optional Stadt:
Österreich ›

Verpackungen › Verpackungsmaterial Markt Hartmannsdorf

Verpackungen

Verpackungen Verpackungen Öffnungszeiten Verpackungsmaterial

GKE

Verpackungen
Verpackungsmaterial
Wir, die GKE GmbH, sind ein Großhandelsunternehmen
aus Markt Hartmannsdorf im Bezirk
Weiz, dass sich auf Verpackungslösungen spezialisiert
hat. Unsere Kernkompetenzen umfassen den Bereich
von Glasflaschen jeglicher Art, Kartons aller Größen,
Formen und die Erstellung von Etiketten in Klein- und
Großmengen.Aber auch wenn es um das Gestalten von
Logos, Visitenkarten oder Onlinemarketing geht, beraten
Sie die Experten der GKE. Wir verpacken Ihre Produkte
nicht nur, wir helfen Ihnen auch ihren Umsatz zu steigern!
Da wir selbst als regionales Unternehmen gestartet
sind, möchten wir auch kleineren Betrieben eine Chance
geben durch ein gutes Preis-Leistungsverhältnis durchzustarten.
Da Ihre Verpackungsprodukte jederzeit bei uns
abholbereit sind, ist die Verfügbarkeit immer gegeben.
Dabei ist ganz gleich ob Sie von uns kleine oder große
Mengen bei GKE kaufen – auf jeden Fall kaufen Sie Erfahrung.
Sie, als Kunde, profitieren nicht nur von Innovation
sondern auch vom richtigen Gemisch aus Direkter Beratung
vor Ort und Online Shopping. Das Team der GKE
GmbH ist bunt gemischt mit Profis aus den unterschiedlichsten
Bereichen.
Bestellen sie jetzt Ihre Verpackung!
Kontaktieren Sie uns jetzt unter Tel. 0676/843404404
oder office@gke-verpackungen.at. Sie können uns auch
direkt besuchen: Industriegasse 14 & 15, 8311 Markt
Hartmannsdorf. www.gke-verpackungen.at

www.gke-verpackungen.at


Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

Pinnwand Pinnwand: Beiträge & Erfahrungen Produkte

Beitrag Beitrag oder Bewertung schreiben Frage Frage schreiben

Öffnungszeiten

Öffnungszeiten für Verpackungen:
Montag-Freitag von 7:30 - 17 Uhr
Stand

Erfahrungen

StadtBranche.at GKE gke-verpackungen.at Wertung vom 2019-02-11:
5 StadtBranche.at Punkte
(Anzahl Besucher)
https://stadtbranche.at/eintrag/7957.jpg

Adresse Adresse Commercial Ztl

Webseite
Name
Verpackungen
StrasseIndustriegasse 14+15 « Karte
Postleitzahl8311  
OrtMarkt Hartmannsdorf  
UmkreisMarkt Hartmannsdorf  
BrancheVerpackungsmaterial in Markt Hartmannsdorf
RegionSteiermark  
Telefon0676/843404404  



Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:


Verpackungsmaterial Produkte Commercial Ztl Basic Kartons Etiketten Verpackungen Glasflaschen Suche Bäckereien Holzkisten Korbwaren Metzgereien Obstbauer Selbstvermarkter

