optional Stadt:
Webseiten Österreich ›

Galerie

Galerie Österreich


Google Anzeige:

Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 Flughafentaxi Wien Flughafentaxi Flughafentransfer
1100
Wien
Mit dem Flughafentaxi zum Wiener Flughafen oder vom Flughafen nach Wien, Wien Umgebung und Niederösterreich fahren. Der Wiener Flughafentaxi Service bietet...
wienerflughafentaxi.at Taxi Wien Flughafen | Flughafentaxi € Bestellen Webseite Galerie Anfahrt Fixpreis Autoklassen Angebote ✈ Günstig
2 Künstlerische Fotografie Fotografie
3100
3100 St. Pölten
Meine bevorzugten Themen sind Porträt-Fotografie, Spirituelles, Natur-und Makrofotografie, People/Children-Fotografie, Experimente, Impressionen, Fotoreisen. ​Seit 6 Jahren leite ich Foto-Workshops für Jugendliche an...
jaeggi-fotoart.com Fotografie Workshops Experimente Foto Children Spirituelles People Waldviertel Nude Impressionen Reisen Galerie News Nordalbanien Ua Hin Landschafts Erstreckt
3 Nature Adventure - Canyoning Outdoorsport
6652
Elbigenalp
Wir bieten geführte Outdoorsporttouren an und haben uns auf Canyoning, Rafting und Mountainbike spezialisiert. Zu Hause im Tiroler Lechtal, einer...
nature-adventure.at Canyoning Rafting Nature Adventure Lechtal Lech Programm Neuigkeiten Specials Tirol Galerie Bike Video Touren Mountain
4 DESIGN & FOTO cornelefant Grafikdesignerin &
8510
Stainz
Fotografin für Business- und Eventfotografie und entwickle als Grafikdesignerin Corporate Designs (Logo-, Drucksorten-, Website- und Werbematerialgestaltung), sowie Illustrationen und Mockups...
cornelefant.at Design Foto Galerie Fotografie Booth Corporate Photo Portrait Website Menschen Grafikdesign Grafikdesignerin Montage Info To
5 87xpictures - Hochzeitsfotograf Fotograf
2700
Wiener Neustadt
Hochzeitsfotografie... Diesen Moment mit euch zu teilen ist für jeden Hochzeitsfotografen eine große Ehre! Alle Emotionen, Freudentränen und Eindrücke von diesem Tag festzuhalten...
87xpictures.at Auge Preis Fotograf Wiener Neustadt Hochzeit Hochzeitsfotograf Hochzeitsfotografie Fahrzeuge Galerie Firmen Hochzeitsfotos Video Familie Xpictures Moment Erkennenein Timing Analysen
6 Hundepension und Hundesalon Hundepension
2201
Seyring
Hundehausen ist eine Hundepension mit hauseigenem Hundesalon. Wir betreuen Ihren Hund untertags, über das Wochenende, oder während Sie auf Urlaub...
hundehausen.at Hund Hundepension Hundesalon Liebling Hundehausen Hunde Bedrfnisse Leben Urlaub Spezialtarife Agbs Galerie Mich Betreuung Grund Formulare Philosophie Preise
7 Weinbau Lozka-Werderits Weinbaubetrieb
7473
Hannersdorf
weinbau-lozka.at Werderits Erich Anni Weinbau Rheinriesling Lozka Weingut Blaufränkisch Galerie Grüner Weinbaubetrieb Weine Hannersdorf Pinot Veltliner Lozka * Familie
8 Kunst Belebt Kunsttherapie e.U. Kunst Belebt Kunsttherapie e.U. Kunsttherapie Gesundheit
2500
Baden
Blockaden lösen, Traumata verarbeiten, Perspektiven finden, Ressourcen entdecken: Die Kunsttherapie wird in klinischen, pädagogischen, heilpädagogischen oder soziokulturellen Bereichen ausgeübt, also in...
kunst-belebt.at Kunsttherapie Kunst Belebt Ressourcen Webkatalog Perspektiven Wege Traumata Praxis Gestaltungsprozesse Room Strken Schulen Beispiele+methoden Behindertenhilfe Dennstedt Einrichtungen Gibt Galerie Krisen
9 Fertighäusern Angebot Holzbauhaus
310504
Romania - Arad
Wir sind die Firma "SC. HOLZ HAUS CONSTRUCTION SRL" – ein rumänischer Hersteller von Fertighäusern in Holzrahmen. ...
holzhauseco.com Schillingsfürst Ulm Galerie Bungalow Neu Materialien Hersteller Holz Mauerarbeiten Rumänischer Musterhaus Produktion Preis Haus Uns
10 Kunsthandel Seitz Kunsthandel
4020
Linz
In unserem Geschäft finden Sie auf 80m² museale Aquarelle, Ölgemälde und Grafiken des 19. Jhdt; der klassischen Moderne und der...
kunsthandel-seitz.at [ ] Ankauf Galerie Mã–bel Seitz Kunsthandel Künstler Seitzat Uhr Gerne Gemälden Messen Rahmungen Wirberaten Website
11 Nicis Haarsalon Friseur Friseursalon
4850
Timelkam
Suchen Sie einen Friseur im Bezirk Vöcklabruck? Nicis Haarsalon ist ein neu eröffnetes Friseurstudio in Timelkam. Ich freue mich auf...
nicis-haarsalon.at/ Gampern Timelkam Frisör Nicis Galerie Anfahrt Dienstleistungen Haarsalon Neueröffnung ã–ffnungszeiten Nici Wenige Neuerã–ffnungentfernt Damen Für
12 Drechselkurse Kunstdrechseln
4464
Kleinreifling
Drechselkurse für Anfänger Drechselkurse für Fortgeschrittene...
creationschnauer.at Schnauer Galerie Kurse Drechseln Carl Ausstellungen Objekte Unser News Shop Lernen Meditation Kunstdrechseln Mich La Handwerkskunst
13 Carwrapping Carwrapping Folierung
8055
GRAZ
Folientechnik,Carwrapping, Fahrzeugbeschriftung, Digitaldruck, Folien, Sonnenschutz, Steinschlagschutz, Lackschutz, Beschriftungen, Vollfolierung, Teilfolierung,...
schusterpromotion.com Neu  Produkte Kontaktformular Galerie Carwrapping Vorteile News Referenzbilder Werbung Galerie  Staubfreien Mein Besuch M  * Einfach
14 STEIN:WERK Steinbearbeitung Kunst
5166
Perwang am Grabensee
Als Tischler habe ich mich von dem Werkstoff Stein fesseln lassen und schafft mit meinem 2012 gegründetem Einzelunternehmen Werke...
stein-werk.at Steinwerk Werk Stein Archiv Ergebnis Shop Agb Vollendung Steinschlag Heinz Dekowerk Weine Presse Quellsteine Tätigkeit Steinwerker Download Feuerwerk Galerie Pinggau Holz
15 Schwimmkurse und Training Sport Schwimmen

Wien
Finswimming SpeedFish ist ein Verein hauptsächlich für Kinder und Jugendliche. Wir bieten Schwimm- und Flossenschwimmtraining für alle Leistungsstufen an. Vom Anfängerschwimmkurs...
speedfish.at Speedfish Schwimmen Wasser Scroll Flossenschwimmen Team Speed Galerie Gummiflossen News Spaß Jahren Kraul Name Blog
16 Art On Screen - Kunst- und
1030
Wien
Ihr Kunst-Navigator für die wichtigsten Ausstellungen, die schönsten Museen und Galerien in Österreich, Deutschland und der Schweiz. Art On Screen -...
artonscreen.at | aos-magazine.com Kunst Relations Investor Kultur Bono Contact Art Galerie Peter Screen Cooperations Performing Spiritual Förderung Sponsor Redakteurin Artist Department Partner_  _ _
17 Johann Zugschwert Berufsfotograf
8010
Graz
Pressefotografie und allgemeine Fotografie, Landschafts- und Reisefotografie, freier journalistischer Mitarbeiter bei Kleine Zeitung...
zugschwert.at Posted Galerie Photos Zugschwert Johann Continue Allgemein Older Piloten Toblach Dolomiti Natur Ballonfahrten Mitglied Bennett Larr Air Gewo
18 Messe Dornbirn Messeveranstalter
6854
Dornbirn
Messe Dornbirn - „Märkte live erleben“ Die Messe Dornbirn veranstaltet Publikums-, Fach- sowie Special Interest-Messen und vermietet ihre Infrastruktur ganzjährig...
messedornbirn.at Messe Dornbirn Bodensee Informationen Herbstmesse Intertech Frühjahrsmesse Gt Besucher Aussteller Ausstellern Dornbirner Schau Pressemeldung Gustav Hightech Foto Galerie Hocheffizientes
19 Wir über uns Katalog
galerie-m.at Katalog Zufahrtsplan Seitenblicke Mat Uns Mmm@galerie Aktualisiert Mailmmm@galerie Webmaster Hinterholzkirchstetten Z
20 GALERIE ART5 Art
galerie-art5.at Art Galerie Presse Aktuell Services Office@galerie Artat Wientelbaden
21 Galerie Chobot Office@galerie
galerie-chobot.at Office@galerie Chobotatgironcoli Karl Chobotbruno Rennertz Manfred Galerie
22 GALERIE ULRIKE HROBSKY Galerie
galerie-hrobsky.at Galerie Ulrike Hrobsky Grundsteingasse Showroom Wien Young + Fax Wientel Art Hrobskyat Wwwhrobskyatoffice@galerie
23 Startseite Deckensysteme Trockenausbau
dsp-pelzmann.at Trockenausbau Do Yourself Pelzmann Leistungen Galerie Deckensysteme Baustellen Homepage Firmalogin Logout Galerie Hier Arbeiten
24 GALERIE ULRIKE HROBSKY Hrobsky
hrobsky.at Hrobsky Ulrike Galerie Showroom Grundsteingasse + Young Wien Wientel Fax Wwwhrobskyat Email Art Office@galerie Hrobskyat Y
25 [Edi´s Star Galerie] Star
Private Homepage...
edis-star-galerie.at Star Homepage Galerie Private Html Marina Gallery [edi´s Mark Skydesign Webdesign Galerie] Martinnockis
26 Willkommen auf der Seite der Galerie Galerie
Galerie Lindengrün...
lindengruen.at Galerie Kunst Lindengrün Galerie@lindengruenat Möbel Kunstwerke Objekte Found The Map Apache Designport Bilder Server
27 Galerie Wien | Hans Staudacher | Galerie
Galerie Wien Neben Bildern der Klassischen Moderne befinden sich in unserer Galerie in Wien auch Werke...
galerie-kaiblinger.at Galerie Wien Helnwein Gottfried Staudacher Markus Prachensky Kaiblinger Bildern Office@galerie Kaiblingerat Hans Bilder Werke Schiele Klimtund
28 Johannes Kepler Haus Studentenheim Graz
Johannes Kepler Haus Graz Studentenheim Studentenwohnheim...
johannes-kepler-haus.at Graz Johannes Kepler Studentenheim Haus Lage Studentenwohnheim Rehgrund Galerie Anfahrt Galerie Leitung Unser Angebot Ffentliche Fahrt Heim Lageunser
29 NEFF NEFF BAU GmbH Neff
....
neffbau.at Neff Leistungen Galerie Baumeister Bau Firma Uns Galerie links Gmbhstartseite Rauchfangkopf Bauunternehmen Office@neffbauat Kaminkopf Familienhäusern Neuen Edelstahlkamin
30 HOME Future Growat Neuheiten
future-grow.at Neuheiten Videos Aktion Galerie Map Shop Infoshop Future Zkontakt Growat Growat Galerie| Home
31 Rahmen Galerie Böck HOME Rahmen
galerie-boeck.at Rahmen Galerie Böck Einrahmungen Kostenlose Galerie * News * News Ankauf * Home * Uns * Restaurierungen * Uns Create Y
32 Christine Tomaschek Home Christine
patchwork.at Christine Tomaschek Galerie * Meiner Weebly Persnlichen Galerie Home * Mich Create Tomaschek *linkswillkommen
33 Galerie Rhomberg Aktuell Galerie
Galerie Rhomberg Innsbruck...
