Angebot › Awesome Freefont Wien Österreich

Angebot


Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 Entrümpelung Wien Entrümpelung

1190
Wien
Zuverlässiger und seriöser Partner für Entrümpelung Wien, Wohnungsräumung, Hausentrümpelung, Verlassenschaftsräumung. Kostenlose Besichtigung und unverbindliche Angebot Erstellung...
entruempelungenwien.at/ Awesome Freefont Wien Brandsfont Entrümpelung Cuse Csvg Besichtigung License Font Ort Entsorgung Opening Angebot Unsere
2 City Immobilienmakler Wedemark Immobilien

30900
Wedemark
Während in der Vergangenheit das Besteller-Prinzip in der Immobilienbranche überwog, nach welchem die Käufer eines Immobilienobjektes einen Makler beauftragen, werben..
city-immobilienmakler-wedemark.de/ Immobilienmakler City Wedemark Immobilienbewertung Verkauf Immobilie Unterstützung Portal Preis Experten Angebot Bewertung Eigentümer Beratung Immobilienverkauf
3 Bad und Heizung Installations-GmbH Installationsbetrieb

6020
Innsbruck
Die Bad und Heizung Installations-GmbH, kurz BUH, ist ein Installateur-Meisterbetrieb. Paul Plattner und sein Team haben sich auf klassische Installateur-Arbeiten, vor..
ihr-installateur.at Hauptmen Innsbruck Heizung Installateur Bad Angebot Umgebung Techniker Deutsch Paul Ihr Lösung Fixpreis Hier Klimaanlage
4 Diwosch GmbH Internetagentur

6020
Innsbruck
Die Internetagentur Innsbruck Diwosch GmbH, ist spezialisiert auf Online-Marketing, SEO, Google Ads, Messenger Marketing, Content Marketing und Webdesign. Unser Ziel..
diwosch.at Marketing Kunden Online Innsbruck Angebot Internetagentur Google Internet Media Ad Zielgruppe Unternehmen Erstberatung Tirol Website
5 Immoservice Austria - Immobilienbewertung Immobilien

5026
Salzburg
Professionelle Bewertungen von Immobilien und Liegenschaften, Hausbewertungen und Lagebewertungen für Bauträger, Banken, Gutachter, Immobilienmakler und Sachverständige aus einer Hand: Immobilienbewertungen..
immoservice-austria.com/ Immoservice Austria Immobilienbewertung Produkte Profis Bereich Immobilienbewertungen Gutachter Bauträger Sachverständige Angebot Banken Probeabo Login Kontakt
6 Entrümpelung-Räumungen.at Entrümpelung

1190
Handelsgericht Wien
Ein Hausrat ist einfach ist alles aus deinem Haushalt, Inventar, Möbel, Deko, etc. 24/7 Kostenlose Besichtigung & Beratung 0664 755 44315 Bei..
entruempelung-raeumungen.at Sans Entrümpelung Räumung Wien Proline Entsorgung Besichtigung Professionelle Burgenland Niederösterreich Experten Keller Wohnung Haus Angebot
7 Otrix Graphics Autofolierer

8740
Zeltweg
Otrix Graphics bietet Fahrzeug-Folierungen aller Art und das in höchster Qualität. Durch unsere jahrelange Erfahrung sind wir der #1 Ansprechpartner..
otrix-graphics.com Fahrzeug Folierung Zeltweg Ihr Graphics Otrix Folierungen Gadgets Folierer Fahrzeuge Werbetechnik Folie Hier Angebot Flugzeuge
8 Nobleclean - Die Gebäudereiniger Denkmal Fassaden

1120
Wien
Wir sind ein Qualifizierter Meisterbetrieb in der Denkmal Fassaden und Gebäudereinigung. Wir arbeiten als großes Team von knapp 100 Personen..
reinigung-wien.at Reinigungsfirma Wien Nobleclean Angebot Umgebung Gebäudereiniger Ihren Preis Mitarbeiter Kompetenz Wünschen Zuverlässig Konditionen Reinigung Dienstleistung
9 Wohnungsräumung und Wohnungsauflösung Entrümpelung

1060
Wien
Professionelle Wohnungsräumung für Wien, Niederösterreich und Burgenland Sie benötigen eine Wohnungsräumung in Wien, Niederösterreich oder Burgenland? Dann sind Sie bei uns..
entruempelungenwien.at/ Helvetica Wien Entrümpelung Besichtigung Räumung Sans Angebot Open Entsorgung Opening Team Neue Experten Kosten Color
10 Wohnungsräumung Entrümpelung

1060
Wien
Sie benötigen eine Wohnungsräumung in Wien, Niederösterreich oder Burgenland? Dann sind Sie bei uns auf der richtigen Adresse. Dank unserer..
entruempelungenwien.at/ Helvetica Wien Entrümpelung Besichtigung Räumung Sans Angebot Open Entsorgung Opening Team Neue Experten Kosten Color
11 Entrümpelung Wien Entrümpelung

1190
Wien
Räumung und Entrümpelung Wien mit dem Profi. Ganz gleich ob Wohnungsräumung, Haushaltsauflösung, Hausentrümpelung oder Kellerräumung - bei uns sind Sie..
entruempelungenwien.at/ Helvetica Entrümpelung Wien Besichtigung Räumung Angebot Sans Entsorgung Open Burgenland Neue Niederösterreich Team Antiquitäten Ort
12 Antik Ankauf Antiquitäten

1180
Wien
Sie sind an einem Ankauf Antiquitäten interessiert? Dann sind Sie bei uns genau richtig. Antik Ankauf - Wien bietet Ihnen..
antikankauf-wien.at/ Ankauf Wien Antiquitäten Helvetica Angebot Verlassenschaften Wertschätzung Ort Antike Möbel Unsere Apx Besichtigung Open Sans
13 Ankauf Antiquitäten


Sie sind an einem Ankauf Antiquitäten interessiert? Dann sind Sie bei uns genau richtig. Antik Ankauf - Wien bietet Ihnen..
antikankauf-wien.at/ Wien Ankauf Antiquitäten Helvetica Angebot Wertschätzung Verlassenschaften Experten Altwaren Ort Niederösterreich Open Sans Unsere Apx
14 Antik Ankauf Wien Antiquität

1180
Wien
Sie möchten sich von Ihren Antiquitäten oder Altwaren trennen? Bei uns sind Sie genau richtig. Wir sind Ihre erfahrenen Antiquitätenhändler..
antikankauf-wien.at Wien Ankauf Antiquitäten Helvetica Wertschätzung Verlassenschaften Angebot Experten Sans Open Apx Altwaren Ort Unsere Argba
15 Gartenbau in Wien günstig Gartengestaltung Gartenpflege

1220
Wien
Gartenzaun bauen und montieren Ob Sie schauen, um einen vorhandenen Zaun zu reparieren oder zu ersetzen oder einen neuen Rahmen für..
gaertnerei-wien.at Wien Gärtnerei Gartengestaltung Gartenpflege Gartenservice Gärtner Umgebung Garten Kostenlose Gartenplanung Ihr Ihrem Angebot Beratung Gartenarbeiten
16 Umzug Wien günstig gemacht übersiedlung

1040
Wien
Umzug in Wien: Einfach beauftragen Sie können uns direkt beauftragen oder fragen erst einmal telefonisch oder per E-Mail an. Wir beraten..
umzugsservice-wien24.at Wien Umzug Umzugsservice Umzugsfirma Entrümpelung Angebot Umzugsunternehmen Ihr Open Auslandsumzug Räumung Transport Sans Deutschland Umgebung
17 Umzug in Wien von Umzugsunternehmen

1040
Wien
Wir als Ihre Umzugsfirma bieten Ihnen den günstigen Umzugsservice für einen Umzug Wien. Wir sind Ihre Möbelpacker in Wien Wir packens an..
umzug-wien.at Wien Umzug Umzugsservice Möbelpacker Umzugsfirma Umzugsunternehmen Ihren Entrümpelung Narrow Angebot Umgebung Umziehen Angebote Wiener Sans
18 Translate Trade - Übersetzungsagentur Übersetzungsbüro

81677
München
Copy To Clipboard Für Firmen, welche multinational Geschäfte tätigen, ist die Übersetzungsagentur TRANSLATE TRADE der ideale Partner. Ungeachtet der Tatsache, dass..
translate-trade.com/ Trade Translate München Sprachen Angebot Unternehmen Daten Kunden Augen Prinzip Qualität Webseite Übersetzungen Kroatisch Englisch
19 Spezielles Angebot finanziellen Darlehens Angebot Finanziellen

1208
Geneve
Spezielles Angebot finanziellen Darlehens Wir bieten von finanziellem Darlehen zu jedem an, der fähig ist, es mit Interesse von 3% zurückzuzahlen. Auch..
axa
20 VWA e.U. Dienstleistung -

8605
Kapfenberg
Weniger Arbeit - Weniger Stress - Mehr Zeit? Ihre virtuelle Assistentin machts möglich! Sie kennen das bestimmt! Sie betreten Ihren Arbeitsplatz, auf..
vwassistentin.com Assistentin Zeit Ihr Kunden Design Unterstützung Kundenbetreuung Aufgabe Personalwesen Aufgaben Angebot Kerngeschäft Service Rückmeldung Aufwand
21 SEO bringt Ihren Geschäftsverkehr SEO


Sicher, der Verkehr wird dir kein Geld bringen. Aber würden Sie Ihr Geschäft eher in einer Seitenstraße in Davenport, Iowa..
seo-partners.at Suchmaschinenoptimierung Suchmaschinen Wien Optimierung Webdesign Marketing Seite Webseite Google Agentur Suchmaschinenmarketing Check Partners Texterstellung Angebot
22 Professionelle Gartenservice in Wien Gärtnereien

1010
Wien
Professionelle Gartenpflege und Gartengestaltung von Gärtner Wien leicht erledigt. Wenn Sie kämpfen, um zu füllen und peinlich Bereich in Ihrem Garten..
gaertnerei-wien.at Wien Gärtnerei Gartengestaltung Gartenpflege Gärtner Gartenservice Umgebung Garten Gartenarbeiten Ihr Gartenplanung Angebot Gern Leistungen Ihrem
23 Entrümpelung Räumung Umzug Umzug Transport

1100
Wien
Räumungsfirma Wien und Umgebung Wenn Sie eine gratis Entrümpelung Wien mit Wertausgleich planen, ist das Angebot an hilfreichen Unternehmen groß: An..
entruempelung-wien.at/ Wien Räumung Entrümpelung Angebot Haushaltsauflösung Verlassenschaft Entrümpelungsfirma Wohnungsräumung Räumungsfirma Vorhaben Wohnungsauflösung Leistungen Verlassenschaften Ankauf Entrümpelungen
24 Ferienwohnung mit Terrasse und Ferienwohnung

26427
Holtgast
Die Ferienwohnung Kutscherhuus Sie finden die Ferienwohnung Kutscherhuus in Holtgast in Ostfriesland. Die Ferienwohnung liegt nicht weit von der Nordseeküste entfernt..
ferienwohnung-kutscherhuus.de Ferienwohnung Sauna Ostfriesland Urlaub Kooperation Belegungskalender Preise Holtgast Niedersachsen Ferienhaus Anfahrt Private Wanderer Unterkunft Angebot Erlebnisbäder Y
25 Anhänger OneWay Vermietung * Anhänger Vermietung

1230
Wien
Wir lösen Ihre Transportprobleme PKW Anhänger-Vermietung im OneWay / Einwegmiete Hier anmieten >>>> und dort abgeben ! In Deutschalnd, Österreich, Kroatien......
oneway24.at Oneway Vermietung Anhänger Verleih Deutschland Mietenmiete Anhängerösterreich Leihen Einweg Kunden Angebot Bitte
26 Marketing für Arztpraxen Marketingberatung

1180
Wien
Marketingkonzepte, Webdesign und Online-Marketing - alles aus einer Hand für Arztpraxen und Ärzte. Laut der jüngsten Befragung durch die Stiftung Gesundheit..
docmarketing.at Marketing Arztpraxis Informationen Blog Angebot Artikel Media Team Praxismarketing Social Expertenwissen Docmarketing Möglichkeiten Sicht Portal Hilfe Positionierung Mobiles Beitrge
27 Geiselberg Apotheke Apotheke

1110
Wien
IHRE GESUNDHEIT IST UNSER THEMA Wir sind persönlich für Sie da und nehmen uns gerne Zeit für die Beratung zu allen..
geiselbergapotheke.at Geiselberg Apotheke Gesundheit Unser Angebot Thema Wien Uhr Sa Kisling Kosmetik Uns Engagement Archiv Themen Erreichbarkeit Zeit Credo Uhrund
28 Handykurs für Senioren Kurse


Handyschulung & Smartphoneschulung bei Ihnen zu Hause leicht, stressfrei lernen.Sie lernen Ihr Handy kennen und bedienen mit einem Handykurs. Bewohner in..
handyschulung-steiermark.at Handyschulung Lernen Hause Wer Bin Ihr Steiermark Stressfrei Preise Blog Angebot Bedienen Leicht Handy Gutschein Html
29 Psychologische Praxis MMag. Dr. Psychologie

1090
Wien
psychologin-fritzer.at Psychologische Klinische Wien Psychologin Behandlung Kinderwunsch Gutachten Endometriose Angebot Ausbildung Waffenpsychologische Gesundheits Drin Rauschfrei Supervision Anfrage Einsatz Office@psychologin Fritzerat Vorzeitiger Kassentarifsdurch Eierstockkrebs
30 Sesselflechterei Stöglehner Sesselflechter Tischler

1180
Wien
Was ich Ihnen anbiete: Einflechtungen von Hand Neben dem Wiener Geflecht, beherrsche ich auch eine Vielzahl anderer Geflechtarten. Unter anderem die Reparatur..
sesselflechterei.at Geflecht Restaurierung Stöglehner Wiener Navigation Hand Philosophie Sessels Schnurgeflecht Zusätzlich Sesselflechterei Tischlerarbeiten Tischlermeister Peddigrohr Angebot Persönliche
31 Loogo Umzüge Österreich Umzüge

5400
Hallein
Mit LOOGO sparen Sie Zeit und Nerven. Überlassen Sie Ihren Umzug den Profis von LOOGO! Profitieren Sie von unserer Organisation und..
loogo.at Umzug Möbel Kartons Möbelküche * + Umzugsunternehmen Privatumzug Angebot Firmenumzug Verpackungsmaterial * Umzüge Loogo Kartons * Lkw * Internationaler Neumöbel Abholung Karton Rechner Demokratischevolksrepublikkorearepublikkroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmauretanienmauritiusmazedonienmexikomikronesienmoldawienmonacomongoleimontenegromosambikmyanmarnamibianaurunepalneuseelandnicaraguaniederlandenigernigerianiuenorwegenösterreichomanosttimorpakistanpalästinensischeautonomiegebie
32 Hundehaftpflichtversicherungen im Test Versicherung


Dieser Ratgeber stellt Informationen und Fakten für die Hundehaftpflichtversicherung in Deutschland, Österreich und der Schweiz bereit...
hundehaftpflichttest.de Test Hundehaftpflicht Testberichtede Vergleichen News Angebot Hundehaftpflichtversicherung Tarif Vergleich Hund Darmstadt Schließen Weg Ab Provinzial Httpswwwlebensversicherung Informationen
33 Ankündigungsunternehmen Reiter Werbung

6020
Innsbruck
Wir sind darum bemüht ihren online Auftritt zu verbessern. Dafür bedienen wir uns mehrerer verschiedener Strategien des online Marketings. Wir..
meine-jogginghose.de Adidas Trainingshose Herren Amazon* ➥ Angebot Rsaquo Produktbeschreibung Jogginghose Stripes Essentials ✓✓ Soll Kaufen
34 EU-Neuwagenimporteur Autohandel