Beste Einträge zu Verpackungsmaterial sowie Produkte und Commercial

1 Verpackungen Verpackungsmaterial
8311
Markt Hartmannsdorf
Wir, die GKE GmbH, sind ein Großhandelsunternehmen aus Markt Hartmannsdorf im Bezirk Weiz, dass sich auf Verpackungslösungen spezialisiert hat. Unsere Kernkompetenzen umfassen den..
gke-verpackungen.at Produkte Commercial Ztl Basic Kartons Etiketten Verpackungen Glasflaschen Suche Bäckereien Holzkisten Korbwaren Metzgereien Obstbauer Selbstvermarkter
2 Zaruba Verpackungsmaterial
5020
Salzburg
Verpackungsmaterial ist untrennbar mit der Geschichte der Menschheit verbunden, da man von Anfang an nach Möglichkeiten zum Einpacken suchte. Der..
zaruba.eu/ Umreifungsgerät Kunststoffband Kunststoff Behälter Onlineshop Stahlband Verpackungsmaterial Zaruba Verbrauchsmaterial Anfrage Förderpumpen Verpackung Selbstklebebänder Produkte Unternehmen Handpumpen Kleingebinde Heftklammern Italien
3 bienz:photography Fotograf Fotostudio
8640
Rapperswil
Seit über 16 Jahren fotografiere ich aus und vorallem mit Leidenschaft. Meine Ausbildung und Diplom habe ich an der advanced..
bienz-photography.ch Still Stefan Bienz Hochzeiten Life Commercial Rapperswil Fotostudio Fotograf Foodfotografie Werbung People Architekturfotografie Produktfotografie Fotoshooting Preise
4 Fotograf Winterthur Christian Ruosch Fotograf
8400
Winterthur
Sie wollen Ihre Firmen Identität sichtbar machen? Dann lassen Sie sich von mir helfen! Was auch immer Sie ins rechte..
photoruosch.ch Geschäftskunden Privatkunden Fotograf Studio Portrait Fashion Business Interieur Fotoshooting Commercial Fotostudio Corporate Zürich Mich Mitarbeiterportraits Christian
5 Umzugsprofis aus der Schweiz Umzug
8952
Schlieren
acespedition.ch/ Speditions Umzug Umzüge Lagerlogistik Umzugspartner Umzugsprofi Int Blog Transportenbis Lösungen Internationale Sitzin Stärken Jahren Vip Privatumzüge Umzüge Ace Commercial
6 umzugskraft Transport und
1160
Wien
Umzug Wien, Übersiedlung, Räumung, Entsorgung, Entrümpelung, Transporte, neue Wohnung, neues Heim, neues Haus, Möbelpacker, Umzugskraft, Umzug, Lieferung, Wiener Möbelpacker, Kleintransporte,..
umzugskraft.at Wien Umzug Verpackungsmaterial Anfrageformular Firmenumzug Nachrichten Blog International Dienste Entsorgung Umzugskraft Titel Mbel Italien Gewnschter Rckruf Kche
7 Alexander Keller AG Umzug &
8952
Schlieren
Alexander Keller AG steht für professionelle Umsetzung im Bereich Umzug, Transport und Logistik. Des Weiteren sind wir spezialisiert auf Spedition..
alexanderkeller.ch/ Umzug Logistik Offerte Lager Privatumzug Keller Alexander Firmenumzug Zürich Transporte Schweiz Region Edv Full Partner Checkliste Anderes Setzen Verpackungsmaterial
8 Loogo Umzüge Österreich Umzüge
5400
Hallein
Mit LOOGO sparen Sie Zeit und Nerven. Überlassen Sie Ihren Umzug den Profis von LOOGO! Profitieren Sie von unserer Organisation und..
loogo.at Umzug Möbel Kartons Möbelküche * + Umzugsunternehmen Privatumzug Angebot Firmenumzug Verpackungsmaterial * Umzüge Loogo Kartons * Lkw * Internationaler Neumöbel Abholung Karton Rechner Demokratischevolksrepublikkorearepublikkroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmauretanienmauritiusmazedonienmexikomikronesienmoldawienmonacomongoleimontenegromosambikmyanmarnamibianaurunepalneuseelandnicaraguaniederlandenigernigerianiuenorwegenösterreichomanosttimorpakistanpalästinensischeautonomiegebie
9 Hauruck Umzug - Räumungen TRANSPORT
1100
Wien
Umzug Wien, Übersiedlungen Wien, Umzug im Ausland, Übersiedlungen im Ausland, Räumungen und Entrümpelungen, Übersiedlumg, Räumung Transport mit LKW, Hauruck so..
hauruck.at Wien Räumungen Entrümpelungen Einholen Kosten Entrümpelung Hauruckat Angebot Räumung Keine Verpackungsmaterial Wochenendservice Aufpreis Leistungen |
10 Verpackungsmaterial, Umzugskarton Verpackung