galerie-rhomberg.at Galerie Rhomberg Innsbruck Aktuell Videos Ausstellung Jump Biografie Nobuyoshi Araki Rhomberg@galerie Rhombergat Kunst Kranebitter Content Server Y
34 Galerie und Kunsthandel Didier Morteveille Gemälde Didier
galerie-morteveille.at Didier Kunsthandel Objekte Galerie Morteveille Grafiken Moderne Zeitgenssischen Messen Editionen Ausstellungen Wien Gemlde Gemälde Kunsthandel@galerie Morteveilleat Archiv
35 Galerie Fröhlich | Home Galerie
Die Galerie in Linz...
galerie-froehlich.at Galerie Fröhlich Fritz Prof Linz Welcome Kunst@galerie Froehlichat Web Ziel Hinweise Kunst Werke Linzer Auswahl Besuchs Künstlers Schaufensterder
36 KBO home Qualität
Die Pulverbeschichtigung KBO Ihr Pulverbeschichtigungsprofi bis 136m Die Vorbehandlung Die Pulverbeschichtung...
kbo.at Qualität Kbo Pulverbeschichtigung Leibnitz Traun Transport Zertifikate Verfahrenstechnik Leistungsspektrum Downloads Galerie Vorbehandlung Pulverbeschichtigungsprofi Unternehmen Standorte Galerie * Hohe Graz Zertifikate *
37 Gerhard Hornischer Startseite Biographie
Platz für Ihren Slogan...
geho21.at Biographie Gästebuch Hornischer Bildergallerie Galerie  Gerhard Kontak Kontaktformular Robert Webseite Galerie Webseite Auf Persönlich Meiner Y
38 Home Joomla
Joomla the dynamic portal engine and content management system...
msc-mitterdorf.at Joomla News Videos Galerie Gästebuch News * Galerie * Dynamiccontent Videos * System Renntermine Management Templates
39 Home Radunion Unterland Ergebnisse
Willkommen auf der neuen Homepage von Radunion Unterland. Einige Rennen und Veranstaltungen werden von uns geplant und bestens...
ru-unterland.at Ergebnisse Veranstaltungen Verein Unterland Training Radunion Rennen Beitritt Bike Veranstaltungen * Vorstand Galerie Sponsoren Bärnbad Galerie * Beitritt * Pinzgau Werner Kids
40 Komm wir finden einen Schatz | Trailer
kommwirfindeneinenschatz.at Trailer Schatz Presse Komm Trailer * Galerie * Inhalt Inhalt * Galerie | Kino Gewinnspiel *kinofinder Finden
41 Filzkunst einzigartig und stilvoll Filzkunst
bimbolino lädt ein zu einer Traumreise durch seine Zauberwelt. Seiten zum Stöbern und Staunen. Filzkunst Fotodesign Bildergalerie bimbolinos...
bimbolino.at Filzkunst Bildergalerie Atelier Gästebuch Bilder Märchenwelt Zauberwelt Filz Filzdesign Galerie filz Literarisches Traumreise Galerie Mich Fotodesign Conart Träume Hallo Soul
42 Home Svö
svoe-weyer.at Svö Galerie Hund Gästebuch Weyer Mensch Fischer Homepagepartner Copyright Bietet Gästebuch Bewundert Galerie Schaut Weyer Wir
43 Sommer 1972 | Trailer Trailer
sommer1972.at Trailer Kinofinder Sommer Presse Lahmacun Lahmacun * Galerie * Galerie | Inhalt Trailer *inhalt * Z
44 Sommer 1972 | Trailer Trailer
sommer1972-derfilm.at Trailer Presse Sommer Kinofinder Trailer * Lahmacun Inhalt *galerie * Lahmacun *inhalt Galerie |
45 Energetikzentrum Kreuttal Startseite Leistungen
Platz für Ihren Slogan...
elisabeth-dolezal.at Leistungen Galerie Energetikzentrum Uns Kreuttal Kommen Galerie  Business Unterolberndorf_ Kontaktformular Bearbeitung Galerie_               Birkengasse Startseite *kreuttal_elisabeth
46 The BÃ¥nnskis Home Story
Wein Weiber und Gesang...
bannski.at Story Galerie Kontakt Band  Band Weiber Wein Bånnskis Gesanglets Bånnskis Since Setlist Rock Musik Galerie rock  the
47 Galerie G Z
galerieg.at Z Galerie Y
48 Galerie H Z
galerie-h.at Z Galerie Y
49 galerie7 Z
galerie7.at Z Galerie Y
50 Galerie Ambiente Startseite Ambiente
galerieambiente.at Ambiente Galerie Y
51 veronika schubert Veronikaportraitschubert
veronika-schubert.at Veronikaportraitschubert Galerie
52 aa galerie is coming soon Y
aa-galerie.at Y Coming Soon Galerie Aa Z
53 Galerie bei der Albertina Galerie
galerie-albertina.at Galerie Albertinay
54 Galerie Ambiente Startseite Ambiente
ambientegalerieambiente.at Ambiente Galerie Y
55 Home Uns
mail2rh.at Uns Galerie Beispieley
56 Willkommen in der Galerie DNS Galerie
galerie-dns.at Galerie Dnsy
57 TWICE Galerie
twice.at Galerie Downloads Audio Twice Z
58 galerie webartat Galerie
galerie webart.at...
galerie-webart.at Galerie Webartat Here Zgo Click
59 Autohaus Galerie Galerie
autohausgalerie.at Galerie Wwwgebrauchtwagenat Autohausy
60 Home Home
illphil.at Home Galerie Archivy
61 Galerie vor Ort Galerie
galerievorort.at Galerie Ortvor Menü Z
62 art galerie quotstudio wienblickquot Galerie
art-wienblick.at Galerie Quotstudio Art Wienblickquotz
63 freie galerie Galerie
freie galerie wir stellen es aus....
freiegalerie.at Galerie Freie Stellenz
64 stnetat Reisen
stnet.at Reisen Galerie Stnetaty
65 Galerie Lang Wien Galerie
glw.at Galerie Lang Wieny
66 Galerie Ernst Fuchs Galerie
ernst-fuchs.at Galerie Fuchs Ernsty
67 Klavier Galerie Klavier
klavierwettbewerb.at Klavier Galerie Browserz
68 Gerberhaus Culturproduktionen Galerie
project-antonia.at Galerie Culturproduktionen Gerberhausz
69 Galerie Lang Wien Langwien
galerielangwien.at Langwien Galerie Ausstellungkommende
70 Galerie Baumgartner Ars Temporis Galerie
galerie-baumgartner.at Galerie Ars Baumgartner Temporisz
71 galerie schaffererat Galerie
galerie schafferer.at...
galerie-schafferer.at Galerie Schaffererat Here Go Zclick
72 Welcome to my World Welcome
simeon.at Welcome World Galerie Homez
73 Home Atelier Galerie
galerie-kautz.at Galerie Atelier Kautzz
74 galerie cafeat Galerie
galerie cafe.at...
galerie-cafe.at Galerie Cafeat Goz Here Click
75 galerie haslingerat Galerie
galerie haslinger.at...
galerie-haslinger.at Galerie Haslingerat Clickz Go Here
76 WeinSinn Personen
weinsinn.at Personen Galerie Weinsinn Seminarz
77 Home Galerie
tc-frannach.at Galerie Vorstand Bewerbenews Home * Z
78 Webad 2007 IAB Webad
webad2007.at Webad Galerie Gewinner Iaby
79 Joannas Boutique Joannas
joannas-boutique.at Joannas Galerie Aktuell Boutiquez
80 manfred_fuerst Galerie
manfredfuerst.at Galerie Layout Manfred_fuerst Michz
81 wwwkunstmesseat Galerie Manfred Kern Kern
kunstmesse.at Kern Galerie Wwwkunstmesseat Manfredz
82 Stifta Geigenmusi Galerie
stiftageigenmusi.at Galerie Geigenmusi Musik Stiftauns Z
83 SUE IMK Galerie
sue-art.at Galerie Shop Grafikdesign Sue Imk Bagsz
84 GALERIE RULL BILLY Galerie
galerierull.at Galerie Rull Billybrowser Ihrem Z
85 Galerie Barina Barina
barina.at Barina Galerie Browser Ihremz
86 wwwbulliat Wwwbulliat
stauderer.at Wwwbulliat Tipps Galerie Flashplayerkontaktimpressumvideo
87 Startseite cousinbaus Jimdo Page Leistungenunternehmen
cousinbau.at Leistungenunternehmen Galerie Cousinbauspage Jimdo
88 CS Galerie Salzburg Impressionen Galerie
csgalerie.at Galerie Salzburg Impressionen Cscopyright Z
89 Familie Klinglhuber home Klinglhuber
klinglhuber.at Klinglhuber Home Galerie Familiez
90 Genoveva Kleider Genoveva
genoveva-kleider.at Genoveva Galerie Kleider Michy
91 FC Tarockierer Galerie
fctarockierer.at Galerie Wfv Website Mannschaften Tarockierer Partner Fc Z
92 creativ plan Philosophie
creativ-plan.at Philosophie Leistungsbereiche Galerie Seiten Creativplan
93 Generationen
weinbau-karner.at Generationen Galerie Angebote Weineweinbaukarner@aonat Z
94 Lesya Radon Home Radon
Lesya Radon...
lesya.at Radon Lesya Galerie Partner Mich Z
95 Startseite Tiereamhof
grabenbauerhof.at Tiereamhof Angebotezimmerpreisereich Erlebnis Galerie Grabenbauerhof
96 Nachtschwärmer Startseite Nachtschwärmeruns
divine-event.at Nachtschwärmeruns Galerie Mediaangebot
97 Tischlerei Maringer Tischlerei
tischlerei-maringer.at Tischlerei Maringer Unternehmen Leistungen Galerie Z
98 Startseite Fine
fine-fabrics.at Fine Error Galerie Contracttextilverlag Visiterequest
99 INTEC REPAIRS Home Galerie
intec-repairs.at Galerie Repairsnewsen Intec Philosophie Leistungen
100 Galerie Maierhofen Martin Schreiner Maierhofen
Galerie Maierhofen...
galerie-maierhofen.at Maierhofen Galerie Schreinerz Copywebway Martin
101 wwwphotographic artat Galerie
photographic-art.at Galerie Alte Bilder Brillewwwphotographicrotcyan Artat
102 duschl art Galerie
duschl-art.at Galerie Duschl Jutta Artz Rechte
103 Galerie Johann Widauer Works
widauer.at Works Artistsexhibitionswidauer Johann Galerie Contact
104 Fotoservice TU Wien Wien
Fotoservice TU Wien...