2700
Wr Neustadt
EU-NEUWAGEN IMPORTE SEMIS ist spezialisiert auf EU-Neuwagen und erzielt durch dementsprechende Kontakte Preisvorteile zwischen 20-30 %. In manchen Fällen sind sogar..
semis.at Eur Ps Eureur Eu Verbrauch Semis Volkswagen Neuwagen Autoimport Audi Frontantrieb Co Aktionen Angebot Außenfarbe
35 holoDesign | Webdesign - Webdesign

1210
Wien
holo-design, Ihr Partner für preiswertes Webdesign in Wien! Mein Name ist Stefan Salbrechter. Ich entwickle Webseiten, Logos und Grafiken für Selbstständige..
holo-design.at Website Webdesign Design Suchmaschinenoptimierung Google Responsive Wien Wordpress Grafikdesign Holo Optimierung Flyer Logos Social Logo Angebot Beratung Unternehmen Visitenkarten Text
36 Hausbetreuung Reinigung

1120
Wien
Gebäudereinigung nach höchsten Qualitätsstandards von Ihrer Reinigungsfirma Egal, ob Privathaushalte, gewerbliche Objekte, Gastronomiebetriebe oder Büro- und Praxisräume – unsere Leistungen passen..
msreinigung.at Wien Reinigung Reinigungsfirma Regalbetreuung Hausbetreuung Umgebung Büros Gewerbe Praxen Leistungen Gebudereinigung Objekte Gebäudereinigung Besuchen Kostenvoranschlag Javascript Angebot Fax Produkt
37 Angleitner Peter Mag. Psychotherapie

4910
Ried im Innkreis
Seit zwei Jahren arbeite ich als Psychotherapeut (in Ausbildung unter Supervision) in Ried, mit Interesse und Offenheit für die Menschen..
angleitnerpsychotherapie.at Praxis Angebot Psychodrama Therapeut Psychotherapie Ried Menschen Faq Mag Innkreis Arbeit Homepage Erkrankungen Klienten Haltung
38 Schmuck Ankauf bei Juwelier Juwelier

1010
Wien
Direkt im Herzen von Wien, in der Spiegelgasse 19 – einer Straße mit langer Geschichte erwartet Sie in unserem Juwelierladen..
juwelen-ankauf.at Ankauf Schmuck Juwelier Davidov Juwelen Wien Luxus Uhren Diamanten Barzahlung Gold Spiegelgasse Angebot Reparaturen
39 TwoHands - Wasserbetten Poolzubehör Wellnessprodukte -

2100
Korneuburg
Wir sind Fachhändler und Dienstleister zugleich, bieten die besten Preis-/ Leistungsofferts und kümmern uns um die Beratung, den Verkauf sowie..
twohands.at Bettrahmen Kapitel Wasserbetten Boxspring Bett Ssa Serie Angebot Twohands Season Expert Badu Vortex Tri Heater
40 Reisebus mieten Reise


Naderer bietet ein breitgefächertes Angebot von individuellen Tagesausflügen über organisierte Mehrtagesfahrten bis hin zu längeren Urlauben. Als Reisedienstleister plant..
naderer-reisen.at/bus-mieten/ Reise Bus Mieten Busreise Linz Naderer Reisebus Reisekalender Rückfahrt Kleinbus Anfrage Zusätzliche Angebot Preis Versicherungen Pauschalreisen Zeit Einzelzimmer Fahrzeiten Browser
41 Coaching und Psychotherapie Coaching und

8042
Graz
Fazekas & Fazekas bietet Coaching und Psychotherapie in Graz. Geleitet wird die Praxis im Bezirk 8042 Graz-St. Peter von..
fazekasundfazekas.at Fazekas Graz Kompetenzhelgachristian Angebot Beratung
42 Leopold | Essen & Restaurants

1020
Wien
Das Leopold bietet mit seinem äußerst freundlichen und professionellen Team, nationale und internationale Schmankerln und verbindet klassische Speisen mit einer..
restaurant-leopold.at Leopold Reservierung Brunch Platz Trinken Essen Alexander Poch Anfahrt Lokal Angebot Wien Leopoldat Große Genießer Mittags
43 Adless Mediendesign & Druckservice Druckservice

5323
Ebenau
Als Salzburger Werbeagentur mit Sitz in Ebenau bietet Adless Mediendesign & Druckservice GmbH volle Kompetenz in Grafik, Webentwicklung & Online..
deindigitaldruck.at Navigation Offsetdruck überspringen Webdesign Relaunch Augenhöhe Werbeagentur Grafik + Grafikdesign Angebot Web Uns Rufen Beratung
44 3D Visualisierungen Werbeagentur


3D-Visualisierung von Architektur - Immobilien - Raumgestaltung Als ein überzeugendes Präsentationsmittel bieten fotorealistische 3D-Visualisierungen die ideale Voraussetzung für die Präsentation und..
visual-design.at Architekturvisualisierung Immobilien Konzeptplanung Visualisierungen Projekte Autocad Wohnungs Wohnprojekt Umsetzung Grundrisse Innenvisualisierung Architektur Architecture Expos Herndler Brandstetter Angebot Nachbearbeitung Sketchup Dxf Archicad Worte
45 Dr. Daniela Skiba Zahnarzt

1010
Wien
Dr. Daniela Skiba leitet die Zahnarztordination Dental-Spa in 1010 Wien. Sie ist spezialisiert auf ästhetische Zahnheilkunde und Implantologie, sowie alle..
dentalspa-wien.at Zahnheilkunde Team Daniela Skiba Prophylaxe ästhetische Wien Kieferorthopädie Implantologie | Zahnimplantate Ihrenwünschen Angebot Linkpartner Wien_ Google+ Fachdisziplinen
46 Großer Umzug Kleiner Preis! Umzug

1040
Wien
Mit grosser Erfahrung im Möbeltransport, Montage und Einlagerungen jeglicher Art, stehen wir als Garant für einen Reibungslosen Ablauf. Wir würden uns..
umzugsservice-wien24.at Umzug Wien Entrümpelung Auslandsumzug Umzugsservice Angebot Räumung Preise Umzugsfirma Umzugsunternehmen Transport Kleintransporte Preisliste übersiedlung Möbeltransport Fachkräften Sehen
47 Toner kaufen Toner Tintenpatronen


Sie können uns 24 Stunden am Tag online besuchen unter www.toner-kaufen.at Wir bieten eine riesige Auswahl an Druckerpatronen und Tintenkartuschen für..
toner-kaufen.at Toner Druckerpatronen Kaufen Tintenpatronen Tonern Onlineshop Vorteile Bestellung Tonerkartuschen Auswahl Rebuilt Bildtrommel Angebot Fragen Günstig Drucker Internet
48 SAFUR COOL - preiswerte Klimaanlagen

1050
Wien
Klimaanlagen zu Fixpreisen inklusive Beratung, Montage und Inbetriebnahme. Ideal geeignet für Einfamilienhäuser, Dachgeschoß- und Balkonwohnungen, sowie Büroräume. Ihr Ansprechpartner für..
safur-cool.at/ Safur Angebot Cool Wien Beratung Anlagen Klima Klimaanlagen Montage Raum Endlich Inbetriebnahme Preiswerte Wärmepumpenfunktion Gute Firma
49 24 Stunden Betreuung zu Dienstleistung

9020
Klagenfurt
Fidelita GmbH bietet liebevolle BetreuerInnen über ihre osteuropäischen Partnerfirmen an. Es wird die Betreuung vor Ort organisiert und die gesetzeskonforme..
diepflege.at   Pflege Stunden Seniorenbetreuung Diepflegeat Hause Betreuung Ihr Anfordern Angebot Wt Port Disclaimer Abrufen Verträge News
50 HÖLZL & HUBNER Gewerbeimmobilien Immobilien

5020
Salzburg
HÖLZL & HUBNER Immobilien in Salzburg bietet Anlageobjekte, Renditeobjekte sowie Gewerbeimmobilien. Als Gutachter erstellt HÖLZL & HUBNER Gutachten und Immobilienbewertung..
hh-immo.at/ Immobilien Hubner Hölzl Büros Gutachten Salzburg Gewerbeimmobilien Renditeobjekte Wohnimmobilien Anlageobjekte Wohnbaugrundstücke Gewerbe Unternehmen Geschäftslokale Hotels Anlageimmobilieninvestmentsgewerbe Immobilientreuhänder Angebot
51 Hotel Sonnschupfer *** Superior Hotel

8970
Schladming
Ruhig und zentral, familiär und persönlich: Ihr Hotel Sonnschupfer in Schladming verwöhnt Sie mit allen Annehmlichkeiten, die Sie sich in..
sonnschupfer.at Schladming Hotel Sonnschupfer Anreise Sommercard Zimmer Sommer Urlaub Hotelbewertungen Rein Angebot Plus Pauschalen Gerhardter Wellness Bestpreis Garantie Dachstein Skiing Ansehen Superior Sterreich
52 Friseur Dauerhafte Haarentfernung IPL Friseur Dauerhafte

1020
Wien
Herzlich willkommen bei Haarsache in Wien! Im 2. Bezirk finden Sie Ihre Profis für trendige Schnitte, intensive Farben und kreative..
haarsache.at Team Preise Services Gallerie Haarsache Schneiden Wien Ipl Haarentfernung Friseur Haare Blog Föhnen Et Jahre Cum Angebot Faucibus Preisebeizubehalten
53 Umzugsservice in Wien von Transport

1040
Wien
Günstiger Umzugsservice für Ihren Umzug in Wien durch Ihre professionelle Umzugsfirma. Eine Selbstverständlichkeit für uns ist unser Umzugsservice in Wien für..
umzugsservice-wien24.at Umzug Wien Entrümpelung Auslandsumzug Angebot Umzugsservice Räumung Preise Umzugsunternehmen Umzugsfirma übersiedlung Transport Keine Kleintransporte Kein Kilometergebühr Stockwerkkosten Stehen
54 Papiertaschen-Shop Papiertaschen

1170
Wien
Individuell bedruckte Papiertragetaschen günstig und online bestellen. Papiertragetaschen mit gedrehter Papierkordel und mit Firmenlogo. Als Ihr Spezialist für Tragetaschen in..
papiertaschen-shop.at Papiertaschen Papiertüten Papiertragetaschen Bestellen Günstig Logo Anfrage Bedrucken Angebot Messetaschen Bedruckt Produkte Individuell Produktdetails Preise Henkel Braun Langfristige Druckdateneingang
55 Papiertaschen-Shop Papiertaschen

1170
Wien
Papiertaschen Papiertragetaschen Papiertüten günstig online bestellen Papiertragetaschen Bedrucken Lassen Papiertaschen, Papiertragetaschen günstig Der günstigste Papiertaschen Shop in Österreich. Individuell bedruckte Papiertragetaschen günstig und online..
papiertaschen-shop.at Papiertaschen Papiertüten Papiertragetaschen Günstig Bestellen Logo Anfrage Bedrucken Angebot Produkte Individuell Bedruckt Messetaschen Anfragekostenlos Einkaufstaschen
56 Barbaras Küche Mietkoch

1090
Wien
Lassen Sie sich kulinarisch verzaubern - was kann es Schöneres geben?..
barbaraskueche.at Kochen Kochkurse Privatköchin Blog Küche Lunch Barbarasküche Angebot Unternehmen Gemeinsam Business Strudelteigausziehen Köchin Catering Freunden Curry Mein Privates Partnern Kurkuma
57 Papiertaschen-Shop Papiertragetaschen Bedrucken

1170
Wien
Papiertaschen, Papiertragetaschen günstig Der günstigste Papiertaschen Shop in Österreich. Individuell bedruckte Papiertragetaschen günstig und online bestellen. Papiertragetaschen mit gedrehter Papierkordel und mit..
papiertaschen-shop.at/ Papiertaschen Papiertüten Papiertragetaschen Günstig Bestellen Logo Anfrage Bedrucken Angebot Messetaschen Bedruckt Produkte Individuell Einkaufstaschen Werbetaschen Messen Nachhaltigkeit
58 Praxis für Kinderpsychologie Psychologie

2452
Mannersdorf
Psychologische Praxis für Kinder, Jugendliche und Familien; klinisch-psychologische Diagnostik, Beratung und Begleitung..
kinderpsychologie-bauer.at Kinderpsychologie ° Praxis Kinder Psychologie Jugendpsychologie Diagnostik Kosten Klinische Scheidung Beratung Leistung Angebot Mannersdorf
59 Individualpädagogik Projekt Kanu bauen Kanutrekking Individualpädagogik Projekt Kanu bauen Individualpädagogik Sozialpädagogik

2700
Wiener Neustadt
Eine erlebnispädagogische Reise mit dem Kanu - vom Selbstbau bis zur Ausfahrt Ich biete erlebnispädagogische Kanu Bau Workshops an, in welchen..
kanubauen-kanutrekking.at Kanu Kanus Kanubauen Bauen Angebot Trekking Pixeliode Kanutrekking Kinder Behinderung Erlebnispdagogik Stunde Stunden Jugendlichen Schiffsbau Sperrholz Zeta Preisanbotes Reise
60 Syen Andreas - SA Webdesign -

8993
Grundlsee
Moderne Webseiten auf dem neuesten Stand der Technik mit oder ohne Selbstwartung. Ob Logos, Flyer, Plakate, Geschäftsdrucksorten im Grafikbereich können..
sawerbung.at Webseiten Printwerbung Werbung Website Angebot Responsive Firmenlogo Logo Kostenloses Kunde Geschäftsdrucksorten Flyern Messeobjekte Professionelle Unternehmens Copositionieren Unseren Missfallendaher Betrachters Adresseeingeben
62 Praxis für Psychotherapie Mag.a Psychotherapie

1100
Wien
Systemische Einzel-, Paar- und Familientherapie. Ich biete Unterstützung insbesondere bei depressiver Symptomatik/Erschöpfungszuständen, Ängsten/Panik/Zwängen, Lebenskrisen sowie bei traumatischen Erfahrungen, die nicht..
psychotherapie-russold.at Bettina Russold Wien Menschen Maga Leebgasse Angebot Familientherapie Praxis Psychotherapie Psychotherapeutin Sprache Systemische Mein Supervision Person Leichten Einzeltherapie
63 iPhone Handy Reparatur ist Handy

1120
Wien
Ein iPhone ist ein sehr teueres Handy, aber was ist wenn dieses edle Smartphone auf den Boden fällt? Dann ist..
iphone-handy-reparatur.at/ Reparatur Wien Iphone Smartphone Handy Klagenfurt Ipad Angebot Handyshop Displayreparatur Wasserschaden Handybörse Entsperren Bringen Ipod
64 webhandel Sicherheit


sicherheitsmesser..
thedo.at Versandkosten Mwst Sicherheitsmesser Secunorm Secumax Passwort Shopsoftware Produkt Warenkorb Angebot Artikelnamen Privatsphäre Martor Shop Mizar Auva Unternehmen
65 Lustige Wiener Stadtspaziergänge Wiener Stadtführungen

1130
Wien
Wir bieten Ihnen kurzweilige Stadtführungen in Wien an. Kuriose Fakten aus der Geschichte Wiens werden auf den romantischen Pfaden der..
perfect-travel.at Travel Perfect Reisen Reisegruppen Angebot Citytransfers Shuttleservice österreich Bustransfers Busfahrten Touren Sightseeing Fremdenführer Eintrittskarten Ansprechpartner Heurige Schloss überzeugen Busreisen
66 REGELKREIS Gebäudetechnologie | Roland Bauwesen


Firma REGELKREIS Gebäudetechnologie Roland Leitner in 6069 Gnadenwald Tirol. Wir unterstützen Sie bei den Themen Heizung, Lüftung, Lueftung, Klima, Regelung..
regelkreis.at Roland Leitner Regelkreis | Gnadenwald Gebäudetechnologie Angebot Tirol Produkte Kunden Vorteil Vertrauen Austria Energiesparen Danfoss Info@regelkreisat Y
67 Kinesiologie, Familiencoaching und mehr Kinesiologie