Im Onlineshop dieverpackung.com können Sie Verpackung in jeder Form bestellen, Verpackungsmaterial für Ihre Umzüge oder alles, was Sie im Geschäft..
dieverpackung.com Umzugskartons Verpackung Ordner Etiketten Bürobedarf Klebebänder Verpackungsmaterial Luftpolsterfolie Büroartikel Umzugskarton Folien Versandtaschen Umzug Verpackungen Beutel Eur Exkl Schilder Büromaterial Aufkleber Schneidegeräte
11 Naturkosmetik Fesche Gretl – Naturkosmetik
4048
Puchenau
Almkosmetik GmbH Naturkosmetik Fesche Gretl Mit Pflanzenwirkstoffen aus kontrolliert biologischem Anbau! Beziehe unsere Naturkosmetik-Produkte einfach über unseren Online-Shop, wir liefern nach Österreich..
feschegretl.at österreich Gretl Fesche Naturkosmetik Produkte + Office@almkosmetikat überzeugen Hergestellt Produziert Unparfümiertenhochwertiger Z
12 Reparatur Wartung Ihrer Storen Handwerk
4153
Reinach
Wir reparieren ihre defekten Lamellenstoren, Rollläden, Sonnenstoren u.v.m zu sensationiellen Preisen. Unsere Serviceleistungen: Beratung und Verkauf -Reparaturen -Wartung -Neumontage -Automatisierung -Stoffersatz..
rio-storen.ch/ Joomla Wilkommen Designwartung Portal Management Wintergartenbeschattungen Größen Dynamicsonnenstoren Produkte Engine Terrassen
13 Fahrradzubehör Sportartikel
6850
Dornbirn
HiLo sports stellt Fahrradzubehör mit Leidenschaft her. Überzeuge dich selbst in unserem Online Shop. Darüberhinaus gibt es hilfreiche gratis Informationen rund um..
hilosports.de Hi Fahrradzubehör Leidenschaft Produkte You Instagram Shopify Verpackung Know Schließen Facebook Blog Leitbild How Shopifyshop
14 AIOH - All In AuraSprays &
5440
Golling
AIOH ist eine Essenzen Manufaktur in Salzburg, die seit 2006 feinstofflich energetisierte Essenzen und AuraEssenzen (AuraSprays) in Handarbeit produziert..
aioh.at Disabled Activated Down Inline Essenzen Aura All Heureka One Herz Serie Trilogie Produkte Lichtfarben Salzburg
15 Ihre Homepage von Profis Werbeagentur und
5020
Salzburg
salzburgSOFTWARE bietet professionelle Homepages, Marketing und Training. Innovation durch Information. Mehrwert durch Wissen, Kreativität und Talent...
salzburg.software Webshop  » Domain Informationen Hosting Marketing Beratung Firma Support Produkte Cloud Homepageblog Menü
16 Body Sugaring Enthaarung
8400
Winterthur
Überlegen sanft und ohne Hautirritationen für (fast) alle Körperregionen, bei Mann und Frau. Entdecke diese tolle Enthaarungsmethode und erlebe wie die..
zuckereggae.ch Haarentfernung Shaba Zuckereggä Produkte Deacuteesse Brazilian Wo Biologische Deessechtricks Co Enthaarung Email Epilation
17 ankauf von verlassenschaft Räumung Entrümpelung
1160
Wien-Umgebung
Ankauf von Verlassenschaften und Antiquitäten Räumungen Ankäufe kompletter Nachlässe, Sammlungen, Bilder, Möbel. AntIquitäten und Antiquariat Gold , Schmuck und Silber Besteck Porzellan Gemälde Kauf kompletter Nachlässe Auch wenn..
verlassenschaften-wien.at Klick Shop Webseite Jimdo Pageseinfach Design Schief Etwas Produkte Webseiten Baukasten Präsenz Spaßmacht
18 HORISEN AG Werbeagentur
9400
Rorschach
Full-Service-Agentur mit Weitsicht: Marketing, Werbung, Social Media, Webdesign, Hosting, Branding, Corporate Identity und vieles mehr!..
horisen.ch Horisen Marketing Deinem Dienstleistungen Digitale Cloud Produkte Basierende Bietet Technologie Unternehmentechnology Helfen Sowohl
19 Him+ Fenster und Türen Bauwesen
5236
Remigen
Him+ ist ihr Ansprechpartner für professionelle und kundenorientierte Altbausanierungen und Montagen von Fenstern und Türen. Den Einsatz der Materialien wie..
himplus.ch Neubau Literatur Produkte Partner Firma Altbau Leestrasse Schiefer Him+einsatz Montagen Kunststoff Altbausanierungen Granit
20 welcome-tec Software
55411
Bingen am Rhein
Für Ihre Besucher bietet welcome-tec eine herausragende digitale Begrüßung mit Auskunft, und dies schon seit 2004. Als virtueller Begrüßer beantworten..
welcome-tec.de Helvetica My Arial Software Komplett Begrüßung Neue Times New Mitarbeiter Sets Digitale Digital Gehäuse Produkte

Häufige Verpackungsmaterial Suchbegriffe Produkte

Weinbauer Tragetaschen Gastronomie Fleischpapier Brauereien Einmachgläser Ergebnisse Gmb Einkaufswagen Blockbodenbeutel Instagram Vakuumbeutel Imkereien Maschinen Uns Google Facebook Pinterest Einmachgläsern Suchbegriff Treffer Ergebnis Sign Service Adresse Verpackung Flaschen Qualität Esc Drucktechnik Suchen Kontakt Verschlüsse Einloggen Schließen Branchen Verschlüssen Shopify Rounded Nutzungsgrenze App Berechtigungen Erstellen Konto Maps Problem Paket Betrachten Speichern Industriegasse Keine Ihr Imkerei Industrie Logistik Thema Individualität Verpackungsmanufaktur Beratung Hier Markt Kategorie Anzahl Ausverkauft Declare Kasse Bezahlung Steuern Versandkosten Rabattcodes Zwischensumme Abonnieren Soft Mailingliste Melden Subscribe Lager Richtungen Fr Mon Steiermark Hartmannsdorf Persönliche Live Support Arrayprototypeslicecallarguments Seitennavigation Shopifytheme Geräte Jan Vakuumbeuteln Shopifythemehandle Blockbodenbeuteln Shopifythemestyle Bwi Trekkie Shopifyshop Performance Analytics Session Attribution Customer Pricing Direkt Inhalt

Verpackungen Öffnungszeit Commercial Ztl

Verpackungen Öffnungszeiten: Montag-Freitag von 7:30 - 17 Uhr - Die Verpackungen Öffnungszeiten Markt Hartmannsdorf können zu Feiertagen wie Pfingsten, Fronleichnam, Reformationstag und Allerheiligen abweichen. Wir empfehlen, sich vorher zu informieren, ob es sich um ein lokales Verpackungsmaterial Markt Hartmannsdorf Geschäft handelt. Bei Änderungswünschen zu Erfahrungen und Produkte Test Bewertung und Erfahrungsbericht von Verpackungen Industriegasse 14+15 Markt Hartmannsdorf senden Sie uns eine E-Mail.

△ nach oben kostenfreier Eintrag Datenschutz