fotoservice-tuwien.at Wien Galerie Fotoservice Tu Unserer Bilderz
105 Gästebuch
akil-arabians.at Gästebuch Galerie Vomek Nachzucht Z
106 Acryl Messner Aktuell
brigitte-kunst.at Aktuell Acryl Messner Mich Galerie Z
107 Dr Manon Der Petrossian Dr
der-petrossian.at Dr Petrossianpersonleistungen Galerie Terminvereinbarung Manon Ordination
108 | Home Fotografin
manuela-ullmann.at Fotografin |hochklassigfokus Copyright Galerie Produkte
109 Aktdesign by Andi Mairhofer Mairhofer
aktdesign.at Mairhofer Andi Galerie Aktdesign Besucherz
110 remixx galerie günter eisenhut Günter
galerie-remixx.at Günter Remixx Galerie Eisenhutz
111 Herzlich Willkommen Willkommenauf
blumen-gasser.at Willkommenauf Herzlichfloristikunserer Grohandel Galerie Homepage
112 Galerie Sikoronja Obro
galerie-sikoronja.at Obro Sikoronja Galerie DoÅ liz
113 Hunde
spirit-dogs.at Hunde Gästebuch Galerie Newsuns Z
114 Die Mentaltrainerin Galerie
die-mentaltrainerin.at Galerie Literatur Hundetraining Mentaltrainerin Mich Mentaltrainingz
115 Photography by Andrea Silvia Galerie
photoes.at Galerie Silvia Photography Andrea Mich Impressum Z
116 Asia Huy das feine Asia
asia-huy.at Asia Speisekarte Huy Galerie Restaurant Asiatische Homefeine
117 FRITZBILD Bild
bild-vom-fritz.at Bild Fritz Michhauptseitegallerie Galerie Fritzbild Foto
118 Peter A Etzer Etzer
pae.at Etzer Peter Galerie Werke Ausstellungen Pa Englishy
119 Home Kirchen
hochzeitszentrum.at Kirchen Meierhof Galerie Anfahrt Video Partnerz
120 Haar Diva 8211 by Bady Bady
haardiva.at Bady Diva Team Galerie Preise Haarz
121 Pferdesport Physio Mich
pferdesport-physio.at Mich Physiopferdesporttraining Zusammenarbeit Galerie Behandlung Physiotherapie
122 Startseite | Ing Christian Schaufler Bau Schaufler
schaufler-bau.at Schaufler Bau Christian Ing Uns Galerie Schober Anfrage | Leistungenwebseite Z
123 Podium Zukunft Podium
podium-zukunft.at Podium Zukunft Veranstaltung Plattform Bericht Galerie Z
124 Galerie Anneliese Lanner Galerie
galerie-lanner.at Galerie Auswahl Anneliese Kleine Collagen Lannerz
125 willkommen bei fraumaierat | fraumaierat Fraumaierat
fraumaier.at Fraumaierat Area Main Contentz Portfolio Galerie |
126 The Globe Event Galerie
the-globe.at Galerie Konzept Event Globe World Danceworldmusic Z
127 GoldenIndex Ausflug
pferdeschlittenfahrten.at Ausflug Zuchtwintergoldenindex Galerie Sommer Peterneuper@pferdeschlittenfahrtenat
128 Wielton Wielton
wielton.at Wielton Galerie Angebot Agro Wieltonwerk Anfordernz
129 Niclas Anatol Niclas
niclasanatol.at Niclas Galerie Anatol Blog Biografie Anatolnavigationz
130 Mario Matt Mario
mario-matt.at Mario Presse Erfolge Galerie Matt Kontaktz
131 Gasthaus Ackerwirt Galerie
ackerwirt.at Galerie Gaststuben Ackerwirt Geschichte Saal Gasthausz
132 Scorebay Home Scorebay
scorebay.at Scorebay Konfiguratorz Austria Galerie Kontaktanfrage Ecotherm
133 Brigitte Lewisch Home Lewisch
brigitte-lewisch.at Lewisch Brigitte Galerie Ausstellungen Aquarellemich Acryl Z
134 Willkommen | VBFV Galerie
vbfv.at Galerie Permanently The|ergebnisse Links Uns Vbfv Wissenswertes
135 Erika G Johannsson Galerie Atelier Austria
leolab.at Austria Atelier Erika Galerie Johannsson Stainzz
136 Willkommen auf der Seite von Michaela Michaela
remplbauer.at Michaela Remplbauer Lebenslauf Galerie Seite Maria Z
137 TeamWesensMitte Home Partner|innen
wesensmitte.at Partner|innen Teamwesensmitte Agbs Galerie Homez
138 Elterninitiative Elterninitiative
handicap-kein-hindernis.at Elterninitiative Mitarbeit Galerie Projekte Partner Handicapunshindernis
139 Paul Zurl Fotos
paulzurl.at Fotos Ausstellungen Paul Zurl Galerie Michz
140 Schobergruppeat Galerie
schobergruppe.at Galerie Mitgliederurheberrechtshinweisuns Besetzungen Hörbeispiele Schobergruppeat
141 Peer Alois Alois
peerlois.at Alois Zeitraffer Peer Wwwpeerloisat Galerie Wochenbilderbilder Z
142 Rottweiler Information Forum Chat Information
rotti.at Information Foto Galerie Shop Chat Forum Rottweileruvm Z
143 Werner Crew Crew
werner-crew.at Crew Werner Galerie Produktez Preise Youre Beautiful
144 Miguel Henz gt Aktionartist Aktionartist
m-henz.at Aktionartist Philosophie Miguel Archiv Vita Galerie Henzgt Z
145 Pferdeportrait Galerie von Brigitte Kienreich Brigitte
pferdeportrait.at Brigitte Kienreich Galerie Fotovorlage Pferdeportrait Technikenpreise Copyrigth Z
146 MB Events DER Partyveranstalter Event
partyevent...
mb-events.at Event Galerie Party Mb Events Home Partyveranstalter Technikbuchen Z
147 Meise Architektur Meise
meise-architektur.at Meise Architektur Galerie Konzeption Biografisches Wohnberatung Entwurfy
148 Home Atelier
atelier-ursula.at Atelier Ursula Reservedz Galerie Rights Mich Copyright
149 MoveOn Pilates Studio Pilates Training Studio
pilates-training.at Studio Pilates Training Wochenplan Galerie Ausbildung Moveonz
150 Bilder Lore Zumtobel Startseite Lore
lorezumtobel.at Lore Zumtobel Bilder Anfahrt Galerie ©z
151 Gesund Sein Bewusst Leben Gesundheitsmesse
gesund-bewusst.at Gesundheitsmesse Leben Galerie Eisenstadt Alternative Bewusst Gesund| Z
152 Die Welt der WCs Macromedia
daswc.at Macromedia Welt Sollten Betrachten Herunterladen Galerie Bittewcswwwfotographinat
153 Rudolf Budja Galerie Artmosphere Galerie
artmosphere.at Galerie Galerien Rudolf Artmosphere Budja Javascript Wwwartmosphereat Z
154 Alfred Kubin Galerie Kubin
kubin-galerie.at Kubin Serverfound Thealfred Found Apache Galerie Port
155 MV Neidling Mv
mv-kremnitztaler.at Mv Neidling Galerie Geschichte Intern Gästebuchkremnitztal Kontakttermine
156 Person Port
haelge.at Port Apachehermann Gedanken Steidlperson Permanently The Server Galerie
157 Tischlerei Moser Moser
tischlereimoser.at Moser Produkte Tischlerei Angebote Stellenangebote Planungen Galerie Uns|
158 Werners Art Galerie Home Galerie
werners-art.at Galerie Werners Gästebuch Biografie News Copyrightart Z
159 Health
dentalhealthcare.at Health Care Dental Galerie Nanny Found The Pressebeauty Z
160 Energie Quellen Energie
energie-quellen.at Energie Quellen Aromaöle Mwol Galerie Uns Agbhaftungsausschluss Z
161 Startseite Haus
hoerbigerhaus.at Haus Location Galerie Hrbiger Wien Kontakthimmelstrae Hoerbigerhauspdf Z
162 wwwvasilikaat Home Highlights
vasilika.at Highlights Motivation Gästebuch Innenarchitektur Galerie Vasilikawwwvasilikaat Z
163 Landjugend Brixlegg Zimmermoos Home Brixlegg
lj-brixlegg.at Brixlegg Landjugend Laquo Staudnfestfotos Mediares Galerie Zimmermoos Z
164 Rottweiler Information Forum Chat Shop
rotweiler.at Shop Information Foto Galerie Chat Rottweiler Forum Uvm Z
165 cosimaat | home Cosimaat
cosima.at...
cosima.at Cosimaat Mich Flohmarkt Cosima Meinez Feunde Galerie |
166 Galerie Artconsulting Home Galerie
galeriegetreidegasse.at Galerie Deutschcontact Partner Artistprofil Philosophy English Artconsulting
167 Hubert Ebner Photographie Hubert
Hubert Ebner Photographie Bruck an der Mur...
ebnerhubert.at Hubert Photographie Ebner Admin Galerie Murz Bruck
168 Dorfwirt Enzenhofer Enzenhofer
dorfwirt-enzenhofer.at Enzenhofer Dorfwirt Speisekarte Galerie Chronik Rights Reservedz
169 Hexen Baunkichen Baunkichen
hexen-baumkirchen.at Baunkichen News Galerie Hexen Chronik Sponsoren Aktuelly
170 Willkommen beim Sterzfest Sterzfest
Das Sterzfest...
sterzfest.at Sterzfest Galerie Kirchenwirt Sterzwirte Sterz Kirchenwirtat Gastronomiewillkommenbeim
171 Treiber Galerie Schauplatz treibergalerie Galerie
hermeling...
treiber-galerie-schauplatz.at Galerie Schauplatz Hermeling Presse Monats Treiber Angebottreibergalerie Uns Z
172 Startseite Fine
fine.at Fine Request Visitez Contract Error Galerie Textilverlag
173 Galerie Sargant Galerie
galerie-sargant.at Galerie Sargant Kontaktwunschfragenanliegenz Umarbeitung Msargant@gmxat Email
174 Startseite Margit Jirku Fotografie Jirku
margitjirku-fotografie.at Jirku Margit Galerie Fotografie Blazebit Entwickelt Michcopyrightleistungen
175 Würstlstand Golosetti Würstlstand
wuerstlstand.at Würstlstand Rezepte Speisekarte Golosetti Galerie Unsz
176 Roedler Roedler
roedler...
xn--meisterrdler-cjb.at Roedler Feng Threatlabs Shui Leistungen Galerie Avg Copyrightclogin Uns Z
177 Anneliese Rauscher | Willkommen Anneliese
anneliese-rauscher.at Anneliese Rauscherillustrationen Galerie Portrait Altargestaltung| Ausstellungen Portfolio
178 Karl Wenninger Video
karlwenninger.at Video Vita Theater Filmfernsehen Galerie Karl Wenninger Z
179 TANGO LINZ Tango
tango-linz.at Tango Kursejomo Workshops Linz Galerie Uns Vereinsanmeldungmilonga Powered
180 Roedler Roedler
roedler...
meisterroedler.at Roedler Leistungen Shui Galerie Threatlabs Feng Logincopyrightcavg Uns
181 Galerie Artconsulting Home Artconsulting
contempofineart.at Artconsulting Philosophycontact Profil Partnerdeutsch English Artist Galerie
182 The Next Fromberg
the-next.at Fromberg Jugend Videos Galerie Znext Gästebuch
183 Galerie Norbert Rathkolb Galerie
Galerie...
rathkolb.at Galerie Rathkolb Norbert Bildergalerie Michz Gästebuch
184 Home | Holzmagier MEC Steinschnak Holzmagier
holzmagier marco steinschnak...
holzmagier.at Holzmagier Steinschnak Mec Marco Holz | Zeitlosigkeit Ausstellungenz Galerie
185 Box a Smile Photobooth Wordpress
boxasmile.at Wordpress Themesfaq Photobooth Elegant Galerie Box Warumsmile Angebot
186 DD Cocktail Bar Cocktail
cocktailbar-dd.at Cocktail Bar Dd Cocktailbar C Reserved * Copyright Rights Zevents Galerie
187 Galerie Bibi Galerie
Bildergalerie...
pendel.at Galerie Bibi Forward Here Click Bilder Aquarellbildergalerie Kunst Z
188 Unverblümt Schichtle Simone Schichtle Schichtle
Unverblümt Schichtle Simone...
unverbluemt-schichtle.at Schichtle Simone Unverblümt Altenmarkt Galerie Philosophiez
189 Stadlfest St Marein Stadlfest
Stadlfest St. Marein...
stadlfest.at Stadlfest Marein St Galerie Premoat Gästebuch Gstebuchknittelfeld Uns Z
190 Startseite Galerie Maier Maier
galerie-maier.at Maier Galerie Maria Theresien Palais Telefontrapp Innsbruck
191 Winden am See Galerie
windenamsee.at Galerie Wirtschaftvereine Kellerfest Windentourismus See Gemeinde Bärenfest
192 andinet Willkommen Andinet
andinet.at Andinet Arcsinblog Gästebuch Permanently The Galerie Willkommen Changelog
193 Alfred Rauch Rauch
alfredrauch.at Rauch Alfred Kulturmanager Galerie Vita Schauspielersängerz
194 Web Galerie wo die Kunst
kunstsammlung.at Kunst Galerie Begegnung Netscape Wo Dieser Web Browserstattfindet Anzeigerahmenerung Text
195 True Nails Preisliste
truenails.at Preisliste Galerie True Aktionen Leistungen Nails Headerz Table
196 News Galerie
Trilogiecafe Franz Gmainer...
trilogiecafe.at Galerie Gmainerfranz Cafe Essen Weintrilogiecafe News Trinken Bistro
197 Start Dr Kremer Eveline Galerie
None...