8055
Graz
Kinesiologie, Tierkinesiologie, Systemisches Coaching, Familiencoaching, Jugendarbeit, Mentaltraining und mehr von Marion Hörmann Dipl. Systemischer Coach, Dipl. Jugendarbeiterin und Kinesiologin...
impulsplus.at/ Kinesiologie Coaching Graz Heilpilze Körperkerzen Systemisches Bachblüten Tierkinesiologie Familiencoaching Angebot Produktübersicht Il Do Mein Hyperton Kontaktinformationen
68 BOAHENE Biologische Gebäudereinigung Denkmal-Fassaden-Gebäudereinigung

6410
Telfs
Wir reinigen Ihre Objekte mit probiotischen sehr effektiven Reinigungsmitteln, weil wir ein Herz für Ihre Gesundheit und für unser aller..
http://cleaning.boahene.at Gebäudereinigung Boahene Cleaning Jobs Biologisch Büro Angebot Stiegenhausreinigung Raum Imst Grundreinigung Telfs Innsbruck Ordinationsreinigung Menu Navigation Uns
69 umzugwien24.at führt Übersiedlung Wien Umzug

1080
Wien
Mit umzugwien24.at dem Experten für Übersiedlung Wien hat man einen raschen Service gewählt, der diskret ist und nicht viel kostet...
umzugwien24.at/ Wien Entrümpelung Umzug Umzugsservice Wohnungsräumung Linz Umzugwien Außendienstmitarbeiter Verfügung Privatumzug Räumung Preis Kostenvoranschlag Wohnung Angebot Messi Wohnungen Tricks
70 Christina Gritsch Altwaren Räumungen

7574
Burgauberg
Zeitreise, Historische Möbel, Antike Möbel, Räumungen, 50er, 60er, 70er, 80er, Schallplatten, Bücher, Teppiche, Antiquitäten, Gritsch, Puppen, Tische, Möbel, Regale, Verlassenschaften..
zeitreise45.at Zeitreise Herzlichst Platz Christina Spezialistin Glas Porzellan Möbel Mich Geschäft Reise Musik Angebot Gebrauchtwaren Schnitzelklopfer Verlassenschaft Epochen Lassen Ostern Möbel Kleinteile
71 KOP-Entsorgungen Entsorgungen Übersiedlungen


KOP-Entsorgungen ist Ihr SERVICE-Partner in Sachen Entsorgungen Übersiedlungen Hausarbeiten! Von der Aktenvernichtung/Entsorgung über den Umzug bis hin zum Bilder aufhängen, Reinigung...etc...im..
kop-entsorgungen.at Entsorgungen Angebot Hausarbeiten Entsorgungenentrümpelungen Kop übersiedlungen Kontaktformular Etc Informieren Ansicht Logout Sieerreichbar Sachen Beratung Internetpräsenz
72 KOP-Entsorgungen Ihr Service-Partner Entsorgungen Übersiedlungen


KOP-Entsorgungen ist Ihr SERVICE-Partner in Sachen Entsorgungen Übersiedlungen Hausarbeiten! Von der Aktenvernichtung/Entsorgung über den Umzug bis hin zum Bilder aufhängen, Malereien...etc...im..
kop-entsorgungen.at Entsorgungen Angebot Hausarbeiten Kop Entsorgungenentrümpelungen Kontaktformular übersiedlungen Partner Privat Druckversion Etc Verfügung Emailoffice@kop Entsorgungenat Kontakt Rufen
73 Stahlbau, Rohrbau, Montagen Metallbau

8103
Rein
WIR BIETEN: Montageleiter – erfolgreiches Projektmanagement von der Planung bis zur Fertigstellung. Schweißer – selbstverständlich mit gültigem Zeugnis in allen gängigen..
cksmetalltechnik.at Quisque Unser Metallbau Montagen Rohrleitungsbau Metalltechnik Consulting Grossprojekte Projekte Fachwissen Integer Angebot Personal Bieten Kunden Suspendisse Finalen
74 CKS Metalltechnik GmbH Stahlbau Rohrbau

8103
Rein
Vom Service in Raffinerien, Verrohrungen und Montagen in Chemieindustrie, Lebensmittel- und Getränkeindustrie, Papier- und Zellstofffabriken, bis zu Energieerzeugern (Wasserkraft..
cksmetalltechnik.at Unser Quisque Metalltechnik Rohrleitungsbau Metallbau Projekte Angebot Consulting Integer Grossprojekte Montagen Bieten Fachwissen Kunden Lorem Doppelmantelleitungen * Materie Zeugnis
75 WirSindEltern - Kangatraining Rückbildung Baby Schwangerschaft

6800
Feldkirch
WirSindEltern begleitet Sie auf Ihrem individuellen Weg mit Ihrem Kind. Um schon in der Schwangerschaft fit zu bleiben und nach..
wirsindeltern.at Trageberatung Kangatraining Babykurse Eltern Preise Vorteile Kind Kinder Schweiz Liechtenstein Fragen Wirsindeltern Angebot Team Eltern® Ratgeber Aktuell
76 Übersiedlungsservice Linz – die Umzug

4020
Linz
Der Übersiedlungsservice Linz von den Experten mytrans ist der beste weit und breit. Bei uns finden Sie hochmotivierte Mitarbeiter und..
mt-uebersiedlungen.at/ Linz übersiedlungen Mt Umzug Büroumzug Umzugsservice Entrümpelung Professionelle Oberösterreich Arbeit Organisation Angebot Stress Unser Lösungen
77 Kanada Darlehen Angebot Unternehmen


BRAUCHE SIE ein Darlehen zur Gründung oder zum Ausbau Ihr Unternehmen? Fair-Finance LTD ist eine aufrichtige und Certified privaten Darlehen..
stadtbranche.at/ Wien Stadtbrancheat Salzburg Orte Magazin Christian Wellness Linz Österreich Hrlesberger Haus Österreicher Oberösterreich Unser Sehenswürdigkeiten Urlaub Eventvideos Animationen Film Abgasmessung Atmosphre Franzsisch
78 Fertighäusern Angebot Holzbauhaus

310504
Romania - Arad
Wir sind die Firma "SC. HOLZ HAUS CONSTRUCTION SRL" – ein rumänischer Hersteller von Fertighäusern in Holzrahmen. ..
holzhauseco.com Schillingsfürst Ulm Galerie Bungalow Neu Materialien Hersteller Holz Mauerarbeiten Rumänischer Musterhaus Produktion Preis Haus Uns
79 Preiswerte Entrümpelung – MT-Raeumungen Entrümpelung

4633
Kematen am Innbach
Sie suchen eine preiswerte Entrümpelung in Linz? Kein Problem, rufen Sie bei MT-Raeumungen an wir helfen Ihnen und erledigen die..
mt-raeumungen.at/ Linz Räumungen Entrümpelung Mt Räumung Wohnungsräumung Oberösterreich Verlassenschaften Messiewohnungen Umzug Raeumungenat Professionelle Angebot Keller â â â â â â â â â â â â  Altersheim
80 Integrative Psychotherapie Psychotherapie

1090
Wien
Psychotherapie, Kunsttherapie, Psychoonkologie, interkulturelle Therapie, Burn-Out..
psychotherapie-rakos.at Psychotherapie Integrative Wien Mich Mag Anna Artwork Mein Angebot Anfahrtsplan Linksliteratur Psychoonkologie Rakos über Methoden Rako
81 Umzugsservice MT-Uebersiedlung Linz Umzug

4020
Linz
Sie wünschen sich professionelle Hilfe bei ihrem Umzug Linz ? Sie möchten keine leeren Versprechen mehr von ihren Freunden hören..
mt-uebersiedlungen.at/ übersiedlungen Linz Mt Umzug übersiedlung Büroumzug Umzugsservice Oberösterreich Entrümpelung Professionelle Arbeit Google übersiedlungsfirma Angebot Google+
82 Günstiger Handyshop Wien X-Mobile Handyshop

1120
Wien
In der Regel dauert eine Reparatur eines Handys zirka 1 bis 3 Tage. Sobald der Service abgeschlossen wurde werden Sie..
handy-wien.at/ Wien Handy Handyshop Handybörse Ankauf Geld Smartphone Reparatur Geräte Angebot Smartphones Youtube Wienat Notebook Modelle
83 BOWTECH Leoben BOWTECH Leoben Massage -Fascien

8700
Leoben
BOWTECH®i ist ein eigenständiges, dynamisches System einer ganzheitlichen Muskel- und Bindegewebe-technik. Bowtech unterstützt die Schulmedizin und deren Behandlungen. Mit sanften..
bowtech-leoben.at Leoben Video Bowen Bowtech Landvogt Webseite Griffe Lebensqualität Anwendung Gutgemachtat“ Zeit Glacis Helmut Angebot Bowtechleoben@anet Neuigkeiten„empfehlen Schreiben
84 Ferienwohnungen Schartner Ferienwohnungen

5570
Mauterndorf
Traumurlaub in Österreich - Wir freuen uns, Sie im SalzburgerLand zu begrüßen. Die Marktgemeinde Mauterndorf liegt auf 1122m über dem..
schartner-urlaub.at Apartment Schartner Mauterndorf Ferienwohnungen Personen Personen__ Schloßblick Garten Biosphärenpark Mobil über Angebot + Biosphäre Familie Anfragebuchung__
85 Schartner Ferienwohnungen Ferienwohnungen

5572
Mauterndorf
Traumurlaub in Österreich - Wir freuen uns, Sie im SalzburgerLand zu begrüßen. Die Marktgemeinde Mauterndorf liegt auf 1122m über..
schartner-urlaub.at Apartment Ferienwohnungen Schartner Personen Personen__ Schloßblick Mauterndorf Biosphäre über Mobil Angebot + Garten Biosphärenpark Familie Stampfl
86 APSC Business Solutions e. Arbeitspsychologie Organisationspsychologie

1100
Wien
Unternehmensberatung Organisationsentwicklung Arbeits- und Organisationspsychologie Coaching Was machen Wir? Unternehmensberatung – Organisationsentwicklung – Arbeitspsychologie - Coaching Wie machen Wir das? Wir unterstützen Unternehmen zu Fragestellungen die..
apsc.at Sigrid Schmiedl Arbeits Organisationspsychologie Evaluierungen Maga Downloads Ma Coaching Mag Seminare Consulting Mitarbeiterinnen Angebot Vertrauen Aschg Angebote Belastungen
87 Physiotherapie Impuls Physiotherapie

5020
Salzburg
Physiotherapeut Kovac Ivica klassische Physiotherapie Lymphdrainage Cranio-Sacrale-Osteopahtie Heilmassage Akupunktmassage Crafta-Therapie: Gesichts-Kiefer-Kopfschmerzen und Halswirbelssäule-Problematik Passive Therapie: Elektrotherapie und Ultraschall Skoliosebehandlung Behandlung vor und nach Operationen..
impuls-praxis.at Hebammenpraxis Physiotherapie Angebot Behandlung Pagealarm Galerie Anfahrt Kurstermine Stock Rights Designed Impuls Faberstraßemail Reserved
88 Hebammenpraxis Hebamme

5102
Anthering
Hebamme Kovac Angelina Angebot: Mutterkindpass-Beratung Akupunktur Kinesiotaping Geburtsvorbereitungskurs Rückbildungskurs Babymassage Vor und Nachsorge ( ambulanter und vorzeitiger Entlassung)..
impuls-praxis.at Hebammenpraxis Physiotherapie Angebot Galerie Kurstermine Pagealarm Anfahrt Behandlung Mail Adresse Physiotherapie + Designed Anzeige Stock Y
89 Hebammenpraxis Hebamme

5020
Salzburg
Hebamme Angelina Kovac Hebamme für Salzburg Stadt und Flachgau Angebot: Mutterkindpassberatung Akupunktur Kinesiotaping Geburtsvorbereitungskurs Rückbildungskurs Babymassage Vor und Nachsorge in der Schwangerschaft in Salzburg Stadt und Flachgau..
impuls-praxis.at Hebammenpraxis Physiotherapie Behandlung Angebot Galerie Pagealarm Kurstermine Anfahrt Spambots Bewegungaristotelessofortkontakt Physiotherapie Leben Uns Designedimpuls
90 Capitalo.at Finanzen

55234
Ober-Flörsheim
Capitalo.at hilft Ihnen dabei, unter der Vielzahl der am Markt erhältlichen Spar – und Ratenkredit-Angebote das für Sie richtige zu..
capitalo.at Tagesgeld Sparzinsen Vergleich Vergleichat Bank Banken Kreditzinsen österreich Festgeld Zinsen Laufzeit Beste Kredite Festgeldzinsen Sparer Produkte Entscheidung Angebot
91 Textildruck Textilveredelungen

1030
Wien
Sie sind auf der Suche nach einem Lieferanten für veredelte Textilien mit hohen Qualitätsstandards und fairen Preisen? Dann sind Sie bei..
almped.at Aufkleber Textildruck Mode Shirt Kinder Insel Farben Inselat Werbetechnik News Angebot Flyer Katalog Fahrzeug Wandtattoo Anfordern
92 HauRuck Moving - Umzüge Transporte Übersiedlungen

1100
Wien
HauRuck Moving ist ein Wiener Familienunternehmen welches sich auf Übersiedlungen, Räumungen und Transporte und im In- & Ausland spezialisiert..
hauruck.at Wien Räumungen Entrümpelungen Hauruckat Angebot Entrümpelung Kosten Räumung Einholen Keine Transportgutversicherung Kundenrezension Beratung übersiedlung Aufpreis Umzugsplanung Fixpreis Garantie
93 Hauruck Umzug - Räumungen TRANSPORT

1100
Wien
Umzug Wien, Übersiedlungen Wien, Umzug im Ausland, Übersiedlungen im Ausland, Räumungen und Entrümpelungen, Übersiedlumg, Räumung Transport mit LKW, Hauruck so..
hauruck.at Wien Räumungen Entrümpelungen Einholen Kosten Entrümpelung Hauruckat Angebot Räumung Keine Verpackungsmaterial Wochenendservice Aufpreis Leistungen |
94 kostenlose Webvisitenkarte Internet

1160
Wien
Seit mehr als 10 Jahren begleitet unser Unternehmen Klein und Mittelbetriebe bei der Erstellung und dem Betrieb ihrer Homepage. Von..
co.at Domain Homepage Webseite Ihres Internet Erfolg Unternehmens Wartung Name Zeit Beispiel Kosten Kunden Web Serverausstattung Hosting Ihre Angebot Google+
95 Kinder Yoga Yoga

6830
Rankweil
Auf ganz spielerische Weise und mit viel Fantasie und Freude wird in dieser Stunde Yoga mit den Kindern geübt. Kinderyoga stärkt..
praxis-fuer-bewusstes-sein.at Praxis Unser Bewusstes Psychologie Ayurveda Yoga Numerologie Silke Energieausgleich Angebot Feng Kromer Shui Sprachmagie Bernd Lebensbereichenlösungsorientierte Wohlbefinden Bedeutet Bewusstsein Umfasst
96 Mietkoch.at - Privatköche und haushaltspersonal

5020
Salzburg
Mietkoch.at bietet Ihnen Privatköche und qualifiziertes Hauspersonal für den gehobenen Privathaushalt. Wir finden qualifizierte Butler, Haushälterinen, Chauffeure oder Privatköche für..
mietkoch.at Haushaltspersonal Privatkoch Salzburg Hauspersonal Butler Privat Kunden österreich Offene Mietkoch Personal Privathaushalt Unternehmensphilosophie Cook Angebot Chef Bewerbung Staff Gstaad Messepersonal
97 Aktenvernichtung, Aktenlager, Archivräumung Aktenvernichtung

