränderung selbst als auch den Aufenthalt am Zielort. Die verwendeten Verkehrsmittel bilden hierbei eine sogenannte Reisekette . Reise Öffnungszeit und Erfahrungen

△ nach oben kostenfreier Eintrag Datenschutz