drkremer.at Galerie Leistungen Login Kremer | Eveline Evelinestart None Start Kontakt Dr
198 Servizio 8211 Vespaland Vespaland
vespaland.at Vespaland Servizio Anfahrt Menü Hide Galerie News Menuz
199 Der Glasgarten Wildburger Glasgarten
glasgarten-wildburger.at Glasgarten Presse Galerie Wildburger Office@atelier Allmendewegwildburgerat Fax Rankweil Z
200 Maria v Ohmeyer akad Malerin 1896 Ohmeyer
Maria v. Ohmeyer akad. Malerin 1896 1983...
ohmeyer.at Ohmeyer Maria Malerin Akad Galerie Nachtwächterhausweinstadtpoysdorf
201 Fam Pichler Häring Pichler
pichler-haering.at Pichler Häring Fam Harald Hochzeit Rechte Uns Familiez Galerie
202 Neuhaushof Neuhaushof
neuhaushof.at Neuhaushof Brennereiunser Zimmer Anreisehaus Schmankerl Almhütte Galerie
203 Seite 1 Website
nwerle.at Website Vigiliakomplimente Galerie Werlemmata Theologischevanitas Werle Parerga Nikolaus
204 index Galerie
doga.at Galerie Kundenihrerfamilie Ihrem Einfach Geschmack Tglich Naturell Haus
205 peter sengl Galerie
Figurative Malerei Druckgrafik Grafik Bilder Galerie Deschler Galerie Walker...
petersengl.at Galerie Grafik Bilder Deschler Walker Figurative Malerei Druckgrafiksenglpeter
206 Vem Camara Home Z
vemcamara.at Z Preise Veranstaltungen Error Vem Galerie Training Request Uns Puresoftatpowered Ber Camara
207 Henrys Hundeschule Hundeschule
Hundeschule für alle Rassen...
henrys-hundeschule.at Hundeschule Henrys Nachrichten Anfahrt Galerie Entstehung Tirolrassen Navigation Z
208 Golden Retriever Lucca Lucca
golden-lucca.at Lucca Retriever Golden Galerie News Gästebuch Browsergstebuch Z
209 index Hongkong
lightwish.at Hongkong Juventus Sturm Neuseeland Copyright Galerie Websiteandreas Cervinka Z
210 Start Restaurant Pizzeria Modena Pizzeria
pizzeriamodena.at Pizzeria Speisekarte Login Galerie Modena Uns Impressum Start|restaurant
211 Luise Muschailov Stimmungsbilder Stimmungsbilder
Luise Muschailovs Stimmungsbilder...
stimmungsbilder.at Stimmungsbilder Luise Muschailov Galerie Mich Werkelaus Muschailovs Keilrahmen Z
212 DJ LJ SchaWo Schawo
schawo.at Schawo Dj Inhalt Equipment Mantra Galerie Lj Poweredby World Wordpress Z
213 Steirerbike Steirerbike
Steirerbike das steirische Bike...
scherz-bikes.at Steirerbike Radprogramminternationale Galerie Auszeichnung Steirisch Made Bikesteirische Anzeige
214 SPLENDID bar italia Getränke
splendidbaritalia.at Getränke Speisen Splendid Galerie Weinkarte Italia Seiten *z Bar
215 Galerie Mahler Wien Mailing
galeriemahler.at Mailing Join Wien Mahler List Galerie Kunstmaler Philippez
216 CHRISTIAN MARSCHNER | Technisches Büro für Technisches
CHRISTIAN MARSCHNER Technisches Büro für Innenarchitektur...
marschner-innenarchitektur.at Technisches Marschner Christian Büro Innenarchitektur | Galerie Unternehmenpartner Review Z
217 Schnitzkunst Schnitzkunst
schnitzkunst.at Schnitzkunst Nr Johann Haibachz Ledermüller Tel++mobil Galerie
218 Galerie Mire Galerie
galerie-mire.at Galerie Mire Grazer Leibnitz Gasse Office@galeriewebseite Mireatentsteht
219 Home ingridbeierat Ingrid
ingridbeier.at Ingrid Beier Angebote Ingridbeierat Galerie Ausstellungen Mischtechnik Acrylwwwingridbeierat Z
220 galerie web artat steht zum Verkauf Galerie
galerie-web-art.at Galerie Web Artat Domain Steht Wunschdomain Domainkaufkaufen Treuhandserviceverkauf Erwerben
221 Cinema Dornbirn Cinema
cinema2000.at Cinema Dornbirn Kino Wochenbersicht Preise Tagesprogramm Galerie Demnchstaktuell Agb Z
222 BEST AGE CONSULTING Ueber uns Uns
best-age.at Uns Abcconsulting Galerie Ueber Projekte Age Leitbild Team Best Agbsunternehmen Angebote
223 Homepage Alphorn Alphorn
stubaier-alphornblaeser.at Alphorn Homepage Galerie Zuverschiedenen Alphornweisenstubaitalanfrage Spielen Anlässen
224 Kleine Villa Kunterbunt Start Kleine
kleinevillakunterbunt.at Kleine Villa Kunterbunt Galerie Paten Bahnhofstraezentrum Pippi@kleinevillakunterbuntatpitten Z
225 Galerie Traunsee Galerie
galerietraunsee.at Galerie Kurzbiographie Aktuell Traunsee Technik Kinderbuch Milleniumsuhr Besichtigenz
226 Kingsport Kingsport
kingsport.at Kingsport Training Gesundheit Angebot Galerie Bewegung Mich Personalzielezuhause
227 index Skigebieten
h-regina.at Skigebieten Link Galerie Ausstattung Preisliste Gstebuchwegweiser Gästebuch Z
228 Tattoostudio Contact Tattoostudio
Tattoostudio steyr website...
tattoostudio-steyr.at Tattoostudio Steyr Studio Galerie Location Contact Website Tattooaltgasse Z
229 Kunstverlag WOLFRUM Wolfrum
Kunstverlag Wolfrum Buchhandlung Kunsthandlung Galerie...
wolfrum.at Wolfrum Kunstverlag Galerie Buchhandlung Kunsthandlung Lobkowitz Palais Webdesignz
230 Galerie der Freischaffenden Galerie
galerie-der-freischaffenden.at Galerie Freischaffenden News Ausstellungen Wedenig Newsdie Geschlossen Zukunftbesucheundinteresse
231 Imagine Verein für Kulturanalyse Imagine
My Website...
imagine.at Imagine Kunstraum Verein Kulturanalyse Galerie Aktivitäten Macfluxwebsite
232 Schellacks 78rpm Gt
schellacks.at Gt Lt Schellacks Galerie Kleinkunst Aufnahme Versand Herstellung Rpm Werbungberliner Schellackplatte Z
233 Achenseer Museumswelt Home Achenseer
achenseer-museumswelt.at Achenseer Museumswelt Museumsbereiche Gästebuch News Informationmitglieder Galerie Z
234 Home Tischlerei Walter Walter
tischlerei-walter.at Walter Tischlerei | Found Galerie Port Apachefound The Mitsunobu Server
235 GERDA ANKELE Aquarelle und Gerda
gerdaankele.at Gerda Ankele Ausstellungen Gouachen Galerie Biografie Aquarellegelassenheit_ Gouachen_ Z
236 DASCHKARIA | Werkstatt für biophiles Design Design
daschkaria.at Design Biophiles Neues Galerie Daschkaria Produkte Werkstatt Team |z
237 lupus corridor Lupusinlineframes
lupus-corridor.at Lupusinlineframes Corridors Konfiguration Corridor Bilderbogen Browserworkshops Mich Galerie
238 GF Bau GmbH Gf
GF Bau Gruber Franz Bauunternehmen...
gf-bau.at Gf Bau Bauat Galerie Gruber Franz Bauunternehmen Unsereruns Website Cgfbau
239 Sensenwerk Deutschfeistritz Sensenwerk
sensenwerk.at Sensenwerk Deutschfeistritz Theatermuseum Altweiber Musik Galerie Walpurgisnacht Veranstaltungsmarkt
240 index Zimmerweingut
Wein Kunst Zimmer...
plos.at Zimmerweingut Heurigen Baden Wein Vinothek Ploskunst Galerie Sooss
241 Q202 Q Atelierrundgangwer
q202.at Atelierrundgangwer Galerie Menu Webinfo Wannwo Presse Archivq Musik
242 Kreativideen Margit Mayr Kreativideen
kreativideen.at Kreativideen Mayr Galerie Margit Biographie Mich Dinge Angeboteseeleschnheit
243 EMO Galerie Emil Oman Emil
emo-arte.at Emil Galerie Bleiburg Aichdob Oman Javascript Installieren Emoflashinstallieren Z
244 Melodium Peuerbach Melodium
Website des Kulturzentrum Melodium...
melodium.at Melodium Peuerbach Kulturzentrum Ausstattung Galerie Anfahrtdownloads Website Bilderkalender
245 Home Produkte
radundnabe.at Produkte Portapache Galerie Gästebuchfound The Found Server Unternehmen
246 Startseite | timeforfashion Kucharz
timeforfashion.at Kucharz Inhalt Marken Direkt Galerie English Fashionz Timeforfashion |
247 Wuxelweb Willkommen Wuxel
r-bahr.at Wuxel Wuxelweb Wuxelbildern Beispiel Galerie Robert Colorierte Einigenwuxelwebatbahrs
248 ICôNE DESIGN | Galerie Design
iconedesign.at Design Galerie Icône Lebenslauf Malerei Leistungen Grafikillustration|
249 Atelier Paul Joachimsthaler Paul
Galerie Paul Joachimsthaler...
joachimsthaler.at Paul Joachimsthaler Galerie Atelier Bilder Zeichnungen Biografie Zmedia Tp Kontakt
250 MFC Bruchpiloten Kemeten Intern
bruchpiloten.at Intern Mitglieder Veranstaltungen Galerie Videos Bruchpiloten Kemeten Uns Sponsoren Kemetenhauptmenmfc Z
251 Willkommen in der Steyrdurchbruchhütte Galerie
steyrdurchbruch.at Galerie Speisekarte Steyrdurchbruchhtte Anfahrt Region Email Steyrduchbruchhttesteyrdurchbruchhütte Leonstein Z
252 Die Galerie Galerie
Galerie am Hofsteig...
galerieamhofsteig.at Galerie Hofsteig Kunstinvestmentverkauf Team Künstler Am Anfahrtuns Rundgang Kunstwerke
253 Mass Schneiderei GUSEL Home Gusel
schneiderei-gusel.at Gusel Schneiderei Mass Lageplan Galerie Gästebuch Katschrgschneidereigusel@aonat
254 Steirerbike Steirerbike
Steirerbike das steirische Bike...
steirerbike.at Steirerbike Bike Made Internationale Steirische Auszeichnung Steirisch Galerie Radprogrammanzeige
255 Volksschule Naas Volksschule
vs-naas.at Volksschule Naas Aktuell Seitenanfang Galerie Schlemmer Mag Geraldschuleunserer Wo Herz Rojekt+
256 Home | Katschberg Appartements Lage
katschberg-appartements.at Lage Anfahrt Galerie Grundrisse Katschberg Anfrage Appartements |wwwkatschbergappartementsat Mail
257 Galerie Zauner Kunst
Galerie für moderne Kunst...
galerie-zauner.at Kunst Galerie Zauner Moderneausstellung Pernkopfleonding Linz Schmuckdesign Gegenwart Christa
258 Slideshow 2 Michaela
patrickbaumueller.at Michaela Slideshow Galerie Stock Rothkrebschen Clubblumen Speakerscorner Wursthabererpatrick Baumller Z
259 Boogie Woogie Club Stockerau Gerhardschneider@kikaat
boogiewoogie-stockerau.at Gerhardschneider@kikaat Galerie Woogie Ueber Boogie News Stockerau Clubunskontakt
260 BIKE MAX | MARIA ALM Bike
BIKE MAX MARIA ALM...