4650
Edt bei Lambach
Wir vernichten Ihre vertraulichen Akten nach höchsten Sicherheitskriterien. Vergeuden Sie keine kostbare Arbeitszeit mit herkömmlichen Büroschreddern. Wir lagern auch Ihre..
bachlkg.at Angebot Ablaufvorbereitung Unverbindliches Durchführung Daten Sicherheitsbehälterarten Sicherheitstransportunsere Sicherheitsfahrzeuge Garantie Vernichtungszertifikatihre Anfordern Warum Sicher Vernichtetumweltfreundlich Technische Datenschutzverletzung Preise Dvd Platz
98 Systemische r Resilienztrainer in Ausbildung Online

4030
Linz
In 6 Modulen stärken Sie ihre innere Widerstandskraft, lernen lösungsorientiert zu denken, gleichen ihr Körpersystem aus und aktivieren ihr persönlich..
lichtblicke4you.at Elisabeth Teamcoaching Einzelcoaching Training Gruppensupervision Peitl Fragen Newsflorian Pdagogen Supervision Angebot Pdagoginnen Konflikten Gesundheitsvorsorge
99 Liebesschloss Österreich Geschenkartikel


Wir bieten eine große Auswahl an Liebesschlössern mit persönlicher Gravur...
liebesschloss.at Liebesschloss Euro* Euro** Bestellen österreich Herzschloss Gravur ❤ ✔ Liebesschlossat Angebot Exklusiv Schnell Dein Silbernes Angebote
100 bewusst-mental Gesundheitsberatung

5302
Henndorf
Mentaltraining, Mentaltrainer, mental, Mentaltraining Salzburg, Mentaltraining Salzburg-Umgebung, Mentaltraining Henndorf, Mentaltrainer Henndorf, Mentaltrainer Salzburg, Mentaltrainer Salzburg-Umgebung, bewusster leben, mental erleben, ..
bewusst-mental.at Coaching Mobbing Tipp Projektleiter Mich Kommunikationstraining Work Life Balance Aktuell Bewerbungstraining Angebot Selbstorganisation Mein Weg Mentaltraining Prsentationstraining
101 VisionSAT - Astra Angebot SAT

1160
Wien
Ihre Chance für kristallklaren fullHD SAT Empfang finden Sie bei VISION-SAT! kostenlose Beratung! kostenloser Erstbesuch! Servicee, ohne Zusatzkosten an Sonn- und Feiertagen! Eröffnungsangebot: SAT Anlage..
vision-sat.at Soon Coming Bearbeitungkontakt Tel Standort Rasim Hd Anlage Produkte Sat Info@vision Wien Mobile Receiver Satat Straßewebsite
102 Umzug Wien, Umzug-Angebote vergleichen umzug wien

1040
Wien
Wer eine Übersiedlung oder einen Umzug plant, möchte schnell übersiedeln. Planung und Durchführung dürfen nur wenig Zeit und Geld kosten..
umzug-wien.at Umzug Wien Umzugsfirma Umzugsfirmen Angebote Umzugsunternehmen Wienat Formular Umzugsangebote Angebot Umzugsservice Wünsche Umziehen Vergleichen Sparen
103 Limousinenservice in Österreich: Günstig taxi wien

1100
Wien
Sie landen am Flughafen Wien und wollen schnell in die umliegenden Städte. Dann ist unser Airport Taxi für Sie und..
mozarttaxi.at Wien Taxi Flughafen Airport Flughafentransfer Limousinenservice Transfer Flughafentaxi Preise Airporttaxi Ihrem Stadt Angebot Gästebuch Ziele
104 InnTeam Eventservices Eventgestaltung

6200
Jenbach
Rundumservice für Ihre Veranstaltung - von der Konzeption bis zur Durchführung alles aus einer Hand..
innteam.at Eventservices Angebot Leitbild Galerie Innteam Fasser Office@innteamat Jenbach Manfred Begutachtenfeiern Kirchgasse Beisie Bisherigenarbeiten Innteam
105 Psychologische Praxis Psychologie Medizin

8044
Graz
Ich möchte Sie gerne in meiner psychologischen Praxis in Graz-Mariatrost begrüßen. Als Klinische und Gesundheitspsychologin unterstütze ich Erwachsene, Jugendliche, Kinder..
psychologie-mariatrost.at Praxis Hasenhütl Mariatrost Psychologische Angebot Mariatrostbettina Bettina Team Graz Schliessenvereinbarung Schwangerschaft Kontakt Mag
106 ERFOLGSIMMOBILIEN Gabriele Wieser Immobilienmakler

4300
St. Valentin
Zuverlässige Vermittlung Immobilien aller Art! Verkauf, Vermietung, Verpachtung, etc. Jede Immobilie ist so einzigartig wie wir Menschen und hat eine eigene..
erfolgsimmobilien.at Immobilien Kaufen Umgebung Weitra Linz Erfolgsimmobilien Waldviertel Wohnen Verkauf Haus Baugrund Gasthaus St Gabriele Nähe Land Wieser Energieausweis Angebot Stadel News
107 ncor GesbR Software

7000
Eisenstadt
MenüApp - die smarte App für Ihr Restaurant MenüApp ist eine App für iPhone und Android-Mobiltelefone und die perfekte Ergänzung zu..
ncor.at Menüapp App Push Android Mitteilungen Demo Gäste Webseite Ihrem Wochenmenü Logo Informieren Speisekarte Auftritt Mobiltelefone Mittags Angebot Design
108 SZNews.at - Topaktuelle Nachrichten News

6130
Schwaz
Die aktuellste Online-News-Plattform aus dem Raum Schwaz bietet News zu verschiedenen Themenbereichen aus mehreren Regionen. Nie mehr etwa verpassen, aber..
sznews.at Browser Sznews Bitte Sznewsat Topaktuelle Welt Politik Wirtschaft Sport Nachrichten Schwaz News Lokales Stadtbrancheat Ausland Angebot Kultur Internet
109 Etiketten Jusko Etiketten


Ihr Spezialist für Printeretiketten, Waagenetiketten, Thermoetiketten, Schmucketiketten, Weinetiketten, Preisauszeichnungsgeräte, Thermodrucker, Verkaufshilfen aus Acryl..
jusko.at/ Etiketten Jusko Gefahrenzeichen Weihnachts Verkaufshilfen Preisauszeichner Angebot Acryl Unverbindliches Versandkosten Finden Printeretiketten Drucksorten Preisen Maschinen
110 Etiketten Jusko e.U. Etiketten

6020
Innsbruck
Das Tiroler Unternehmen mit über 45jähriger Tätigkeit im grafischen Gewerbe garantiert fachliche Beratung von der Grafik über den Druck bis..
etiketten-jusko.com Etiketten Jusko Apotheken Acryl Versandkosten Weihnachts Drucker Untersttzt Gefahrenzeichen Konfiguration Angebot Unverbindliches Derderzeitigen Inlineframes Verkaufshilfen Preisauszeichner
111 Coaching Lebensberatung Mentaltraining Lerncoaching Coaching

1080
Wien
Mein Angebot im Bereich Beratung, Coaching und Therapie für Kinder, Jugendliche und Erwachsene umfasst: SYSTEMISCHES COACHING und PERSÖNLICHKEITSENTWICKLUNG Sie wollen Ihre Persönlichkeit..
praxis-bittner.at Coaching Mentaltraining Lebensberatung Training Wien Lerntherapie Systemisches Angebot Familienberatung Lernen Seminar Lerncoaching Erwachsene Kinder Integrative Kontaktformular Praxis
112 Cardseven thermotransferbänder Druckereien

2483
Ebreichsdorf
Armor, Marktführer bei Thermotransferbänder und Partner von Cardseven bietet eine vielseitige Produktpalette an Thermotransferbändern, Waxbänder, Farbbänder für Etikettendrucker und Barcodedrucker...
thermotransferband.at Armor Cardseven Bnder Barcode Etiketten Thermotransferbnder Etikettendrucker Transfer Wax Solfree Thermo Farbbnder Produkte Thermotransferdrucker Angebot Termotransfer
113 24 Stunden Pflege und Pflegeagentur

08001
Prešov
Die Agentur VaV ist Personal- und Bildungsagentur und ein Mitglied der Gruppe VaV die eine große Skala von Dienstleistungen in..
altenpflegevav.at Angebot Stunden Pflege Pflegerinnen Bestellung Mail Diamantangebot Unser Pflegeagentur Pflegepersonal Deutsch Taxi Adresse Verfügung Pflegestufen Dasbetreuungspersonal Pflegekräfte
114 Sports World Online GmbH OnlineShop

4600
Wels
Viele Sportler entscheiden sich dafür, sämtliche Trainingsutensilien und auch sämtliche Trainingskleidung in einem Sport Online Shop zu kaufen. Beinahe in..
sportonlineshop.at/ Sport Intersport Onlineshop Wintersport Eshop Angebot Marken Sportbekleidung Burton Winter Mckinley Artikel Shop Sports Sicherheit Gerstet Vielfalt
115 Praxis f. Psychotherapie Psychotherapie

2130
Mistelbach
Psychotherapie für Erwachsene bei Angst, Panik, Depression, Krisen. Jugendlichentherapie zur Beziehungsklärung in Bezug auf Eltern, FreundIn aber auch in Entwicklungskrisen...
w4psy.at Methode Psychotherapie Therapie Mistelbach Geiger Paartherapie Psychodrama Praxis Gruppe Martin Angebot Person Jugendliche Supervision Coaching Thema Psychotherapeut Kalender
116 HypnoBirthing und Geburt Aufarbeitung Gesundheit

1230
Wien
Die gesundheitspsychologische Praxis "Erlebnis Geburt" von Mag. Kerstin Rojko-Vetter bietet Vorbereitung und Aufarbeitung. Das Angebot wendet sich einerseits an Paare,die..
erlebnis-geburt.at Geburt Erlebnis Rojko Geburtsnachsorgegespräch Kurs Vetter Kerstin Hypnobirthing Erfahrungsberichte Hypnobirthingkurse Maga Praxis Aufarbeitung Vorbereitung Birth Hypnobirthing© Angebot Schön
117 DIKA Pool - Pools Schwimmbecken

2011
Sierndorf
Unser Unternehmen hat sich auf die Planung und Lieferung von individuellen Überlauf und Skimmer Schwimmbecken spezialisiert. Durch hochwertiges Material sowie..
dika-pool.at Pool Schwimmbecken Dika Modelle Luxury Swimming überdachungen Kalkulation Angebote Bevorzugte Aktionen Angebot Company Bildergalerie überdachung Perfekte Niveko Kundenspezifisch Beraten Mb
118 Der Koihof Zoofachhandel

8483
Deutsch Goritz
Handel mit Japan Koi, Zubehör und Teichpflanzen, Beratung bei Teichbau und Filteranlagen, Import und Verkauf von orig. japanischen Koi..
derkoihof.at Koi Japan Koihof Zubehör Teichpflanzen Teichbau Herbst Maschenweiten Verkauf Angebot Vorbestellungen Futter Gartenteich Shop Samen
119 Übersetzungsbüro Dienstleistungen

1090
Wien
Sollte man eine einwandfreie Übersetzung eines Dokumentes brauchen, empfiehlt es sich, ein Übersetzungsbüro zu kontaktieren. In Österreich findet man mittlerweile..
interlingua.at übersetzungen Springen Sprachen Angebot Kontaktformular Dokumentation Dienstleistungen Kooperationen Cat Tools Dolmetschen önorm Geschäftsshybedingungen Jobs Team Translations Unser Webseiten Juristische
120 Was Gutes tun Shoppingportal

1220
Wien
Shoppen und dabei was Gutes tun. Einfach über was Gutes tun zu deinen Lieblingsshop surfen, einkaufen und wir spenden danach..
was-gutes-tun.eu Gutes Shops Shop Email Dich Website Einnahmen Beste Schick Einkauf Daten Cent Gute Organisationen Datenschutzhinweis Beitritt Technik Angebot Elektronik Unterschied
121 Praxis Sailer Psychologe

8010
Graz
Meine Tätigkeit als Psychologe in Graz umfasst die Behandlung von Angst und Panik, Depressionen und einer möglichen Selbstwertproblematik. Als ausgebildeter..
praxis-sailer.at Graz Psychologe Praxis Kinder Dazu Sailer Behandlung Erwachsene Familien Psychologische Behandlungen Tätigkeit Meine Angebot Jugendliche Gefühle Verantwortung Vordergrund Arbeit Diverse
122 Zum Angebot das

Das Angebot bei Gedanke.at umfasst und behandelt umfrangreich die Themen: MENTAL BODY ROOM. Desweiteren werden ... Sie das für Sie passende Angebot aus MENTAL I BODY I ROOM NEWSLETTER Jetzt die neusten Informationen per erhalten
gedanke.at Das Angebot Angebote Mentaltraining Beschreibung Der
123 AngeboteNiederoesterreich Angebote

Angebote Aktionen Dienstleistungendirekt vor Ihrer Haustüre ...  Angebote-Niederoesterreich IMPRESSUM AGB KONTAKT JOBS
handwerkerimbezirk.at Angebote Niederoesterreich AngeboteNiederoesterreich AngeboteWien AngeboteBru
124 AngeboteSteiermark Angebote

Angebote Aktionen Dienstleistungendirekt vor Ihrer Haustüre ...  Angebote-Steiermark IMPRESSUM AGB KONTAKT JOBS
angebote-tirol.at Angebote Niederoesterreich AngeboteNiederoesterreich AngeboteWien AngeboteBru
125 AngeboteNiederoesterreich Angebote

Angebote Aktionen Dienstleistungendirekt vor Ihrer Haustüre ...  Angebote-Niederoesterreich IMPRESSUM AGB KONTAKT JOBS
angebote-stockerau.at Angebote Niederoesterreich AngeboteNiederoesterreich AngeboteWien AngeboteBru
126 AngeboteSteiermark Angebote

Angebote Aktionen Dienstleistungendirekt vor Ihrer Haustüre ...  Angebote-Steiermark IMPRESSUM AGB KONTAKT JOBS
angebote-steiermark.at Angebote Niederoesterreich AngeboteNiederoesterreich AngeboteWien AngeboteBru
127 AngeboteNiederoesterreich Angebote

Angebote Aktionen Dienstleistungendirekt vor Ihrer Haustüre ...  Angebote-Niederoesterreich IMPRESSUM AGB KONTAKT JOBS
angebote-tulln.at Angebote Niederoesterreich AngeboteNiederoesterreich AngeboteWien AngeboteBru
128 AngeboteSteiermark Angebote

Angebote Aktionen Dienstleistungendirekt vor Ihrer Haustüre ...  Angebote-Steiermark IMPRESSUM AGB KONTAKT JOBS
angebote-kaernten.at Angebote Niederoesterreich AngeboteNiederoesterreich AngeboteWien AngeboteBru
129 AngeboteNiederoesterreich Angebote

Angebote Aktionen Dienstleistungendirekt vor Ihrer Haustüre ...  Angebote-Niederoesterreich IMPRESSUM AGB KONTAKT JOBS
angebote-niederoesterreich.at Angebote Niederoesterreich AngeboteNiederoesterreich AngeboteWien AngeboteBru
130 AngeboteSteiermark Angebote

Angebote Aktionen Dienstleistungendirekt vor Ihrer Haustüre ...  Angebote-Steiermark IMPRESSUM AGB KONTAKT JOBS
angebote-oberoesterreich.at Angebote Niederoesterreich AngeboteNiederoesterreich AngeboteWien AngeboteBru
131 AngeboteNiederoesterreich Angebote