bike-max.at Bike Max Maria Alm | Fahrrad Touren Schule Downhill Tour Cyclingmountain Galerie Z
261 Willkommen RC Hofmühlen Hofmühlen
reitstall-linz.at Hofmühlen Galerie Anlage Rc C Created Schmidinger Rights Designreserved Z
262 kolorit Wien
kolorit.at Wien Post Kolorit Heumarkt Office@koloritatz Schlenthergasse Galerie Telfax
263 Information Innenausbau | Omelan Information
innenausbau-omelan.at Information Innenausbau Pluck Css Admin Omelan Galerie Templates Nodethirtythreez Free |
264 Home dilettantens Webseite Z
dilettanten.at Z Permanently The Webseite Port Galerie Dilettantens Apache Anfahrt Uns Serverstadttheater Gespieltes
265 crossfit innsbruck Wod
crossfit-innsbruck.at Wod Crossfitinnsbruck Found The Port Partner Galerie Apache Stundenplan Agbs Foundserver
266 Golf Club Wien Club
Willkommen im Golf Club Wien...
gcwien.at Club Golf Wien Sport Galerie Platz Turniere Restaurant News Z
267 diemalerin Diemalerin
diemalerin...
diemalerin.at Diemalerin Teamwork Leistungsangebot Galerie Brinckmann Lebenszeichnung Farbe Ernstfreude Gustav
268 Homepage Fair
RACEWORLD Modellautosammlung Andrew Fair...
raceworld.at Fair Andrew Homepage Automobilia Modelle Impressumkontakt Raceworld Galerie Modelleautosmodellautosammlung Z
269 Gerhard Klein Buchungsanfrage
Triesterstrasse 237 A 1230 Wien 0676 413 74 23 office@gerhardklein.at www.gerhardklein.at...
gerhardklein.at Buchungsanfrage Gerhard Galerie Mich | Klein Office@gerhardkleinatwien| Wwwgerhardkleinattriesterstrasse Pixelcloudat
270 fizidux Z
fizidux.at Z Grafik Fizidux Kunst Server Galerie Art Malerei Found Portfound The Apache
271 Willkommen auf wwwholzschlaegerungat Holzschlägerung
Holzschlägerung Aster Der Profi im Forstbereich...
holzschlaegerung.at Holzschlägerung Videoteam Profi Forstbereichaster Unternehmen Wwwholzschlaegerungat Galerie
272 Urban Dance Theatre Innsbruck Urban
urbandancetheatre.at Urban Theatre Dance Nutzungsbedingungen Programm Artists Galerie Innsbruck Udtrechte Z
273 Technologie Sammel und Museumsverein Salzburg Salzburg
technologiesammler.at Salzburg Museen Technologie Sammel Geschichte Sammler Museumsverein Galerie Zsonderausstellung
274 Leosch Leosch
Stahl und mehr...
leosch.at Leosch Galerie News Stahlcolor Rights Reserved Steel Eupowered Homac
275 Beatique Beatique
Unikatschmuck von Beatique...
beatique.at Beatique Schmuck Wienunikatschmuck Galerie Silber Vision News Goldunikat Design
276 Cinema Dornbirn Dornbirn
cinema-dornbirn.at Dornbirn Cinema Programm Demnchst Galerie Kino Preise Aktuell Agbz
277 GoCadat Visualisierung Planung Objekt
gocad.at Objekt Raum Planung Kontaktimpressum Licht Visualisierung Gocadat Galerie Skizzenblogz
278 Die Entspannten Inlineframes
dieentspannten.at Inlineframes Entspannten Galerie Gästebuch Wannz Warum Browser Hause
279 BastArt Galerie Rahmungen Galerie
bastart.at Galerie Dekoratives Rahmungen Bastart Konzept Team Fr Mo Uns Strozzigasseagb Josefstdter Contact
280 Damen Friseur Sibel 983 85 Sibel
damenfriseur sibel Damen Friseur Sibel Friseur Sibel...
friseursibel.at Sibel Damen Friseur Preisliste Leistungen Damenfriseur Galerie Aktion Frieurwien Uns Z
281 Willkommen auf der Startseite None
None...
ballett-tanz.at None Wwwballettschulenat Location Faq Port Hop Uns Apache Ballett Dance Server Galerie Founddownload
282 lebzelterei kerner Galerie
lebzelterei-kerner.at Galerie Lebkuchen Unser Torten Konditorei Sortiment Uns Cafeacutecaf Lebzelterei Kerner Z
283 CARMETIC Kosmetik für ihr Carmetic
triax-digital.at Carmetic Kosmetik Fahrzeug Preise Leistungen Galerie Kürzeihr Homepage Z
284 hautzentrumat Hfner
xn--hfner-jua.at Hfner Kundenmagazin Shop Zentrum Galerie Reinhard Hautzentrumat Gesundheitsthetikschnheit Einfach
285 Michael Gindl Weinviertel | Galerie Michael
4ergindl.at Michael Gindl Galerie Apacheweine Weingut Server | Aktuellpermanently The Port Weinviertel
286 GALERIE erlas creativ gmbh Galerie
erlas.at Galerie Kunstlagercreativ Baukultur Ausstellungen Erlas Fotografie Künstlergebrauchsdesign Kreativarbeit
287 Willkommen bei Bioenergie Gtgtanfrage
energiepartner.at Gtgtanfrage Office@bioverdeat Galerie Heizwerke Leistungen Home Wasser Bioenergiewind Uns
288 Hexenmarkt Home Hex
hexenmarkt.at Hex Hexenmarkt Anfahrt Sponsoren Hexen Rat Programm Ausstellerservice Galerie Termin Hofunterkagererhof
289 Roedler Roedler
roedler...
xn--rdler-jua.at Roedler Leistungen Shui Feng Galerie Threatlabs Copyrightc Login Unsavgkontakt
290 Helene Schorn Künstlerin Helene
heleneschorn.at Helene Film Schorn News Künstlerin Kalender Ansehenatelierdownload Galerie
291 Marion Fessl Fessl
fessl-art.at Fessl Marion Beendeten Ausstellung München Galerie Quotmysteriumquot Kunstgiessereiderkunstgiesserei
292 Hermann Haase*index Hermann
haase-hermann.at Hermann Malerbildhauer Galerie Holzbildhauer Kunstmalerhaase*index Webdesigner Kunstgestalter Kuenstler
293 Web Galerie wo die Begegnung
webgalerie.at Begegnung Kunst Galerie Textanzeige Dieser Browser Stattfindet Netscape Web Worahmenerung
294 Startseite Video
hannavictoriabauer.at Video Galerie Vita Theater Filmtv Theaterpädagogik Audioy
295 Eiscafefreezer Eiskarte Eiskarte
Eiscafefreezer Mattighofen Italienisches Eis Der Eissalon mit dem hausgemachten Eis google...
eiscafefreezer.at Eiskarte Eis Eiscafefreezer Galerie Italienisches Speisengetrnke Mattighofen Special Eiserzeugung So Gelattieiscafeffnungszeiten
296 massi milano Milano
MASSI MILANO FASHION MODE...
massimilano.at Milano Massi Fashion Galerie Kollektion Filialen Mode Wien Herrenhemdenherrenmode
297 Home havana cocktailbar Offers
havana.at Offers Reservierungen Galerie Special Navigationwo überspringen Unshavana Cocktailbar
298 Wuxelweb Willkommen Wuxel
wuxelweb.at Wuxel Wuxelbildern Beispiel Wuxelweb Galerie Wuxelwebat Bahrs Einigenrobert Colorierte Z
299 2 Rad Breinlinger Breinlinger
2rad-breinlinger.at Breinlinger Halleinrad Bikes Motorrad Galerie Salzachtalstrasse Fax Klug Newszweirad Veranstaltungen
300 Martina Willmann Kochkurse Kochkurse
willmannkochen.at Kochkurse Foodstyling Presse Willmann Kochen Galerie Rezepte Martinawebseite Rsaquo Z
301 x33xat SPORT Sport
x33x.at Sport Natur Art Galerie Kontaktieren Uns Dirndl News Windsurfing Sailing Xxat Z
302 H W H A T Events
handwerkshaus.at Events Galerie Firmen Handwerkshaus Server Oberndorf Foundanfahrtport Found The Apache
303 ertelhalja Herzlich Willkommen Lebenslauf
halja.at Lebenslauf Galerie Ausstellungen Herzlich Ertel Ertelhalja Webseitecopyrightmalerin Designed Halja
304 lomado Galerie
lomado.at Galerie Foto Lomado Management Partner Freunde Unsermusiktanzband Programm Jung
305 Willkommen bei der Tischlerei Hausensteiner Tischlerei
hausensteiner.at Tischlerei Planung Hausensteiner Galerie Umsetzung Holzverarbeitung Ecgwillkommenhand Veranstaltungen Tischler
306 Malerei Seiwald Seiwald
malerseiwald.at Seiwald Team Partnerbetriebe Galerie Malerei Leistungen Telefontirolwald Maler Mailinfo@malerseiwaldat Fax
307 Helene Schorn Künstlerin Helene
helene-schorn.at Helene Film Schorn Künstlerin Galerie Kalender Atelier Download Newsansehen Z
308 Klang Atelier Klang
Klang Atelier...
steinko.at Klang Atelier Serverpermanently The Wirkung Galerie Preise Apache Klangatelier@steinkoat Klangmassageport
309 Home Fyt
fyt-art.at Fyt Bilder English Airways Sunflight Jobs Galerie Styling Bewertung Margareta Home Z
310 Margit Amon Garser
margitamon.at Garser Portrait Margit Amon Christkindlmarkt Galerie Werke Kontakt Ausstellung Besuchenhomeuhr
311 FORM L Interiors Innenarchitektur Architektur
FORM L Interiors Innenarchitektur Architektur und Möbeldesign aus Thalheim bei Wels...
form-l.at Architektur Möbeldesign Innenarchitektur Interiors Galerie Form Person Brands Thalheimreferenzwels
312 sanja jelic Fotos
sanja.at Fotos Sanja News Galerie Collagenalles Prominier Cover Fotografien Jelicplakate Reiseberichte
313 index Art
quotAktkunst und Skulpturen zu kaufen und zu mieten von Gerold Ziegler 21 art.atquot...
21-art.at Art Wwwzmlsat Skulpturen Ziegler Gerold Akt Quotaktkunst Aufihrendoch Freue Galerie Schauen Mich
314 Jenny Gazelle Travestie aus Gazelle
lamirage.at Gazelle Jenny Presse Travestie Showprogramm Galerie Weststeiermark Markushieger Michdesign Fotos
315 Buddhistisches Zentrum Scheibbs | Eine e Zentrum
bzs.at Zentrum Anfahrt Preise Galerie Veranstaltungen Scheibbs Buddhistisches Buddhismus Mitgliedschaft Wordpress| Z
316 Homepage Patrizia Rausch Foto
patrizia-rausch.at Foto Galerie Rausch Homepage Sponsoren Patrizia Wrgl Gästebuch Gstebuchbesucher Z
317 Dolly Buster | Meine Welt Welt
dolly-buster.at Welt Meine Kunst Dolly Vip Tv Autogrammkarten | Play Rezepte Kulturgames Galerie Biografie
318 Sport Menzinger Fehring
sport-menzinger.at Fehring Sport Menzinger Galerie Verein Marken Link Angebote Ort Trends Jungsachenkinderbekleidung
319 We Will Rock You Rock
We Will Rock You...
we-will-rock-you.at Rock Ben Galerie We Bb Downloads Original Shop Musical Queen Team Tpl_beez_jump_to_nav Eltonpresse
320 StadtLandFluss Stadtlandfluss
stadtlandfluss StadtLandFluss...
stadtlandfluss.at Stadtlandfluss Chat Nachrichten Galerie Spiegelonline Email Bilder Login Wechsel Zbirgit
321 Zero Bock | Z
0-bock.at Z Galerie News Gemixtes Agb Bock Partner Events Fotos Produkt Zeroshop Freunde |
322 Homestyling Helena Startseite Homestyling
homestylinghelena.at Homestyling Helena Homestaging Galerie Maishofenhomestylinghelena@sbgat Tradlweg Gem Ecgpentz Collection Mich
323 index Magix
evis-handarbeiten.at Magix Made Fivolitocchitatting Arbeiten Jahre Galerie Handarbeiterin Handarbeit Stckhomepage Wissen
324 home Glas
gabriela mayrhofer textil glas kunst design workshop glasperlen...
gabriela-mayrhofer.at Glas Textil Workshop Glasperlen Gabriela Galerie Design Mayrhofer Kunst Cv_kontakthomeprojekte
325 Startseite cart Archiv
c-art.at Archiv Künstler Vorschau Galerie Editionen Prantl Boch Ausstellung Cartprantlcart Z
326 horse balance Z
horse-balance.at Z Tiermasseur Itm Galerie Links Mich Horse Balance Leistungen Reichlnina Derzeit Bearbeitet
327 traude kling | malen Wien
traude kling malen aquarell acryl wien bali galerie ausstellung kunst wien...
aquarell.at Wien Traude Malen Kling Acryl Bali Galerie Kunst Ausstellung Aquarellsehnsuchtmeine |
328 Pix Vibes OT Vibes
pixandvibes.at Vibes Lienz Oc Tirol Kunst Schick Gerhard Pix Galerie Inhalte Ot Freifood Tage
329 sajowitz dachat Startseite Produktpartner
sajowitz-dach.at Produktpartner Jobs Galerie Gtgtdeckungsmaterialsajowitz Gtgtunternehmen Gtgtleistungen Dachat Box Drucken Wwwnetserviceatgtgtkontakt Website
330 Griasenk auf der Gamsalm Gamsalm
Griasenk auf der Gamsalm in Ehrwald...
gamsalm-ehrwald.at Gamsalm Ehrwald Hütte Griasenk Wegnews Wetterstein Alm Winter Sommer Galerie Zugspitzefeiern
331 Willkommen bei der Auhirschpass Auhirschpass
Auhirschpass Krampusgruppe aus Donaustadt...
auhirschpass.at Auhirschpass Grafikfreelancersponsoren Web Galerie Mass Masken Mitglieder Apache Geschichtepfeffer Schnitzen Schnitzer
332 Appartements Ferienzimmer | Haus Helpferer Appartements
haus-reiter-helpferer.at Appartements Helpferer Reiter Ferienzimmer Haus | Appartementabendsonne Kontaktlagezimmer Galerie Preise Wordpress
333 Residenz Zillertal Zillertal Joomla
Joomla the dynamic portal engine and content management system...
residenz-zillertal.at Joomla Zillertal Residenz Content Dynamic Anmeldung Managementsystem Engine Lifestyleportal Galerie
334 MT Medien Home Anfrage
MT Medien Werbeagentur Filmproduktion Personaltraining...
mtmedien.at Anfrage Mt Medien Werbeagentur Filmproduktion Galerie Personaltrainingschenken Kreativitäthome Freude
335 Anna Ballwein Anna
Anna Ballwein...
ballwein.at Anna Ballwein Anfahrt Galerie Gästebuch Album Biographiepöchlarnwiener
336 REITERHOF NAPOLEON Deutsch Wagram Deutsch
reiterhof-napoleon.at Deutsch Reiterhof Wagram Napoleon Anlage Letzte Aktualisierung Galerie Western Preiseleistungen Z
337 Rallye Beifahrer Christoph Friesenegger Christoph
rallye-beifahrer.at Christoph Rallye Beifahrer Friesenegger Gästebuch Fuhrpark Newsfahrergeschichte Ifahrer Galerie
338 Museumsheuriger Mallits Lackenbach Mallits
museumsheuriger-mallits.at Mallits Museumsheuriger Lackenbach Bauernhof Urlaub Galerie Reservierungen Faxpostgasse öffnungszeiten Uns
339 Conspiracy Startseite Galerie
conspiracynet.at Galerie Conspiracy Uns Bitteunserer Austria Httpconspiracyaustriabandcampcom Bearbeitung Kürze Startseite *webseite Die Please Thrashdeathmetal
340 Start TG Security GmbH Events
None...
tgsecurity.at Events Login Mitarbeiter Leistungen Ausbildung Galerie Start Security Gmbh Unsnonetg
341 Afghane Gino Old Shatterhand Gino
Gino stellt sich vor...
afghane-gino.at Gino Afghane Shatterhand Old Bethsheba Letzten Galerie Fotos Ausstellungsergebnisse Disclaimerstellt Neuigkeiten Z
342 Haus Marlies am Keutschacher See Haus
hausmarlies.at Haus Keutschacher See Foto Galerie Route Marlies Toplage Englisch_hausmarliespdf German_hausmarliespdfltlt Gtgt Z
343 Ingrid Berger Berger
Ingrid Berger...
ingridberger.at Berger Ingrid Galerie Kontaktimpressum Ib@ingridbergerat Acryl Mich Illustration Acrylmalereiz Kunst
344 hautzentrumat Hfner
hautzentrum.at Hfner Galerie Shop Zentrum Reinhard Kundenmagazin Einfachgesundheit Hautzentrumat Sthetik Schnheit
345 Tischlerei Lechleitner Tischlerei Lechleitner Tischlerei
tischlerei-lechleitner.at Tischlerei Lechleitner Wohntrume Tischlerqualitttrumen Handwerk Galerie Produkte Arbeitgeben Unseinblick Erleben
346 Home Doppelpack
wm-pongau.at Doppelpack Anmeldung Video Galerie Aussteller Ansehen Gfrererat Wohnenthistischlerei Info@remove Z
347 Z
kitcar.at Z Fury Konfiguration Gebrauchte Faschi Inlineframes Besucher Daten Galerie Browserumbaustatus Forum
348 Pressekarten
stiftskonzerte.at Pressekarten Verein Künstler Team Archiv Hörprobenprogramm [] Kontaktformular Galerie
349 fernitzgrafik | hier drucken profis | |resch
fernitzgrafik.at |resch Grafik Galerie Profis Produkte Fernitz Drucken Fernitzgrafikat Gtgtgt Fernitzgrafikdazu
350 ASKö SV Linz Linz
Alle Infos über den ASKö Schiverein Linz...
askoe-schivereinlinz.at Linz Sekritariat Urlaubswochen Schibasar ] [ Verein Fitness Askö Galerie Events Sv Website Y
351 Rupp Temper Temper
rupp-temper.at Temper Persönlich News Rupp Team Galerie Rennkalender Gehtssponsoren Z
352 ShowIt V2200 Fotos
PHP Bildergalerie zur Anzeige und Verwaltung von Fotos Bildern und anderen Imagedateien...
cc2.at Fotos Showit Gif Found Verwaltung Bildern Imagedateien Bildergalerievorschau Image Anderen Php Galerie
353 Kultur im Dorf Grabern Dorf
kid-grabern.at Dorf News Kultur Galerie Grabern Veranstaltungen Grea Zaktuell Uns Köllagossn
354 fotoheldenat Foto
fotohelden.at Foto Galerie Klub Unser Woche Bild Wwwnetserviceat Neu Gerhardfotostory Box Apaunik Website
355 Wilfried
hedenborg.at Wilfried Hedenborg Hedenborgswilfriedkazuki Music Safari Bottle Copyrightblog Mozillafirefox Galerie Wine
356 Kinderhaus Langenzersdorf Startseite News
kinderhaus-langenzersdorf.at News Galerie Philosophie Kinderhaus Navigation Langenzersdorf Fördereruns überspringen Z
357 Gem Chor St JakobKolbnitz Chor
Gemischter Chor St. JakobKolbnitz...
chor-kolbnitz.at Chor Jakobkolbnitz St Gem Gemischter Sponsoren Galerie Chronikbeim Gemischtenjakob Copy Hauptmenü
358 fotostudio |1 Copyright
fotostudio1.at Copyright Hinweis Galerie Tiere Models Länder Office@fotostudioat|fotostudio
359 We Will Rock You Rock
We Will Rock You...
wewillrockyou.at Rock Will Galerie Band Cast Creative Ben Elton Shop Musical You Tpl_beez_jump_to_navdownloads Presse
360 W E Bullshop
wexx.at Bullshop Itunes Mp Tube Presse Texte Veranstalter Bullneuesvideo Band Videos Galerie
361 Willkommen bei Promotool Promotool
promotool Formenbau Ges.m.b.H...
promotool.at Promotool Werkzeugbau Konstruktion Leistungen Stellenangebote Galerie Partner Fertigung Formenbauuns Qs Din En Formen
362 MYTHOREALISMUS Mythorealismus
Mythorealismus als Architektur...
mythorealismus.at Mythorealismus Architekturapache Archiv Mytho Architektziviltechnikermytho Realismus Port Realpermanently The Galerie Server
363 coro siamo Z
corosiamo.at Z Presseinfo Coro Siamo Sponsoren Pressestimmen Chronik Mitsingen Sponsor Konzertekontaktinformation Galerie
364 ENERGETIK TAI CHI Tai
naturverstand.at Tai Qi Gong Ji Kurse Shaolin Ingrid Austria Galerie Rezepte Anzeigen Tempel Standortenergetik
365 Andrea Edler Home Edler
andreaedler.at Edler Andrea Natur Galerie Mensch Abstrakt Architektur Aktuell Biographie Contenthome Z
366 Startseite Link
brand-art.at Link Lebenslauf Galerie Ausstellungen Künstlerischer Farberights Reservedcopyright Homepage Meiner
367 home Sirisshow
SIRIS Welcome to the SHOW...
siris.at Sirisshow Found The Apache Band Welcome Guestbook Downloadsfound Playlist Server Galerie Port
368 Sophie Berger | Theater | Musical Berger
sophie-berger.at Berger Sophie Film | Demo News Musical Galerie Theater Vita Designtigerwebdesigndesigntigerwebdesign
369 VitaminB Booking Die gesunde Website
vitaminb-booking.at Website Vitaminb Booking Galerie Paradise Myspace Alternative Toursoon Relaunch Gehtsquotgoodbye
370 Galerie Mondsee Galerie
galerie-mondsee.at Galerie Steine Shop Mondsee Uhren Schmuck Trauringe Design Künstler Y
371 Blumen Inge Inge
put a good description in here...
blumen-inge.at Inge Blumenheidi Galerie Uns Good Fürndraht Fuchs Descriptionkg Sortiment Here Engerlwerkstatt
372 Burgenland singt Willkommen Burgenland
burgenlandsingt.at Burgenland Notendownload Singt Projekte Galerie Jahresprogramm Veranstaltung Schickenwillkommen Volkskultur Homepage Z
373 GALERIE CHRISTIAN HOSP Galerie
galerie-christianhosp.at Galerie Hosp Exhibitions Gallery Artists Ausstellungen Christian Künstlerunless Galeriechristianknstler
374 Physio Fit Physio
Homepage of Physio Fit...
fithalten.at Physio Galerie Fit Kurse Team Leistungen Homekontakt Copyright Austria Gesundheitstrainingwels Leistungsdiagnostikhomepage
375 Goldway Home Goldway
goldway.at Goldway Uhren Schmuck Nominationcorner Sackstraepunkte Vitrine Fax+ Galerie Sonderaktion Anfahrt Homegraz
376 Galerie
Willkommen in der Galerie Ihr Name...
schuette.at Galerie Name Ihr Kunst Ausstellen Kunstausstellung Modern Galerien Surrealistischbildergalerie Oel Gemaeldeausstellung Gemaelde Klassich
377 Geometer SchartnerZopp Schartnerzopp
zopp.at Schartnerzopp Geometer Disclaimer Büro Mail Galerie Referenzenhome Nonntalerhauptstr Website Faq Salzburg
378 home dz photo Galerie
dz-photo.at Galerie Hochzeiten Dz Making Personen Diverses Akt Mich Dessous Photo Of Foundbilder Video
379 Residenz Zillertal Zillertal Joomla
Joomla the dynamic portal engine and content management system...
zillertal-residenz.at Joomla Residenz Zillertal Portalengine Content Lifestyledynamic Management System Anmeldung Galerie
380 Malerei Ganglberger Sgraffito Dekorationen Sgraffito
sgraffito.at Sgraffito Malerei Ganglberger Dekorationen Fassaden Bilder Galerie Leistungen Informationenganglberger *unternehmen
381 wwwOfenSchmidat coming soon Uns
ofenschmid.at Uns Galerie Faq Leistungen Coming Krze Ffnungszeiten Systeme Soon Dauerbrandfen Wien Beratungverfgbar Reparaturen
382 Evangelische Volksschule am Karlsplatz 14 Uns
karlsplatz14.at Uns Volksschuleevangelische Klassen Galerie Port Apache Karlsplatz Server Permanently The über Tagesheim
383 Illustration und Comic Comic
heinzwolf.at Comic Wolf Illustration Heinz Publikationen Neues Galerie Jimdo Logoutbearbeiten Bio Druckversionlinks
384 L O K A L M Anfahrt
lokalmueller.at Anfahrt Specials Galerie Philosophie Zeiten Essen Trinken Unsz Kochen ü
385 Home Galerie
signet.at Galerie Home Signet Güngörjoomla Hurricanemedi Joomlatemplates Impressum Templatesceyda Uns
386 Home Innsbruck
Wir sind ein Transportunternehmen mit Sitz in Innsbruck. Feldstrasse 11a 6020 Innsbruck Tel.+43 0 512 342570...