Angebote Aktionen Dienstleistungendirekt vor Ihrer Haustüre ...  Angebote-Niederoesterreich IMPRESSUM AGB KONTAKT JOBS
angebote-sierndorf.at Angebote Niederoesterreich AngeboteNiederoesterreich AngeboteWien AngeboteBru
132 AngeboteSteiermark Angebote

Angebote Aktionen Dienstleistungendirekt vor Ihrer Haustüre ...  Angebote-Steiermark IMPRESSUM AGB KONTAKT JOBS
angebote-urlaube.at Angebote Niederoesterreich AngeboteNiederoesterreich AngeboteWien AngeboteBru
133 AngeboteNiederoesterreich Angebote

Angebote Aktionen Dienstleistungendirekt vor Ihrer Haustüre ...  Angebote-Niederoesterreich IMPRESSUM AGB KONTAKT JOBS
angebote-korneuburg.at Angebote Niederoesterreich AngeboteNiederoesterreich AngeboteWien AngeboteBru
134 AngeboteSteiermark Angebote

Angebote Aktionen Dienstleistungendirekt vor Ihrer Haustüre ...  Angebote-Steiermark IMPRESSUM AGB KONTAKT JOBS
angebote-vorarlberg.at Angebote Niederoesterreich AngeboteNiederoesterreich AngeboteWien AngeboteBru
135 AngeboteNiederoesterreich Angebote

Angebote Aktionen Dienstleistungendirekt vor Ihrer Haustüre ...  Angebote-Niederoesterreich IMPRESSUM AGB KONTAKT JOBS
angebote-zwettl.at Angebote Niederoesterreich AngeboteNiederoesterreich AngeboteWien AngeboteBru
136 Transportvermittlung.at Angebote zum transportvermittl

transportvermittlung.at Erhalten Sie bis zu 6 Angebote von Transportunternehmen und Spediteuren in Ihrer Nähe! ... Österreich Transportfirma Gefährliche Güter Kostenlose Angebote Tipps zum Transport Internationaler Transport
transportvermittlung.at Transportvermittlung.at Angebote Transport Vergleichen
137 Aktuelle Angebote IWOG Aktuelle

Aktuelle Angebote. meta description ... IWOG Immobilien und Wohnen GmbH Aktuelle Angebote Kontakt Unsere aktuellen Angebote Karte
iwog.at Aktuelle Angebote Keywords
138 Spedition Angebote von spedition

Spedition kostenlose Anfrage stellen und Angebote erhalten ... die Ihnen ein konkretes Angebot unterbreiten. Sie arbeiten bereits mit einer Spedition zusammen möchten aber gerne
myspedition24.at Spedition Transporteur Angebote Angebot
139 Unser Angebot : Kunststoffkanten Kunststoffkanten
4020
Linz
Kunststoffkanten : Unser Angebot Kunststoffkanten Furnierkanten Aktionen/Abverkauf ... Sie Stichworte um ein Produkt zu finden. erweiterte Suche Unser Angebot Herzlich Willkommen Gast! Möchten
kunststoffkanten.at Kunststoffkanten Furnierkanten Aktionen/Abverkauf
140 Kurierdienst Angebote von kurierdienst

Kurierdienst kostenlose Anfrage stellen und Angebote erhalten ... pünktlich und sicher von A nach B transportieren soll und benötigen dafür ein Angebot
mykurier24.at Kurierdienst Bote Kurier Transporteur
141 Bodenheiss.at brandheisse Angebote Laminat

bodenheiss.at brandheisse Angebote rund um die Bodenverlegung ... www.bodenheiss - brandheisse Angebote rund um die Bodenverlegung - Weiter -
bodenheiss.at Laminat Parkett Bodenverlegung Terrassen
142 Angebote und Gutscheine für 'ich
9300
St. Veit
ichbrauche.at Wir finden die besten Angebote Gutscheine und Veranstaltungen in Klagenfurt und Umgebung ... NEWSLETTER ABONNIEREN Aktuelle Angebote Feedback Nutzungsbedingungen Buchen Kontakt
ichbrauche.at 'ich Brauche' 'ich Suche' Angebote
143 Umzug in Österreich umzug

Mit einem einfachen Formular können kostenlos und unverbindlich Angebote von Umzugsunternehmen in Österreich eingeholt werden. ... Umzugsunternehmen? Viele Anbieter tummeln sich auf dem Markt. umzug-easy vergleicht die Angebote von über
umzug-easy.at Umzug Umziehen Angebot Preisvergleich
144 Fliesenhof Strohmer Wir Fliesen
2201
Hagenbrunn
Fliesenhof Strohmer Unser Angebot reicht von Fliesen über Natursteine Mosaike Badewannen ... über . m Lagerware für Sie verfügbar. Unser Angebot reicht von Fliesen über Natursteine Mosaike
fliesenhof.at Fliesen Kachelofen Hagenbrunn Waidhofen
145 Rechnungen schreiben oder Angebote Rechnungen

Software zum Erstellen von Rechnungen Lieferscheinen Aufträge und Angebote ... ) KROOFFICE Rechnungen schreiben Angebote erstellen ... Mit KROOFFICE können sie benutzerfreundlich
rechnungsprogramme.at Rechnungen Rechnung Rechnungen
146 Last Minute Reisen Angebote Holiday Smart GmbH Last
45127
Essen
Last Minute Reisen Angebote im Überblick von allen Veranstaltern finden Sie hier. Ihr ... Last Minute Reisen Angebote Last Minute Reisen Angebote können Sie ganz einfach hier vergleichen
reisen-ab-flughafen.at Last Minute Angebote Last Minute Reisen Angebote
147 Internationalertransport.at Angebote für internationalertr

internationalertransport.at Erhalten Sie bis zu 6 Angebote von internationalen Transportfirmen. Vergleichen Sie und sparen Sie ... Transport Gefahrengut Kostenlose Angebote Transportfirma Tipps zum Transport Home Start Suche Erhalten
internationaler-transport.at Internationalertransport.at Angebote Kostenlos Vergleichen
148 Unser Angebot COSMETIK-STUDIO 3 Ges.m.b.H. Kosmetik
1030
Wien
Erleben Sie Kosmetik und Permanent Make Up im Beauty Island. Unser Angebot reicht von der ... Unser Angebot Permanent Makeup ITPL beautytek Kosmetik Gesicht Kosmetik Körper Hand- und Fusspflege
beauty-island.at Kosmetik Permanent Make Up Ganzheitskosmetik
149 GruppenreisenBusreisen Lechtal Angebote gruppenreisen

Gruppen und Busreisen Lechtal Tirol: Finden Sie hier alle Angebote für Ihre Bus oder ... DE EN FR Anreise Newsletter Gutschein Menü Hotel Post in Steeg Unsere Leistungen Angebote
gruppenreise-lechtal.at Gruppenreisen Busreise Angebote Gruppenreise Tirol
150 Malerfirmen.at Angebote von malerfirmen.at

malerfirmen.at Holen Sie jetzt Angebote für Ihre Fassade von Anstreichern und Lackierern ein! Vergleichen Sie ... ! Home Start Suche Bis zu kostenlose Angebote erhalten So wird's gemacht Schritt - Wählen
malerfirmen.at Malerfirmen.at Malerfirmen Anstreicher Fassade Lackierer
151 Opel Österreich | Neue General Motors Austria GmbH Opel
1220
Wien
Opel Österreich. Entdecken Sie das ganze Angebot neuer Opel Fahrzeuge. Hier finden Sie die neusten ... Konfigurator Händlersuche Probefahrt Angebot Servicetermin Kataloge Newsletter Kontakt myOpel Suche
opel.at Opel Opel Modelle Opel Fahrzeuge
152 Angebote und Aktionen auf Hofer

Aktuelle Supermarkt Angebote. Bei uns finden Sie immer die neuesten TopAngebote aller Supermärkte für Ihren ... Zu den Aktionen ? Zu den %-Tagen ? Besondere Angebote Bei uns immer die neuesten Top-Angebote. Klicken Sie hinein
meineaktionen.at Hofer Angebote Aktionen Sonderangebote Rabatte Bieraktionen Ottakringer Puntigam
153 Tiendeo Prospekte tiendeo

Kaufe in deiner Stadt. Finde Angebote Prospekte und Filialen in deiner Gegend auf tiendeo.at ... Spielzeug und Baby Bücher Motor Reisen Fast Food Mehr Gesundheit Tiendeo » Kaufen Geschäfte und Angebote
tiendeo.at Tiendeo Swarovski DM ToysRus
154 Restaurants Salzburg Restaurant restaurant

Restaurants in Salzburg suchen und finden Restaurantsuche Bewertungen Bilder und Angebote in ... Bewertung Bilder Hier finden Sie die besten Restaurants Gastronomie Angebote und Tipps in Salzburg
restaurants-salzburg.at Restaurant Gastronomie Salzburg Suche
155 Angebote für Kulturreisen und netwerk Kreidl GmbH & CO KG Angebote
6275
Stumm im Zillertal
Angebote für Kulturreisen und Kreativurlaub in Österreich: Kreativ Reisen bereichernde Kulturreisen und inspirierender Kreativurlaub ... Steiermark Tirol Kreativ-Angebote Kunst und Kultur Handwerk Kulinarik Kreativ-Kurse Kreativ-Service
kreativreisen.at Angebote Für Kulturreisen TopAngebote Für Kulturreisen
156 Österreich Skiurlaub Österreich

Österreich Skiurlaub Winterurlaub Angebote 2014 / 2015 günstig buchen und UrlaubAngebote jetzt ... - TopSkigebiete - Familienskigebiete JETZT AKTUELL FÜR Winterurlaub Angebote Skiurlaub Angebote Buchen
mountainstar.at Österreich Skiurlaub Winterurlaub Angebote 2014 /
157 A Fenster Angebot Fenster

Holen Sie sich unser Bestes Angebot für Ihre Fenster! Fenster für Wien und ganz Österreich. ... ¶sche ich die Auswahl aus dem Wahrenkorb? Wie erstelle ich mein Angebot? Hilfe ausschalten Server
a-fenster.at Fenster Türen A Fenster Fenster
158 Offindo ? Angebote rund Offindo

Kostenlose Angebote für Photovoltaikanlagen Solaranlagen Windanlagen Geothermie oder energiesparende Schwimmbäder und Saunaanlagen ... SuchbegriffKategorie Startseite offindo ? Ihr Partner in Sachen Angebote Beratung Auf den folgenden Seiten
offindo.at Offindo Angebote Solaranlage Photovoltaik
159 Aktuelle Angebote im GP Angebote

Akutelle Angebote im GP Shop Peischer
mx-peischer.at Angebote MX Bekleidung Peischer Höhnhart
160 Unser Angebot Syst reg Wandl-Beratung KG Unser
9020
Klagenfurt am Wörthersee
Unser Angebot Syst reg Seminare und mehr Unsere Zielgruppe Mit wem wir arbeiten Ihr Anliegen ... Publikationen News Wir begleiten Unternehmen und Generationen im Wandel Unser Angebot Syst® Seminare und mehr
wandelberatung.at Unser Angebot Seminare Unsere Zielgruppe Arbeiten Anliegen Nutzen
161 Der Renault Clio Grandtour Mario Keller GmbH clio
1200
Wien
Der neue Renault Clio Grandtour (IV): Alle Informationen mit Preisliste Fotos aktuelle Angebote ... - angeboten. Die Clio Grandtour Preisliste als PDF-Download Renault Clio Grandtour
clio-grandtour.at Clio Renault Grandtour Preise Broschüre Angebot Angebote Broschüre
162 Pörtschach am Wörthersee | Wörthersee Tourismus GmbH Wörthersee
9220
Velden
Hier finden Sie Hotels Angebote Aktivitäten Regionen Sehenswertes und nützliche Informationen ... Betriebe Unterkunftsliste Campingplätze ?? Angebote Sehenswertes Services Kontakt Unverbindliche Anfrage
poertschach.at Wörthersee Velden Pörtschach Kärnten
163 Velden am Wörthersee | Wörthersee
9220
Velden
Hier finden Sie Hotels Angebote Aktivitäten Regionen Sehenswertes und nützliche Informationen ... Betriebe Unterkunftsliste Campingplätze ?? Angebote Sehenswertes Services Kontakt Unverbindliche Anfrage
velden.at Wörthersee Velden Pörtschach Kärnten
164 Angebote Poolsauger: Günstige Poolreiniger Angebote

Angebote Poolsauger: Günstige Poolreiniger Poolroboter Bodensauger bei poolroboter.at Angebote Poolsauger Günstige Poolreiniger Poolroboter Bodensauger ... pool-roboter - Automatischer Schwimmbadreiniger - Schwimmbadroboter für den Pool Angebote Pool
pool-roboter.at Angebote Poolreiniger PoolRoboter Angebote BODENSAUGER Angebote
165 Unser angebot MossMusic

Das Angebot von Moss Music deinem Tonstudio in Feldkirch ... Navigation überspringen Angebot Equipment Über mich Kontakt Unser Angebot Willkommen bei mossmusic
mossmusic.at
166 Rechnungen online schreiben Rechnungen
2230
Gänserndorf
Rechnungen online schreiben Angebote erstellen elektronisch und per Post versenden und Kunden verwalten. ... online schreiben Angebote stellen und Kunden verwalten Mit easybill können Sie ganz einfach Rechnungen
easybill.at Rechnungen Online Schreiben Angebote Erstellen Kunden Verwalten Unternehmer
167 Regionale Anbieter und Angebote Regional

Auf nahklick.at findest Du aktuelle Angebote Deiner lokalen Geschäfte OnlineFlugblätter Blätterkataloge Gutscheine ... Schnäppchen-Angebote Flugblätter Gutscheine und mehr! Dein Standort Such-Radius km Angebote - Prospekte
nahklick.at Regional Lokal Angebote Prospekte
168 Umzugsfirmen.at Was kostet umzugsfirmen.at

umzugsfirmen.at Ermitteln Sie eine preiswerte Umzugsfirma in Ihrer Region. Erhalten Sie mehrere Angebote von ... Ihre Postleitzahl Privater Umzug Firmenumzug Sie ziehen in ein anderes Land um? Fragen Sie Angebote auf unserer
umzugsfirmen.at Umzugsfirmen.at Umzugsfirmen Möbelspeditionen Umzugsfirma Angebote
169 Umzugwaidhofen.at Waidhofen | umzugwaidhofen.at

umzugwaidhofen.at PLZ 38 Heidenreichstein Litschau Waidhofen an der Thaya Niederösterreich umzug in Waidhofen. ... Umzugsservice in Waidhofen vergleichen mit gratis Angebote Art Ihrer Anfrage Gefundene Umzugsfirmen
umzug-waidhofen.at Umzugwaidhofen.at Plz 38 Heidenreichstein Litschau Waidhofen
170 Umzugbludenz.at Bludenz | umzugbludenz.at

umzugbludenz.at PLZ 67 Bludenz Schruns Nenzing Vorarlberg Übersiedlung in Bludenz? Fordern Sie direkt ... Übersiedlung Angebote in Bludenz Art Ihrer Anfrage Gefundene Umzugsfirmen Kostenvoranschläge
umzug-bludenz.at Umzugbludenz.at Plz 67 Bludenz Schruns Nenzing
171 Umzuginnsbruck.at Innsbruck | umzuginnsbruck.at

umzuginnsbruck.at PLZ 60 Innsbruck Hall in Tirol Rum Tirol Holen Sie jetzt Angebote ... Holen Sie jetzt Angebote von Umzugsfirmen in Innsbruck ein! Art Ihrer Anfrage Gefundene
umzug-innsbruck.at Umzuginnsbruck.at Plz 60 Innsbruck Hall In Tirol
172 Umzugansfelden.at Ansfelden | umzugansfelden.at

umzugansfelden.at PLZ 40 Linz Donau Traun Leonding Oberösterreich Umziehen in oder aus ... -ansfelden können Sie einfach gratis und unverbindlich Angebote von Umzugsfirmen in Ansfelden einholen
umzug-ansfelden.at Umzugansfelden.at Plz 40 Linz Donau Traun
173 Umzugstockerau.at Stockerau | umzugstockerau.at

umzugstockerau.at PLZ 20 Stockerau Hollabrunn Retz Niederösterreich Preise von umziehen in Stockerau? Holen ... ? Auf umzug-stockerau können Sie einfach gratis und unverbindlich Angebote von Umzugsfirmen in Stockerau
umzug-stockerau.at Umzugstockerau.at Plz 20 Stockerau Hollabrunn Retz
174 Maria Wörth Reifnitz am Wörthersee Tourismus GmbH Wörthersee
9220
Velden
Hier finden Sie Hotels Angebote Aktivitäten Regionen Sehenswertes und Informationen zu ... Betriebe Unterkunftsliste Campingplätze ?? Angebote Sehenswertes Services Kontakt Unverbindliche Anfrage
maria-woerth.at Wörthersee Velden Pörtschach Kärnten
175 Keutschach | 4 Seental Wörthersee Tourismus GmbH Wörthersee
9220
Velden
Hier finden Sie Hotels Angebote Aktivitäten Regionen Sehenswertes und nützliche Informationen ... Betriebe Unterkunftsliste Campingplätze ?? Angebote Sehenswertes Services Kontakt Unverbindliche Anfrage
keutschach.at Wörthersee Velden Pörtschach Kärnten
176 Umzugsalzburg.at Salzburg | umzugsalzburg.at

umzugsalzburg.at PLZ 50 Salzburg Wals bei Salzburg SalzburgGnigl Salzburg Sie möchten preiswert umziehen?Jetzt ... Jetzt Angebote von Umzugsfirmen in Salzburg einholen! Art Ihrer Anfrage Gefundene Umzugsfirmen
umzug-salzburg.at Umzugsalzburg.at Plz 50 Salzburg Wals Bei Salzburg
177 Umzugtulln.at Tulln | umzugtulln.at

umzugtulln.at PLZ 34 Klosterneuburg Tulln St. AndräWördern Niederösterreich Was kostet Möbeltransporte Tulln? Erfragen ... Umziehen in Tulln mit gratis Angebote Art Ihrer Anfrage Gefundene Umzugsfirmen Kostenvoranschläge
umzug-tulln.at Umzugtulln.at Plz 34 Klosterneuburg Tulln St.
178 Mariazell Hotel Steiermark Österreich Mariazell

Österreich Hotel Mariazell urlaub und unterkunft in der Steiermark angebote im sommer zum ... Dampfbad. Programme Sommer und Herbst >> Winter Angebote >> Nach dieser kurzen Einführung möchten
haus-franziskus.at Mariazell Hotel Steiermark Österreich
179 Umzugsaalfelden.at Saalfelden | umzugsaalfelden.a

umzugsaalfelden.at PLZ 57 Zell am See Mittersill Saalfelden am Steinernen Meer Salzburg Umziehen ... -saalfelden können Sie einfach gratis und unverbindlich Angebote von Umzugsfirmen in Saalfelden einholen
umzug-saalfelden.at Umzugsaalfelden.at Plz 57 Zell Am See Mittersill
180 Umzughall.at Hall | umzughall.at

umzughall.at PLZ 45 Bad Hall Kirchdorf an der Krems Kremsmünster Oberösterreich Umzugsservice in ... können Sie einfach gratis und unverbindlich Angebote von Umzugsfirmen in Hall einholen. Folgen Sie einfach
umzug-hall.at Umzughall.at Plz 45 Bad Hall Kirchdorf An
181 Umzugspittal.at Spittal | umzugspittal.at

umzugspittal.at PLZ 98 Seeboden Gmünd Spittal an der Drau Kärnten Was kostet Umzugshilfe? ... ? Auf umzug-spittal können Sie einfach gratis und unverbindlich Angebote von Umzugsfirmen in Spittal
umzug-spittal.at Umzugspittal.at Plz 98 Seeboden Gmünd Spittal
182 Umzuglinz.at Linz | umzuglinz.at

umzuglinz.at PLZ 40 Linz Donau Traun Leonding Oberösterreich Umzug Firma in Linz ... können Sie einfach gratis und unverbindlich Angebote von Umzugsfirmen in Linz einholen. Folgen Sie einfach
umzug-linz.at Umzuglinz.at Plz 40 Linz Donau Traun
183 Umzugschwechat.at Schwechat | umzugschwechat.at

umzugschwechat.at PLZ 23 Mödling Schwechat Perchtoldsdorf Niederösterreich Umziehen in Schwechat? Vergleichen Sie das ... Günstig umziehen in Schwechat mit gratis Angebote Art Ihrer Anfrage Gefundene Umzugsfirmen
umzug-schwechat.at Umzugschwechat.at Plz 23 Mödling Schwechat Perchtoldsdorf
184 Umzugschwaz.at Schwaz | umzugschwaz.at

umzugschwaz.at PLZ 61 Schwaz Wattens Völs Tirol Was kostet mein Umzug? Vergleichen Sie ... Gratis Angebote fur Schwaz Umzug Art Ihrer Anfrage Gefundene Umzugsfirmen Kostenvoranschläge
umzug-schwaz.at Umzugschwaz.at Plz 61 Schwaz Wattens Völs
185 Umzugwoergl.at Woergl | umzugwoergl.at

umzugwoergl.at PLZ 63 Kufstein Wörgl Kitzbühel Tirol Umzug Kosten Woergl vergleichen. Erhalten Sie ... -woergl können Sie einfach gratis und unverbindlich Angebote von Umzugsfirmen in Woergl einholen. Folgen
umzug-woergl.at Umzugwoergl.at Plz 63 Kufstein Wörgl Kitzbühel
186 Flitterwochen Angebote flitterwochen

Flitterwochen auf dem Campingplatz sind nicht nur eine etwas andere Art um Ihre Hochzeitsreise ... ein. Flitterwochen Angebote Verbringen Sie Ihre Flitterwochen in Italien umgeben von Natur und nahe dem romantischen
flitterwochenangebote.at Flitterwochen Angebote Venedig Angebote Ehe
187 Angebote der Firmen

Stellen Sie eine kostenlose Angebotsanfrage vergleichen die Angebote und wählen die beste Firma aus. ... Menu Auftraggeber Firmen Kontakt Über uns Kontakt Finden Sie ein Angebot Finden
oferteo.at
188 Spinde Stahlspinde Spinde

Spinde Stahlspinde Umkleideschränke Metallschränke Stahlmöbel mit hochwertiger Qualität und günstigen Preisen! ... Beratung Planung Kostenloses Angebot! Spinde Stahlspinde Umkleideschränke Metallschränke
spind-shop.at Spinde Stahlspinde Umkleideschränke Metallschränke
189 Umzugbregenz.at Bregenz | umzugbregenz.at

umzugbregenz.at PLZ 69 Bregenz Hard Lauterach Vorarlberg Sie möchten umziehen? Informieren Sie sich ... ? Auf umzug-bregenz können Sie einfach gratis und unverbindlich Angebote von Umzugsfirmen in Bregenz
umzug-bregenz.at Umzugbregenz.at Plz 69 Bregenz Hard Lauterach
190 Umzugternitz.at Ternitz | umzugternitz.at

umzugternitz.at PLZ 26 Neunkirchen Niederösterreich Ternitz Gloggnitz Niederösterreich Umziehen in Ternitz. Vergleichen ... ? Auf umzug-ternitz können Sie einfach gratis und unverbindlich Angebote von Umzugsfirmen in Ternitz
umzug-ternitz.at Umzugternitz.at Plz 26 Neunkirchen Niederösterreich Ternitz
191 Umzugvoecklabruck.at Voecklabruck | umzugvoecklabruck

umzugvoecklabruck.at PLZ 48 Gmunden Bad Ischl Vöcklabruck Oberösterreich Umzug Kosten in Voecklabruck. möbeltransporte ... ? Auf umzug-voecklabruck können Sie einfach gratis und unverbindlich Angebote von Umzugsfirmen
umzug-voecklabruck.at Umzugvoecklabruck.at Plz 48 Gmunden Bad Ischl
192 Demidan Gutscheine www.demidan.at ist ein Service der Bavaria Consult International GmbH Gutschein
86156
Augsburg
Demidan – Marktplatz für Gutscheine Rabatte und günstige Angebote
demidan.at Gutschein Rabatt Angebot Top Angebote
193 Internetanschluss.at Finden Sie DomainQuadrat Marketing GmbH internetanschluss
1230
Wien
Angebote zum Thema Internetanschluss ... internetanschluss Finden Sie hier Angebote zum Thema Internet-Anschluss Weitere Links zum Thema
internetanschluss.at Internetanschluss Internet Anschluss Provider Adsl
194 Angebot zu Schwimmteich Badeteich Schwimmteich

acqua dolce Badeteiche unser Angebot im Internet zu Schwimmteich Badeteich Naturpool und
naturbad.at Schwimmteich Badeteich Naturpool Naturbad
195 Umzugsanktveit.at Sankt Veit umzugsanktveit.at

umzugsanktveit.at PLZ 93 TreibachAlthofen Friesach St. Veit an der Glan Kärnten Was kostet ... -sankt-veit können Sie einfach gratis und unverbindlich Angebote von Umzugsfirmen in Sankt Veit
umzug-sankt-veit.at Umzugsanktveit.at Plz 93 Treibachalthofen Friesach St.
196 Schnäppchen Angebote

Schnäppchen Angebote Deals. Richtig viel sparen mit Preise vergleichen. Angebote von Amazon und ... preisshark Schnäppchen Mehr ? Wir jagen das BESTE Angebot! Menü Zum Inhalt springen Startseite
preisshark.at
197 Lagerraumanbieter.at Vergleichen Sie lagerraumanbieter
3001
KK Rotterdam
lagerraumanbieter.at Vergleichen Sie bei uns kostenlos Lagerraum Spezialisten und finden Sie das beste Angebot für ... den Sie hier den passenden Lagerraum Anbieter! Kostenlos Lagerraum Angebote anfordern! Home Start Suche Bis zu kostenlose
lagerraumanbieter.at Lagerraumanbieter.at Spezialisten Kostenlos Vergleichen
198 Malerkosten.at Gratis angebote malerkosten.at

malerkosten.at Via malerkosten.at können Sie gratis Angebote von professionellen Malereibetrieben für Ihre Malerarbeiten anfordern! ... Maler vergleichen Fordern Sie jetzt kostenlos Angebote für Malereibetriebe an Postleitzahl Privat
malerkosten.at Malerkosten.at Innerhalb Außerhalb Hauses Wärmedämmung
199 Aktuelle Angebote Fa. ImmoEngel Eigentumswohnunge
7000
Eisenstadt
Überblick über die neuesten Angebote der Fa. ImmoEngel in Österreich ... dich selbst und staune! UNSER "OBJEKT DER WOCHE" über uns ... unser Angebot Beratung von Käufer Verkäufer
immobilien-haeuser-wohnungen.at Eigentumswohnungen Mietwohnungen Häuser Grundstücke Büros Hallen Werkstätten Anl
200 Ihr Slogan oder Hinweis

Ihr Slogan oder Hinweis auf Ihre wichtigsten Leistungen und Angebote! ... Ihr Slogan oder Hinweis auf Ihre wichtigsten Leistungen und Angebote! Startseite Video Fotos
mbrcam4you.at
201 Das Angebot

Informationen zum Franchise ...  Das Angebot Franchise Angebot Das Angebot http//www.xn--heim-bro-ca/index.html
xn--heim-bro-c6a.at
202 Angebote im Markplatz Agrarplattform

Hier finden Sie sämtliche Angebote der Agrarplattform Feld Hof ... alleÖsterreichDeutschlandGroßbritannienPolenUngarnItalienWeitere Bundesland alle suchen Marktplatz Angebote gefunden ANFRAGEN ANGEBOTE
feldundhof.at
203 MeinKauf Wien die

Alle Angebote und Prospekte für Wien Einfach im Prospekt stöbern günstige Angebote finden ... Food Optiker Taschen Koffer weitere Services ? voherige weitere ? Aktuelle Prospekte Angebote
meinkauf.at
204 Angebote Aktionen | catering
1030
Wien
Wir sind ein Traditionsunternehmen das für die hohe Qualität seiner Fleisch und Wurstwaren aus ... Direkt zum Inhalt Stanzl-Spezialitäten Angebote Aktionen Aktionen Spezialitäten Wochenmenüplan
stanzl-spezialitaeten.at Catering Angebote Spanferkel Catering Wien
205 Unser Angebot

... ARTS improsant Unser Angebot Aktuell Projekte Über uns Unser Angebot
improsant.at
206 Mein Angebot Klassische

Massagefachinstitut Energetik mobile Massage ... happy way Mein Angebot Preisliste Massage Energetik Kontakt BookShop Bitte aktualisieren
happy-way.at Klassische Massage Fußreflexzonenmassage Bindegewebsmassage Segmentmassage
207 Angebot Susanna

Susanna Grundböck Energetikerin Klangschalenmassage Klangreisen Raindrop Technique Bachblütenessenzen Beratung ...  Angebot Angebot Preise Kontakt Klangschalenmassage Klangreise Raindrop Technique BachblÃ
grundboeck.at Susanna Grundböck Susanne Grundböck Susanna Grundboeck
208 Angebote Aktionen

Angebote Aktionen und Prospekte österreichischen Händler und alle Shopadressen für einen einfachen Preisvergleich. Schnapp ... Angebote schnapp dir dein Schnäppchen auf schnapp Angebote Aktionen Prospekte Preisvergleich
schnapp.at
209 Immobilien Dr. Vospernik Immobilien

Immobilien Dr. Vospernik Wien. Top Angebot der WocheImmobilienvermittlung und Immovilienverwaltung. Mietwohnungen ... Immobiliensuche Such-Agent Service Unser Team Top-Job Links TOP-ANGEBOT DER WOCHE "DIE" Traum
immovos.at Immobilien Mietwohnungen Eigentumswohnungen Häuser
210 Angebote Korrektur

professionelle Unterstützungund Anleitung Lektorat und Korrektorat Friedl Texterstellung TextauszugService Bewerbungscoaching ... . Zusätzliche Angebote schaffen Übersicht Klarheit und Freiräume. Im Lektorat Friedl erhalten
lektorat-friedl.at Korrektur Lektorat Texterstellung Texten
211 ANGEBOT Softwareentwickle

Softwareentwickler Programmierer Freelancer C++ C# VB ASP.net SharePoint 2013 XSL ... ? ANGEBOT ANGEBOT REFERENZEN BLUBLU READER IMPRESSUM Mein Angebot als freier Programmierer
computermeister.at Softwareentwickler Programmierer Kurt Kaeferboeck
212 Mein Angebot lifebalance

... Elisabeth Cäsar Mein Angebot Ihr Nutzen Zur Person Kontakt Ressourcen Mein Angebot
caesar1.at Lifebalance Gesundheit Fitness Burnout
213 Ihr Slogan oder Hinweis

Ihr Slogan oder Hinweis auf Ihre wichtigsten Leistungen und Angebote! ... Ihr Slogan oder Hinweis auf Ihre wichtigsten Leistungen und Angebote! Startseite Willkommen
restaurantprosecco.at
214 Angebote Autovermietung

Billige Mietwagen Sonderangebote ... Angebote Diese Option wird nicht korrekt funktionieren da der aktuell eingesetzte Webbrowser
rentedcar.at Autovermietung Car Rental Prestige Cars
215 Mein Angebot
4840
Pilsbach
... Startseite Biertage Vöcklabruck Mein Angebot Gastronomie! Magazin Termine Hauptmenü Startseite
bierland.at
216 Angebote