zz-stoll.at Innsbruck Verteilung Lkw Zz Galerie Leistungen Php Transporte +etchzustellung Firmenprofil Karriere Sitz Stoll
387 Victor Schupfer Atelier Galerie K2 Victor
vic-art.at Victor Schupfer Atelier Galerie Lifestyle Tipps Uhr Insider Herzen Sierningvereinbarung Kunst Z
388 AMARTIS kunst + edition Kunst
AMARTIS kunst + edition in wien ......
amartis.at Kunst Amartis Edition Wien Verlag + Vermittlung Beschreibungliebe Gloriettegasse Partner Galerie Z
389 Jolanda Thalhammer Thalhammer
jolandathalhammer.at Thalhammer Jolanda Künstlerische Galerie Entwicklung Adresse Kärnten Steindorfz Sallach
390 Lifestyle House Grundrisse
lifestyle-house.at Grundrisse Galerie Umweltbewusstes Disclaimerlifestyle House Wegbeschreibung Partner Maffay Peterbauen Presseberichte Tafel
391 Aktuelle Angebote Angebote
traumankerstrategie.at Angebote Galerie Strom Mein Akttion Agb Cashback Rolle Autortraumankerstrategieeine Weg Version Bildern Gelangen
392 beislfest Beislfest
beislfest.at Beislfest Cafeacute Paradiso Galerie Gewinnspiel Barrock Lt Eder Gt Underground Vita Egon Romaemmi
393 Prinz Neptun Ore LV Thomas II Ore
prinz-ore55.at Ore Thomas Galerie Ii Bregenzer Archiv Gefolge Christianezugmaschine Blog Faschingsprinz Hackspiel Neptun Prinzen
394 hs fohnsdorfat Willkommen auf der Website Website
hs-fohnsdorf.at Website Schler Galerie Terminkalender Schule Aktivitten Lehrer Fohnsdorf Fohnsdorfat Hsbox Dernmshswwwnetserviceat
395 Home References
beautywerkstatt.at References Business Friends Charity Styling Theater Film Galerie Contactimpressum Menu Beratungworkshops Z
396 Hebamme | Ema Golob Dkweb
hebamme-golob.at Dkweb Golob + Medien Agentur Hebamme Blog Ema Person Email Page Internet| Galerie
397 das Schnibblstudio Schnibblstudio
dasschnibblstudio.at Schnibblstudio Galerie Need Section Text Contained Produkte Note Loading Shows Welcome Update Withinbelow
398 Tennisklub Breitenfurt Breitenfurt
tkbreitenfurt.at Breitenfurt Tkbreitenfurt Tennisklubspielerinfos Meisterschaft Reservierung Neuigkeitenveranstaltungen Galerie Foto Hirschentanzstraße Adresse
399 The Ferry Brothers Color
ferry-brothers.at Color Stadtfest Ferry Musik Ii Band Iii Videos Galerie Buchen Biographieferrybrothers Presse Rockhochzeit
400 Atelier MORI ART Kunst
MORI ART Die Kunst ist eine Vermittlerin des Unaussprechlichen Johann Wolfgang von Goethe atelier@mori art.at...
mori-art.at Kunst Mori Art Atelier Galerie Presse Projekte Enter | Ausstellungen Portrait Unaussprechlichen Johann
401 goldmari galerie interieur Kartenansicht
goldmari.at Kartenansicht Interieur Galerie Kulinarik Goldmari Größerehofer Herrenstraelinz Uid Info@goldmariat Atu Inh
402 Familie Schwaiger Schwaiger
Homepage der Familie Schwaiger...
at-schwaiger.at Schwaiger Familie Dcarter Galerie Mozilocms Apacheeriksalzburg Hans Homepage Port Marlene Server
403 Stainless Design Welcome Pool
pool4you.at Pool | Design Welcome Edelstahl Stainless Galerie Unternehmen Technik Material Wasser Standortfilteranlage Abdeckung
404 offline film editing Offlineenglish
evinnia.at Offlineenglish Film Online@offlinecoat Partner Uns Deutsch Schliemanngasse Hudecek Editing Wien Galerie
405 wwwbergrettung lechat Startseite Bhutan
Bergrettung Lech...
bergrettung-lech.at Bhutan Lech Projekt Mediabase Englisch Bergrettung Lt Wanneinsatzstatistik Gt Menu Hilfe Bergen Galerie
406 Der Schnee am Kilimandscharo | Ab Schnee
Der Schnee am Kilimandscharo Ab 16. März im Kino...
kilimandscharo-derfilm.at Schnee Kino Kilimandscharo Trailer | Ab Presse Inhalt Galerie Kinofinder Thimfilm Im Deutscher Arsenal Y
407 Home Projekte
ehem. Baumeister Karl Freiberger...
freiberger.at Projekte Freiberger Karl Ehem Baumeister Anliegen Projekten Kontaktformular Programmierung Galerie Cms Unsgeht
408 Fun Drachen Kitesportat Fun
fun-drachen-kitesport.at Fun Drachen Kitesportat Sport Thayaprogramm Schutzbekleidung Galerie Agbs Habison Klaus Niederedlitzklaushabison@hotmailcom
409 angel of music Ines Ines
angel-of-music.at Ines Kastenhubermusic Verena Galerie Mich Design Meacuteldesign Repertoire Gäste Partnerangel Audio
410 Weinbau Posch Posch
Weinbau Posch...
posch-weine.at Posch Weinbau Buschenschank Wein Uns Produktefamilie Weinkeller Eingang Flaschenweinverkauf Bildern Galerie Informationpresse
411 Cheerstixx Individuelle und günstige Gtgt
cheerstixx.at Gtgt Kandinsky Anfrage Galerie + Cheerstixx Datenschutzhinweise Gt Corporate Faq Leer Ltzurück Agb Classic Y
412 Ecco Arte Aktuell Arte
ecco-arte.at Arte Ecco Aktuell Präsentationen Webmeisterin Publikationen Solutions Retrospektive Galerie Web Copyrightrechte Rs Z
413 Werner Oskar Jilge Werner
woj werner oskar jilge selbstdarsteller wien langenzersdorf...
werner-oskar-jilge.at Werner Jilge Galerie Oskar Mail Lebenslauf Woj Langenzersdorf Club Wien Selbstdarsteller Fan Pauseansonsten
414 Naschkatzerl Naschkatzerl
Naschkatzerl cafe Konditorei Catering 1210 Wien...
naschkatzerl.at Naschkatzerl Catering Wien Rechtliches Konditorei Lokal Karte Galerie Cafe Zwillkommen Mitterhofergasse
415 RS DEFENSE Willkommen || Defense
RS DEFENSE Willkommen Jeder kann sich verteidigen Selbstverteidigung beginnt im Kopf...
rs-defense.at Defense Rs Selbstverteidigung Angebot Uns Galerie Veranstaltungen Wien Agb Kopf Port Apache Maga Jeder Y
416 Move and Dance Salzburg Salzburg
moveanddance.at Salzburg Team Galerie Dance Foto Kurse Move Glanfeldstrae Andreaz Tanz Stipkovits
417 ==== eBosco Blumen
ebosco.at Blumen Sinne Privatkunden ==== Galerie Produkte Firmen Dauerauftrag Servitengasse Handels Naturdarauf Freuen Uns
418 MC Dagles Lembach Home Lembach
mc-dagles.at Lembach Dagles Mitglieder Galerie Clubgeschichte Clubdienste Beim Mchome Gästebuch Gstebuch Z
419 Ihr Hausbetreuer Home Joomla
Joomla the dynamic portal engine and content management system...
hausbetreuung-zoechling.at Joomla Login Jobs Hausbetreuer Hausbetreuung Galerie Engine Unternehmen Dienstleistungensystemihr Dynamic Angebote
420 Clowntown Clowntown
clowntown.at Clowntown Galerie Arbeit Philosophie+methodetrumen Flexibilitt Sensibilitt Uns Einfachheit Kindernaktiv Zuhren Spielen
421 Cabanova
club-excited.at Cabanova Sponsoren Galerie Club Disclaimer Gästebuch Treffen Adresse Markenoffenenclubmail Powered Z
422 irene dworak Dworak
irene dworak...
irene-dworak.at Dworak Irene Galerie Ausstellung Philosophie Biographiegeheimes Dorowin Links Geheimensprache Kandinsky Wassily
423 APP Der Autoputzprofi Eferding
Professionelle Autoreinigung in Eferding...
autoputzprofi.at Eferding Zurück Preisliste App Autoputzprofi Seiteninhalt Pflege Privatkunden Reparatur Apacheserviceinfo Galerie Uns Anfahrt
424 Acrylbilder | Ilse Schill Acrylbilder
ilseschill.at Acrylbilder Ilse Schnering Schill Galerie Cafe Regina Traun Ausstellung | Lge Savedriveadorno Moser
425 Detailing Art Et
L art du Detailing Valeting...
dtail.at Et Les Commentaires Detailing Afficher Membres La Masquer Art Galerie De Le Ma Annonces Conseils Moteur Polish Microfibre
426 Home Galerie
winter-garten.at Galerie Firma Zirbenbetten Hörmansdorfer Neu Auberg Stiegenbau Sabine Rtischlereisfeld Tischlereihome Email
427 Dürer GesmbH Home Z
duerer.at Z Transporte Erdbau Office@duererat Galerie Kfz Anfahrtsplan Dürer Firmengeschichte Recyclingwerkstätte Gesmbh
428 wwwzypresseat Galerie
zypresse.at Galerie Speisekarte Zypresse Wwwzypresseatpartyservice Zypresseat Westbahnstrae Spezialitten Wien Geffnet Telefon Restaurant
429 American Passages Passages
American Passages Ein Film von Ruth Beckermann...
americanpassages.at Passages American Beckermann Film Ruth Presse Kinofinder Gewinnspiel Inhalt Galerie Trailerdokufilmladen
430 Allram Mobilheime und Gartenhäuser Tischlerei Meisterbetrieb Mobilheime
frewo-mobilheime.at Mobilheime Gartenhäuser Prospektpreisliste Galerie Waldviertel Tischlerei Langaumeisterbetrieb Allram Tischlerleistungen
431 Am Ende des Tages | Ab Ende
Am Ende des Tages Ab 26. August im Kino...
amendedestages.at Ende Kino Tages Ab | Galerie Besetzung Kinofinder Inhalt Presse Musikvideo Unterberger Filmschwarz
432 Galerie Raum mit Licht Galerie
raum-mit-licht.at Galerie Kuenstlerinnen Vorschau Sommerpause Licht Text News Raum Rueckblickz English Ausstellungen
433 Lipstixx Individuelle Lippenstifte als Gtgt
lipstix.at Gtgt Lipstixx Galerie Anfrage Kandinsky + Classic Leer Werbeartikelenglish Produkte Faq Lippenstifte Empfehlen
434 Austrian Fine Art Galerie
austrianfineart.at Galerie English Aktueller Katalog Werke Künstlerindex Austrian Ankauf Fine Uns Knstlerindexpresse Art
435 MV Heimatklang Puch Puch
musikverein-puch.at Puch Heimatklang Kontakte Galerie Musiker Chronik Mv Design Floadschwarzesbrett Administration Gästebuch
436 Malerei Fina GmbH Standort
malerei-fina.at Standort Malerei Galerie Fina Leistungen Partner Team Agb Wissenswert News Meisterbetriebbildergalerie Uns Homeimpressum
437 melmalt Kunststation
Melitta Schischma und ihre künstlerischen Tätigkeiten...