... Angebote Qigong Kursdauer/Kosten Anfahrt Über mich Kursbeschreibung Beschreibung der aktuellen
blaubaum.at
217 Aktuelle Angebote + Prospekte

Marktguru: ? Angebote ? Prospekte sowie alle ? Aktionen und ? Flugblätter für den österreichischen ... ? Fertig! Smarttec Angebote .. .. Elektro haas Angebote .. .. Saturn
marktguru.at
218 Angebot

...  Angebot Angebot Über mich Organisatorisches Kontakt Allgemeines Als Arzt für
praxis-renepoeschl.at
219 Aktuelle ImmobilienAngebote Devich Mieten

Mietangebot Angebot Wohnungen Immobilien zu verkaufen zu vermieten Wohnungen ... Navigation überspringen aktuelle Angebote Projekte aktuell Projekte erledigt Referenzen
devich-immobilien.at Mieten Wohnungen Provisionsfrei Wohnungen Wien
220 Angebote TRINITY FÜR KÖRPER, GEIST & SEELE OG Trinity
2630
Ternitz
Trinity Körper Geist Seele Schulungen Schulung Seminare ... Angebote Team Jobsuche Seminare Downloads Partner Kontakt Kontakt Lageplan Newsletter
trinity4success.at Trinity Körper Geist Seele
221 Team Moosdorf Ein
5141
Moosdorf
Ein InformationsAngebot der SPÖ Liste für Moosdorf ... Team Moosdorf Ein Informations-Angebot der SPÖ Liste für Moosdorf SPÖ-Moosdorf Protokolle
team-moosdorf.at
222 Angebot GLÜCKSKIND

Dies ist die Seite von GLÜCKSKIND Sigrid Gleinser Dipl. Mental Intuitions und Bewusstseinstrainerin ... GLÜCKSKIND Sigrid Gleinser Dipl. Intuitions- Bewusstseins- und Mentaltrainerin Info + Angebot
gehinsich.at GLÜCKSKIND Sigrid Gleinser Unternehmensbegleitung USP Mentaltrainerin
223 KISZ Villach :: Allgemeines Villach

Das KinderschutzzentrumDelfi Villach ist eine Anlaufstelle die Kinder Jugendliche Erziehungsberechtigte sowie ... Kontakt Anfahrtsplan UNSERE ANGEBOTE Allgemeines Angebot Für Kids und Jugendliche Für
kisz-villach.at Villach Beratung Elternabend Gewalt Gewaltfreie Erziehung Gruppentherapie Kin
224 KISZ Hermagor :: Allgemeines Hermagor

Das KinderschutzzentrumDelfi Hermagor ist eine Anlaufstelle die Kinder Jugendliche Erziehungsberechtigte sowie ... Kontakt Anfahrtsplan UNSERE ANGEBOTE Allgemeines Angebot Für Kids und Jugendliche Für
kisz-hermagor.at Hermagor Beratung Elternabend Gewalt Gewaltfreie Erziehung Gruppentherapie
225 Startbildschirm German Deutsch Informtaion

Allgemeine Information über unseren hof Und unser Angebot ... gibt es das spezielle Knallerhof - Erlebnisangebot das Nassfeld-plusCard - Angebot und auch das Premium
bio-bauernhof-knaller.at Informtaion Bewertungen Angebote Beschreibung
226 P S X . Domain

PSX.at diese generische Domain wird zum verkauf angeboten. ... PSX Diese premium Domain wird zum Verkauf angeboten Warum PSX All rights reserved Errors
psx.at Domain Name Domainname PSX PlayStation
227 Maxirabatt.at online

Nur die besten Preise und Angebote! ... Rasenmäher mit drei Rädern Nur die besten Angebote % -teiliges Barbecue-Set . ? % Saugfähige
maxirabatt.at Online Kaufen Sparen Angebote Angebot
228 Webhosting Angebote von Webhostern
14532
Stahnsdorf
Webhosting Angebote sollten vor einem Vertragsabschluss umfassend verglichen und geprüft werden. ... online abrufen Webhosting kann im Web . besonders vielseitig ausfallen. Diverse Angebote und Leistungen
1gb.at
229 Angebote der Bahnreisen durch Glacier

Glacier Express Bernina Express Angebote der Bahnreisen durch die Schweiz ... Alpenlandschaft. Auf unseren Internetwebseiten finden Sie zahlreiche Angebote der Bahnrundreisen sowie viele
erlebnisreisen-schweiz.at Glacier Express Bernina Express
230 Startseite :: Diva Hairsalon Hair

Angebote Speziale angebote Gutschein Damenservice und Herrenservice. ... und Partner Angebote  GUTSCHEIN! Diva - Auhofstraße Wien Gutschein als PDF zum speichern
diva-hairsalon.at Hair Diva Gutschein Salon
231 Angebote Rechnungen d2b

Angebote und Rechnungen schreiben Aufträge und Kunden verwalten Registrierkasse zuhause im ... Toggle navigation home testen fürs handwerk preise features software Angebote Rechnungen fürs
design2budget.at D2b Cubiczebra Eibler Business Solutions
232 Renault Neuwagen | RenaultAngebote PKW

Aktuelle Neuwagen und Angebote Ihrer Renault Partner in der PKWKlasse Renault baut die sichersten ... Home Newsletter Kontakt Seite weiterempfehlen Renault Renault Angebote DRIVE THE CHANGE h
renault-angebote.at PKW Neuwagen Nutzfahrzeuge LKW
233 Kurzurlaub.at Österreich Urlaub Kurzurlaub

Kurzurlaub in Österreich! Die schönsten Kurzreisen in ausgesuchten 3* 4* und 5* Hotels in ... Mein Kurzurlaub Gesehene Angebote Gemerkte Angebote Newsletter Anmeldung Gutscheine Wertgutschein bestellen
kurzurlaub.at Kurzurlaub Kurzreisen Wellness Städtereisen
234 BERGSPIRITUALITÄT Berg

Berg Spiritualität Spirituelle Angebote und Berggottesdienste. ... .) Bayern Salzburg-Tirol Spirituelle Angebote Bergexerzitien Spirituelle Bergtour
bergspiritualitaet.at Berg Spiritualität Spirituelle Angebote Berggottesdienste.
235 Lastminute Reise Angebote

Verreisen Sie gemeinsam mit Urlaubsreise24 in interessante Länder reizvolle Ferienregionen erlebnisreiche Städte. Top ... Minute Angebote bei. Wählen Sie einfach Ihr Wunschziel und sichern Sie sich mit einer bequemen Online
urlaubsreise24.at
236 Index  RZOnlinehandel Bei uns Büroartikel

Bei uns finden Sie nicht nur ein umfassendes Angebot preisgünstiger Artikel hier stimmt auch ... EUR {{#.}} {{/.}} Angebote NEU -% Hasbro Play Doh Adventkalender - Knete ... Lieferzeit ca. -
rzonlinehandel.at Büroartikel Büroartikel Büroartikel Online Büroartikel Versand Spielwaren Bruder
237 Ambros Auto Kfz Werkstatt AMA KFZ-Reparatur GmbH Ambros
1210
Wien
Ambros Auto Kfz Werkstatt Wien : Autoreparatur Floridsdorf : Kfz Service : Auto Center : ... Home Über uns Leistungen Team Angebote Werbung Kontakt Karriere Anfahrt Link's Referenzen
kfz-autowerkstatt.at Ambros Auto Kfz Werkstatt Wien : Autoreparatur Floridsdorf
238 Tripbox | Tripbox in

Tripbox in 3 Sätzen: ReiseAngebote dank InsiderInformationen. Individuelle Angebote zu deinem persönlichen Reisewunsch. Flugsuchmaschine in ... Home Die guten Angebote Dein Reisewunsch Flug suchen in Echtzeit Reiselinks Über die Tripbox
tripbox.at
239 Salzburger Thermenland Die Thermen

6 Thermen ein vielfältiges Angebot. Erholung Entspannung Spaß für Groß und Klein ... . Mehr dazu unter . X Willkommen Thermen Karte Kontakt Thermen ein vielfältiges Angebot
salzburgerthermen.at Thermen Salzburg Thermenland Erholung
240 Solarkollektor.at Preisvergleich von solarkollektor.at
3001
KK Rotterdam
solarkollektor.at Sie sind auf der suche nach Solarpanelen? Vergleichen Sie bei uns kostenlos Anbieter und ... Vergleichen Sie Solaranlagen Bis zu Angebote einholen Home Start Suche Bis zu kostenlose Angebote
solarkollektor.at Solarkollektor.at Angebot Vergleichen Kostenlos
241 Solarpanel.at Preisvergleich von solarpanel.at
3001
KK Rotterdam
solarpanel.at Sie sind auf der suche nach Solarpanelen? Vergleichen Sie bei uns kostenlos Anbieter und ... Vergleichen Sie Solaranlagen Bis zu Angebote einholen Home Start Suche Bis zu kostenlose Angebote
solarpanel.at Solarpanel.at Angebot Vergleichen Kostenlos
242 Angebot | Praxisgemeinschaft am Psychotherapie

Angebot an Psychotherapie Supervision und Beratung in 1030 Wien beim Stadtpark durch ein Team ... Psychotherapie Supervision Beratung Angebot Praxis Lage Mag. Markus Huber Psychotherapeut
praxas.at Psychotherapie Supervision Beratung Coaching Wien 1030 Depression Angst
243 BizDrive® Online Zeiterfassung BizDrive

Mit BizDrive erhalten Sie eine webbasierte und einfach zu bedienende Software um Ihre täglichen ... -Deadlines Kunden- und projektbezogene Aufgabenverwaltung Faktura Kassenbuch Angebote und Rechnungen
bizdrive.at BizDrive Cloud Online Zeiterfassung
244 Adrenalin Outdoor Angebote | adrenalin

Bei Adrenalin Outdoor Sports findest du alles: Ob Rafting in Osttirol Paragleiten oder auch ... Anmelden Abmelden Anmelde Formular für Newsletter Software SendBlaster Welcome Adrenalin Outdoor Angebote
adrenalin-canyoning.at Adrenalin Rafting Osttirol Canyoning Osttirol
245 FahrradSchnäppchenOutlet fahrradfinden.at fahrradfinden.at

Die günstigsten Angebote und Fahrradschnäppchen finden Sie jetzt auf fahrradfinden.at dem österreichischen Fahrradoutlet. ... b Elektrobike statt ? . nur ? . zum Angebot Lieferung vor die Haustür Mit unserem
fahrradfinden.at Fahrradfinden.at Fahrrad Outlet Schnäppchen Angebote
246 Hoststar Günstiges Hosting 30000mb

Die Hosting Angebote von Hoststar bieten umfangreiche Profifunktionen zu einem günstigen Pauschalpreis. Beste Performance
cumsinglauda.at 30000mb Hosting Webhosting Webspace Schweiz
247 Wellness Angebote Thermenhotels
6020
Innsbruck
Wellness Angebote und Thermenhotels in Österreich. Thermen Urlaub in den schönsten Wellnesshotels online mit Bestpreis ... Thermen Wellnesshotels Bewertungen Unsere Bestpreisgarantie Aktuelle Angebote Regionen
wellness-angebot.at
248 Rechnungssoftware VerlogRechnungen schreiben rechnungssoftware
4020
Linz
Rechnungsprogramm Verlog ist optisch ansprechende und einfach zu bedienende Rechnungssoftware für kleine und mittlere Unternehmen ... Angebote ... Verlog ist eine moderne und in der Praxis erprobte Rechnungssoftware. Das Herz
algopoint.at Rechnungssoftware Rechnungsprogramm Rechnungen Schreiben Programm
249 Elektriker gesucht? Elektriker Angebote elektriker

Elektriker gesucht? Profi Elektriker finden in der Nähe für Beleuchtung Elektroinstallation oder Elektroarbeiten. Kostenlose ... Elektriker gesucht? Elektriker-Angebote vergleichen sparen! Ständig unter Strom
my-elektriker.at Elektriker Elektroinstallationen Telefonanlagen Alarmanlagen
250 Online Shopping die Mode
8
ist ein großer Schritt für Microsoft. Das neue Betriebssystem soll den Spagat zwischen...
Online Shopping mit besten Angeboten Sales Top Preise Millionen Produkte ... für Sie Ihn Hier werden Ihre Wünsche erfüllt! Ein großes Angebot bei dem das Herz eines Schmuckliebhabers schneller schlägt wartet
gocompare.at Mode Kindermode Uhren Schmuck
251 Möbelspediteure.at Privat | möbelspediteure.a

möbelspediteure.at Privat Vergleichen Sie kostenlos Möbelspediteure in Ihrer Umgebung! Mit nur einer Anfrage bis zu ... Kostenvoranschläge einholen Kostenlos Möbelspediteure vergleichen Bis zu Angebote einholen Home Start Suche
xn--mbelspediteure-vpb.at Möbelspediteure.at Privat Vergleichen Kostenlos Angebote
252 Laktatdiagnostik.at Diese

Diese Domain ist zu kaufen! Angebote richten Sie bitte an office@masterrunning.at ... Laktatdiagnostik Diese Domain ist zu kaufen! Angebote richten Sie bitte an office
laktatdiagnostik.at Diese Domain Ist Zu Kaufen! Angebote Richten Sie
253 Flüge bei Alitravel.at ab flüge

Flüge Low Cost Billigflüge Linienflüge. Buchen Sie Ihren Flug günstig Online mit der ... Nur Hinflug Abflug/ Angebot sehen Barcelona ? Ab Wien Nur Hinflug Abflug/ Angebot
alitravel.at Flüge Flug Fluege Flugangebote
254 Online Shopping die Billiger

Online Shopping mit besten Angeboten Sales Top Preise Millionen Produkte ... im Angebot Entscheiden Sie sich für einen neuen Smart TV und wählen Sie aus dem großen Angebot verschiedener
compareshops.at Billiger Vergleichen Sales Top Preise
255 Last Minute und Reise lami24.de

lami24.de das neue Reiseportal für Ihren Last Minute Urlaub mit vielen Reise ... Kreta ab - Euro Alle Lastminute Reise Angebote Last Minute nur Flugangebote Hin- und Rückflug ab Rom
lami24.at Lami24.de Lastminute Last Minute Pauschalreisen
256 Hoststar Gües Hosting 10000mb

Die Hosting Angebote von Hoststar bieten umfangreiche Profifunktionen zu einem güen Pauschalpreis. Beste Performance
whats-cooking.at 10000mb Hosting Webhosting Webspace Austria
257 Lagerraumvergleich.at Kostenlos Preisangebote lagerraumvergleic
3001
KK Rotterdam
lagerraumvergleich.at Auf der Suche nach einem passenden Lagerraum Spezialisten? Vergleichen Sie bei uns Angebote! ... Vergleichen Sie kostenlos Preise von Lagerraum Spezialisten! Fordern Sie jetzt Angebote an Home Start
lagerraum-vergleich.at Lagerraumvergleich.at Vergleichen Angebote Spezialisten
258 Home Reifen

Reifen Angebote Gablitz ... . Montage und Material Stk. .-- Preise verstehen sich incl. MwSt. !!! LAUFEND NEUE !!! TOP - Angebote
reifen-hotspot.at Reifen Reifenangebote Direkt Angebote
259 Urlaub am Klopeiner See kärnten
9122
St. Kanzian am Klopeiner See
Urlaub in der Region Klopeiner See Südkärnten: Hotels in Südkärnten Pensionen am Klopeiner ... Radreisen Natur aktiv-Betriebe Urlaub am Bauernhof ?? Angebote Regionsangebote weitere Angebote Magische
klopeinersee.at Kärnten Urlaub Ferien Tourismus
260 Home Urlaub Klopeinersee Urlaub

Für ein grenzenlos schönen Urlaub am Klopeiner See schauen Sie unsere aktuelle Angeboten an und ... Home Die Pension Preise Die Umgebung Aktuelle Angebote Im Winter Kontakt Pension Oleander Meinungen
urlaub-klopeinersee.at Urlaub Am Klopeinersee Familienurlaub Alleinreisende
261 Online Shopping mit Shoppen
4912
Neuhofen im Innkreis
Jetzt Preise vergleichen und kräftig sparen ... Sie vergleichen die Preise sowie Produkte der ElektronikBereiche ... ! → jetzt Preise vergleichen und Top-Angebot sichern und bis zu % sparen! - Große Auswahl an GerÃ
okayprice.at Shoppen Vergleichen Angebote Produkte
262 Destinia REISEN ANGEBOTE

Beim OnlineReisebüro Destinia.com bieten wir unseren Kunden die besten Angebote für Hotels Flüge ... "> Wir suchen die besten Flug+Hotel-Angebote. Dieser Prozess kann Minute dauern. Fenster bitte
destinia.at
263 Online Shopping mit Shoppen
4020
Linz
Vergleichen und Sparen ... ... Finanzen DSL Vergleiche Schnellsuche Top Angebote Galaxy Gear... Smartwatch Galaxy Gear green von Samsung
priceme.at Shoppen Vergleichen Angebote Produkte
264 KILLTEC Taubenabwehr Wien KILLTEC Schädlingsbekämpfung GesmbH KILLTEC
1170
Wien
KILLTEC Taubenabwehr Wien : Kammerjäger Niederösterreich : HACCP Burgenland : Insektenvernichter Preis: Schädlingsbekämpfer Kosten:
killtec.at KILLTEC Taubenabwehr Wien : Kammerjäger Niederösterreich :
265 Dachdeckervergleichen.at Preisvergleich von dachdeckerverglei

dachdeckervergleichen.at Sie suchen einen Dachdecker? Vergleichen Sie bei uns kostenlos Angebote und suchen Sie sich ... einholen Vergleichen Sie kostenlos Dachdecker Erfragen Sie Angebote an Home Start Suche Bis zu
dachdecker-vergleichen.at Dachdeckervergleichen.at Kostenlos Angebote Preise
266 Die reise zum ich mich

Home Angebot Über mich Die 3 > ?
monika-aurora-deutsch.at Mich Über Angebot Home
267 Lagerungen.at Vergleichen Sie lagerungen.at
3001
KK Rotterdam
lagerungen.at Vergleichen Sie die Preise verschiedener Anbieter für Lagerungen. Finden Sie so einen geeigneten Lagerraum. ... Sie jetzt einen Anbieter für Lagerungen Vergleichen Sie dafür Angebote von verschiedenen Lagerraum Anbietern Home Start
lagerungen.at Lagerungen.at Raum Anbieter Vergleichen Angebote
268 Willkommen bei Dacia Brigittenau Mario Keller GmbH dacia
1200
Wien
Dacia Brigittenau in 1200 Wien: Dacia Neuwagen Dacia Gebrauchtwagen Service und Angebote in ... Kartenansicht Dacia Neufahrzeuge Angebot Weiterlesen... Copyright Mario Keller GmbH
dacia-brigittenau.at Dacia Dacia 'dacia Duster' 'dacia
269 HeizungsInstallateure.at Heizungsinstallateure vergleichen heizungsinstallat

heizungsInstallateure.at Sie sind auf der Suche nach einem qualifizierten Heizungsinstallateur? Vergleichen Sie bei uns kostenlos ... und unverbindlich Angebote erhalten! Ihre Posleitzahl Bitte auswählen Installation einer neuen Heizung Reparatur
heizungs-installateure.at Heizungsinstallateure.at Vergleichen Kostenlos Unverbindlich Heizungsinstalla
270 GALAnet angebote salzburg

Salzburg Hallein Galanet Webdesign die guenstige Vereinigung von Quantitaet und Qualitaet
galanet.at Salzburg Vigaun Hallein GALAnet Kanzleizentrum
271 Malerbetriebe.at Malerbetrieb in malerbetriebe.at

malerbetriebe.at Malerbetrieb in Ihrer Nähe? Malerbetrieb Kosteb vergleichen. Bis zu 6 Angebote für Malerarbeiten ... bei malerbetriebe Via malerbetriebe können Sie ganz einfach Angebote von Malereibetriebe in Ihrer Nähe anfordern
malerbetriebe.at Malerbetriebe.at Malerbetriebe Angebote Malerbetrieb Malerarbeiten
272 Plusregion Köstendorf Vivid Planet Software GmbH strasswalchen
5302
Henndorf a. Wallersee
Die Plusregion mit den Mitgliedsgemeinden Straßwalchen Neumarkt und Köstendorf bietet ein Firmenverzeichnis aktuelle ... in der Plusregion Veranstaltungen Angebote Menüplaner WEIHNACHTSGEWINNSPIEL Fotos Videos Immobilienangebote
plusregion.at Strasswalchen Köstendorf Neumarkt Am Wallersee
273 Edelstein OnlineShop OnlineShop
1010
Wien
OnlineAngebot hochwertig geschliffener Farbsteine aus aller Welt ... Sie einen repräsentativen Auszug unseres Angebotes hochwertiger Edelsteine in Standard- und Designerschliffen aus aller Welt
edelsteinboerse.at OnlineShop OnlineAngebot OnlineSortiment Farbsteine
274 Autolackierer LKW NFZ Smartrepair autolackierer
47623
Kevelaer
Finden Sie Autolackierer in Ihrer Region und lassen sich ein gratis Angebot erstellen. Lackierer für ... Unternehmen in Ihrer Region Erhalten Sie kostenlos Angebote und wählen selbst aus den Leistungen. Baden-WÃ
lkw-lackierer.at Autolackierer Pkw Lkw Smart
275 Angebot Familienurlaub Ko Familienurlaub

Urlaub in Thailand geplant? Unser erstklassiges Angebot für Ihren Familienurlaub in Ko Samui erwartet Sie! ... Wettervorhersage Telefon + Angebot Buy Fly Kontakt Anfrage http//static.clearsense
reisebuero-flughafen-wien.at Familienurlaub Ko Samui Familienurlaub Thailand
276 Eine Seite für die junge

Eine Seite für die junge Familie. Tipps und Angebote für Eltern. Von Erziehungstips Beziehungstrips ... Taufe Erstkommunion Firmung Hochzeit Glaube Kindergottesdienst Angebote Unterstützung Familienberatung
meinefamilie.at Junge Familie Familie Kinder Tipp
277 Wellness Guide | Dein WellnessGuide.at

Wellness Guide.at ist Dein Führer in die Welt des besonderen. Lerne die besten und schönsten ... Error Page Top Angebote Default Green Orange Blue Deep Ocean More Styles Gutscheine Portfolio One Column
wellness-guide.at WellnessGuide.at Wellness Angebote Österreich
278 Thermenland Österreich Informationen Thermenland

Die Thermalbäder im Thermenland Österreich bieten Wellnessurlaub und Thermenurlaub mit günstigen Angeboten in ausgesuchten Wellnesshotels ... - österreichische TOP-Qualität mit günstigen Angeboten ... ? Thermen in Ungarn ? Thermen in Slowenien ? Thermenblog
thermenland-oesterreich.at Thermenland Wellnessurlaub Thermalbäder Österreich Günstige Angebote
279 Neue Angebote

... In kürze finden Sie hier neue Angebote. Aktuelle Angebote finden Sie auf www.sparreisen .
sparreisen.at
280 Angebote Haiderer Wasserbetten Türen RWM Wasserbetten GmbH Wasserbetten
3071
Böheimkirchen
Ihr Fachbetrieb Haiderer in St. Pölten sorgt mit seinem Angebot von Wasserbetten Türen ... Navigation überspringen Meine Angebote Über mich So finden Sie uns Zulieferer Kontakt
angebote-haiderer.at Wasserbetten Fachmann Spezialist Guter Schlaf
281 Umzug.co.at Umzugsfirmen vergleichen! umzug.co.at

umzug.co.at Vergleichen Sie Dienste und Preise verschiedener Umzugsfirmen in Ihrer Umgebung. Forden Sie bis zu ... in Ihrer Umgebung! Fordern Sie kostenlos bis zu Angebote an. Home Start Suche Bis zu kostenlose Angebote
umzug.co.at Umzug.co.at Umzugsfirmen Dienste Preise Vergleichen
282 Willkommen! st.a.r.-systems gmbh fensterangebot
9020
Klagenfurt am Wörthersee
fensterangebot fenster Türen Angebote Planung Software Statistik Einkauf ... + - = +/- Willkommen! PRODUKTE FÜR HÄNDLER ANGEBOT AUFTRAG PLANUNG STATISTIK WARENLAGER SERVICE
fensterangebot.at Fensterangebot Fenster Türen Angebote
283 HIGH Five Imst:
6460
Imst
Hier finden Sie aktuelle Angebote Sonderangebote und News zu unserem Shop.
highfive.at
284 Aktuelle Angebote Bluemax OG Günstig
3400
Klosterneuburg
Bluesale jeden Tag ein einzigartig günstiger Elektronik Deal ... Username Passwort Jetzt registrieren! Passwort vergessen? aktuelle Angebote abgelaufene Angebote
bluesale.at Günstig Einkaufen Elektronik Günstig Deal
285 Klikovitz Angebot

Angebot Steuerberatung Arbeitnehmerveranlagung
klikovitz.at Angebot Steuerberatung Arbeitnehmerveranlagung Buchhaltung
286 Umzugknittelfeld.at Knittelfeld | umzugknittelfeld.

umzugknittelfeld.at PLZ 87 Leoben Knittelfeld Trofaiach Steiermark Umziehen in Knittelfeld? Vergleichen Sie kostenlos ... ? Auf umzug-knittelfeld können Sie einfach gratis und unverbindlich Angebote von Umzugsfirmen
umzug-knittelfeld.at Umzugknittelfeld.at Plz 87 Leoben Knittelfeld Trofaiach
287 Home: MUB Salzburg Salzburg

Das Projekt sammelt Anfragen und Angebote zu Musikunterricht in einer Börse. Dieser Service ist kostenlos. ... Zur Navigation springen . Zum Content springen . Login Home Angebote Gesuche Merkzettel Login
mub-salzburg.at Salzburg Musik Unterricht Börse
288 Home: MUB Tirol Tirol

Das Projekt sammelt Anfragen und Angebote zu Musikunterricht in einer Börse. Dieser Service ist kostenlos. ... Zur Navigation springen . Zum Content springen . Login Home Angebote Gesuche Stellenangebote
mub-tirol.at Tirol Musik Unterricht Börse
289 Stimmbildung Mein Angebot Dienstleistung

Platz für Ihren Slogan ... Stimmbildung Brigitte Poschner-Klebel Mein Angebot für Sie Über mich Preise Hörbeispiele Fotos
stimmeundgesang.at Dienstleistung Stimme Gesang Stimmbildung In
290 Dachbeschichtungen Dachbeschichtung GmbH & Co. KG Dachbeschichtunge
74564
Crailsheim
Dachreinigung Dachsanierung Kosten Dachbeschichtung Preise Wir sind für Sie bundeweit tätig und ... Die Firma Leistungen Angebote Arbeitsablauf Referenzen Aktuelles Kontakt Aktuelles Angebot
dachsanierung-knodel.at Dachbeschichtungen Dachbeschichtung Dachreinigung Dachbeschichtung Kosten
291 LogoDesign Angebot
4600
Wels
... Unternehmen Unternehmen Team Unser Angebot Unser Angebot Kontakt Kontakt Referenzen Referenzen
logodesign-schmuck.at
292 KILLTEC Ungeziefer Wien KILLTEC Schädlingsbekämpfung GesmbH KILLTEC
1170
Wien
KILLTEC Ungeziefer Wien : Ungezieferbekämpfung Niederösterreich : Ungezieferbefall Burgenland : Ungeziefer identifizieren Preis :
ungeziefer.at KILLTEC Ungeziefer Wien : Ungezieferbekämpfung Niederösterreich :
293 Nauders Info Information Zimmer Nauders

Nauders Info Information Zimmer Hotel Pension Ferienwohnung Appartement Wellness Familien Kinder Mountainbike Motorrad Wandern Last
nauders-info.at Nauders Info Information Zimmer
294 Aktuelle Angebote Elektro Hofmann GmbH
5541
Altenmarkt i. Pg.
... Aktuelle Angebote Leistungen Installation Leistungen Handel Fotoausarbeitung Kontakt Aktuelle
traumankerstrategie.at
295 Kunst+kunstherapie+raum home kunsttherapeutisc

Kontakt Sponsoring kunsttherapeutisches Angebot Steiermark Graz Kunsttherapie ... mit uns interessiert sind spenden möchten Interesse an der Entwicklung kunsttherapeutischer Angebote für Ihre Firmen
kunsttherapie1.at Kunsttherapeutisches Angebot Aktivitäten Kunst+kunsttherapie+raum Verein
296 Startseite Wanderungen

Geführte Wanderungen mit Betty Jehle aus Gosau. Wanderungen im Gosaukamm Angebote für Sportwochen von ... Angebote gemacht werden. Themenwünsche wie es bei Projektwochen oft der Fall ist können ohne weiteres
betty-jehle.at Wanderungen Gosau Wanderungen Gosaukamm Angebote Für
297 Angebot ? www.jarosoft.at

... Quality Software Engineering Menü Angebot Profil Referenzen Kontakt verbergen Wir realisieren
jarosoft.at
298 Ferienfabrik Angebote Lastminute Ferienfabrik

Egal ob Strandurlaub Städtereise Flugreise Kreuzfahrt oder Lastminute Urlaub auf Ferienfabrik.de findet ... LeoneSimbabweSingapurSizilienSkiathos Skopelos SkyrosSlavonienSlowakeiSlowenien Inlandslowenische AdriaSomaliasonstige Angebote
ferien-fabrik.at Ferienfabrik Urlaub Reisen Günstig
299 EigenART Angebot eigenart.at

Jedes Kind das auf die Welt kommt kennt keine Vorurteile und macht seine ... neuARTiges Unsere eigenART Angebot Schauspiel Atem-Stimme-Sprache Fort- und Weiterbildung Projekte
eigen-art.at Eigenart.at Eigenart EigenART Eigen
300 CruiseCenter Kreuzfahrten CruiseCenter

Ihr Spezialist für weltweite Kreuzfahrten. Wir sind neutral und unabhängig und offerieren Ihnen ausgewählte Kreuzfahrtenangebote ... Suchen Erweiterte Suche EXCLUSIV FÜR SIE JOKER ANGEBOTE Sie sind flexibel und möchten viel sehen
cruisecenter.at CruiseCenter Weltweite Kreuzfahrten Kreuzfahrt Angebote
301 Neueste Angebote
1030
Wien
... Neueste Angebote Über euroworld.at Neueste Angebote Neueste Angebote Über euroworld
euroworld24.at
302 Urlaub mit Schauinsland schauinsland-reisen gmbh Reisen
47051
Duisburg
Urlaub mit SchauinslandReisen Lastminute Pauschal nur Hotel oder Flug Angebote ... schließenSie haben Fragen oder benötigen Unterstützung ? Wir beraten Sie gerne! Angebote per Mail
joy-hotels.at Reisen Urlaub Schauinsland Angebote Hotel Flug Pauschal Lastminute

Angebot Awesome Freefont Wien Bewertung:

Die Öffnungszeiten können zu Feiertagen Pfingsten, Fronleichnam, Reformationstag und Allerheiligen abweichen.
Ergebnisse der Auswertung: 142 Bewertungen ergeben 3 StadtBranche Punkte

Neuer Eintrag 

Angebot, österr. auch Anbot, steht für: Angebot Öffnungszeit und Erfahrungen
Tipps & Tricks für Arbeit & Leben:




△ nach oben kostenfreier Eintrag Datenschutz