melmalt.at Kunststation Melmalt Schischma Melitta Aktuell Werkzeugbilder Mel Galerie Fruchtfleisch Angern Pianospielerin Rochusbergmalt Ka
438 Lifestyle House Galerie
tabaluga-haus.at Galerie Grundrissebauen Partner Wegbeschreibung Peter Presseberichte Tafel Maffay Lifestyle Houseumweltbewusstes Disclaimer
439 Hia Do Brass AKTUELLES Brass
hiaunddobrass.at Brass News Hia Performances Do Kirchenkonzert Aktuelles Galerie Golling Abend Stadtpfarrkirche Hallein Archivrepertoire
440 Restaurant Galerie Tanglberg Willkommen Restaurant
tanglberg.at Restaurant Tanglberg Galerie Admin Lageplan Willkommen Acp Presse Speisekarte Fotogaleriegästehaus Z
441 Home Unternehmen
auertransporte.at Unternehmen Fuhrpark Produkte Maschinen Anfahrt Galerie Informierenhandel Kiesgewinnung Erdarbeitenbagger Webseite Mietwagen
442 Startseite provitalis Webseite Provitalis
provitalis.at Provitalis Unser Shop Angebot Galerie Publikationenpresse Reisen Webseite Tipps Jimdo Logoutprovitalisatedeltrud
443 Home Cindys MaineCoon Homepage
nbsp...
cindys-mainecoon.at Homepage Cindys Do Yourself Mainecoon Druckversion Login Galerie Cindy Gästebuch Uns Offspringshome Logout
444 mahrenbrandat Lucas
mahrenbrand.at Lucas Michael Galerie Kopecky Informationen Andrea Andreasturm Dr Website Inhalt Mahrenbrandatz Sturm
445 Start Erlebnisbauernhof Redlberger Request
erlebnisbauernhof-redlberger.at Request Nginx Login Enter Uns Infotage Panoramen Erlebnis Tiere Galerie Erlebnisbauernhof Naschgartenerlebnisspielplatz
446 Klassik in den Alpen Tickets
nbsp...
klassikindenalpen.at Tickets Hausordnung Galerie Künstler Klassik Programm Presse Agbalpen Alpen * Nbsp Z
447 H W H A T Handwerkshaus
hwh.at Handwerkshaus Galerie Events Firmen Oberndorf Anfahrt H Fläche Konzerte Lesungenobjekt Kunstausstellung Beim Los
448 BastArt Galerie Rahmungen Rahmungen
bast-art.at Rahmungen Galerie Dekoratives Bastart Konzept Team Strasse Josefstdtermo Contact Frstrozzigasse Uns Wien
449 Bassena Badmanufaktur Förderungen
bassena-bad.at Förderungen News Leistung Leitbild Traumbad Badmanufaktur Galerie Bassena Ihr Alt Altmach Machbad
450 Klassik unter Sternen Nbsp
nbsp nbsp nbsp...
klassikuntersternen.at Nbsp Galerie Klassik Hausordnung Programm Künstler Tickets Sternen * Unter Pressesternen Agb Z
451 Basecaps Bedruckte oder bestickte Gtgt
classiccaps.at Gtgt Galerie Anfrage Caps Kandinsky Classic + Datenschutzhinweise [x] Bookmarken Leer Corporate Werbemittelpromo
452 Bikecenter Mulzet Mulzet
mulzet.at Mulzet Gebrauchtfahrz Team News Unser Bikecenter Galerie Bossttheneufahrzeugegästebuch Boss
453 Home Httpvuadminvservmenkisysdeimagesfahrradmessedscjpg
sportundservice4you.at Httpvuadminvservmenkisysdeimagesfahrradmessedscjpg Link Orange Blue Sportserviceyou Green Galerie Pichelbauer Langlauf Uns Verleih Gaverngavernframework
454 ju Q lu party Juli
juqlu.at Juli Galerie Sponsoren Juweissenkirchen Lu Aufgepasst Clubbing Wachauhalle Feuerwehr Flashoverclubbingteam Party Flashover
455 Heribert Michl Heribert
Heribert Michl Vita Galerie Ausstellungen Kontakt...
heribertmichl.at Heribert Michl Kunst Ausstellungen Ausstelunggraz Museen Malerei Bildendegruppe Vita Galerie Museum
456 Marktmusikkapelle Peilstein Home Galerie
mmk-peilstein.at Galerie Jugendorchester Geschichte Verein Marktmusikkapelle Peilstein Login Medien Backend Sitemapnbsptypo Javascript Z
457 Pferdeflüsterer Harry Kaldasch +
pferdefluesterer.at + Kaldasch Harry Galerie Kontaktimpressum Pferdeflsterer Preise Kurseausbildung @ Documentwritewersfelden Pferdeflüsterer Uns Z
458 Keychains Individuelle Schlüsselanhänger als Gtgt
xn--schluesselanhnger-2qb.at Gtgt Anfrage Galerie Straps Metall + Kunststoff Keychains Kandinsky Datenschutzhinweiseanfragenkorb Agb Version Website
459 TU Ball Karten
tu-ball.at Karten Geschichte Deutsch Galerie Anfahrt English Ball Saalplan Musikprogramm Eröffnen Tuz
460 KFZ Meisterbetrieb Dolinar Leistungen
dolinar.at Leistungen Gebrauchtwagen Galerie Kfz Meisterbetrieb Gallerie Dolinar Vielen Copyright Fax Mobil Dankanschrift Nachricht
461 Budocenter Featured
budocenter.at Featured Galerie Eventanfrage Allgemein Location League European Cev Volleyball Datenbudocenter Technische Events Z
462 Luftbildservice Redl Redl
luftbildservice.at Redl Luftbildservice Galerie Technik Produkte Leistungen Video Gebiet Animationen Dokumentation Luftbilddokumentationen
463 schwarzundweissat Joomla
Joomla dynamische Portal Engine und Content Management System...
schwarzundweiss.at Joomla Schwarzundweissat Kontaktimpressum Dynamische Galerie Content Management Mich Portal Systemz Engine
464 Holzbau Gobauer Home Holzbau
holzbau-gobauer.at Holzbau Paletten Gobauer Philosophie Galerie Zufriedenheit Von Terassenbden Holzrahmen Preis Bis Home * Pergolaeinreichplanung
465 Gästebuch
gabi-brauchl.at Gästebuch Galerie Information Standort News Port Grafrizz Designedserverapache Content Permanently The
466 Home | Die Almhütte auf der Uns
Hier können Sie schnell und einfach einsehen wann unsere Hütten verfügbar sind und buchen. Oder Sie rufen uns...
almhuette-kaernten.at Uns Sommer Found + Einfach Schnell Server Anzeigen Galerie Almdorfeinsehen | Hütten Apache
467 Blumen Galerie Gršbming Blumen
Blumen Galerie DER Florist in Gršbming und Umgebung...
blumen-galerie.at Blumen Galerie Gršbming Mezhochzeit Umgebung Floristik Trauer GŠrten Deko Anita Poschflorist
468 Sonntagalm Trattenbach Sonntagalm
sonntagalm.at Sonntagalm Anreise Galerie Trattenbach Alm übernachtenösterreich Mob Bruer Hansvenedigerstrae Neukirchen
469 New Materia Startseite Materia
newmateria.at Materia Galerie Songs Band News Videos Newnewcomer Award Schlachthof Austriantourdaten Untersttzung
470 Zorn Versicherungsvergleiche Home Versicherungsvergleiche
vbzorn.at Versicherungsvergleiche Zorn Leistungen Galerie Kfz Schadensmeldung Formulare News Offertanfragen Office@zornst Content Uns Fax
471 Ordination Dr Hoheneder Home Hoheneder
Dr. Franz Hoheneder Hausarzt am Wallhof...
hoheneder.at Hoheneder Dr Ordination Joomlaleistungen Praxisteam Mich Franz News Anfahrtsplan Hausarztphilosophie Galerie Wallhof
472 Beart Homepage von Beate Ausstellungen
buntebilder.at Ausstellungen Kunst Lukas Wernhart Schmunzeln Pawek Beart Galerie Beate Homepage Michpressecodingkontakt
473 Heimat | Hofkäserei Schörgerer Oberndorf in Heimat
Heimat Schörgerer Andreas Lindner Liebe Leidenschaft regionale Zutaten Bio Bauernhof Oberndorf in Tirol Austria Genuss Bio Natur...
schoergerer.at Heimat Oberndorf Schörgerer Bio Uns Tirol Regionale Bauernhofserver Andreas | Neues Genuss Galerie
474 Von der Ehrenfeste Z
ehrenfeste.at Z Land Erfolge Geschichte Wildsteiger Ehrenfeste Bilder Galerie Paarungen Zucht Nachwuchs Verkauf
475 Willkommen Lachwanderngeniesser
lachwandern.at Lachwanderngeniesser Angebot Familien Lachyoga Heiterkeit Sät Aktualisierung Lebensfreudeernten Firmen Letzte Galerie
476 Mitglieder
armati-domini.at Mitglieder Termin Galerie Rss Wissenswertes Port Found The Domini Tec Uns Piding Mittelaltermarkt Nethosting Home
477 Steinmötzger KEG Profil
steinmoetzger.at Profil Steinmtzger Galerie Steinmötzger Produkte Angebot Keg Vergngen Internetseitefragen Beratung Z
478 Mag Nicolae Marinica Home Nicolae
Mag. Nicolae Marinica...
marinica.at Nicolae Mag Marinica Galerie Lebenslauf Intro Skulptur Gedchnis Bildhauer Marinicabildhauer Memoriammagkant Lieben Z
479 Our Adventures Adventures
Klemens und Denise unsere Reise Abenteuerwelt...
our-adventures.at Adventures Denise Klemens Galerie Abenteuer Gstebuch Reise Abenteuerwelt Copyright Gästebuchuns Z
480 Salsastudio Home Salsa
Salsa Studio...
salsastudio.at Salsa Salzburg Sbg Events Workshops Salsastudio Galerie Salsasbg Salsaclub Gt Schatzkammer Club Seitgrnder
481 JVP Faistenau Vorstand
jvp-faistenau.at Vorstand Jvp Gnu Gauderfest Neues Registriere Passwort Galerie Aktivitäten Eventkalender Fusion Php Gplfaistenau
482 Michael Gindl Weinviertel | Galerie Buteo
mgsol.at Buteo Michael Gindl Galerie Weine Weingut Flora Sweet Aktuell Weinviertel Marktplatzhohenruppersdorf | Z
483 Zierkies der Blickfang für Zierkies
Zierkies der Blickfang für Blumenbeete Parkanlagen Zufahrten......
zierkies.at Zierkies Blickfang Zufahrten Blumenbeete Parkanlagen Garten Beschaffenheit Kontaktzierkiesgestaltungselementeschmckern Homepage Viel Galerie
484 KFZ Service Innsbruck Tirol | KFZ Kfz
Kfz Service Best Box zu Innsbruck in Tirol KFZ Werkstatt für alle Marken und Reifen und Alufelgen Handel...
kfzservice-bestbox.at Kfz Innsbruck Tirol Reifen Best Galerie Aluräder Handel Box Werkstatt Lesen Alufelgen Autowerkstatt Uns |
485 Keramikatelier Ne382ika Agnes Novak Novak
novakart.at Novak Keramikatelier Neika Slovensko Galerija Agnes English Gallery Deutsch Galerie Belaart Z
486 TPE News News
tribal project eventmanagement...
tribal-project.at News Tpe Tribal Project Partner Weblinks Multimedia Team Galerie Presse Vorschau Dj Eventsltlt
487 Home Hirschwell
discogig.at Hirschwell Gig Event Location Pizzeria Hit Roma Shuttle Galerie Rapper Cubes Amstetten Oktoberfestbier
488 Willkommen auf der Startseite Spg
SPG WeitersfeldenKaltenbergLiebenau Ein Team...
spgwkl.at Spg Sfeldenkaltenbergliebenau Galerie Leitbild Gästebuch U Joomla Cssreserve Ende Team Liebenau Sfelden
489 BFD die starke Werbeidee HOME Werbeartikel
Ihr kompetenter Partner für Werbemittel Werbeartikel...
bfd-werbeidee.at Werbeartikel Werbeidee Werbe Anbringung Schauraum Galerie Bfd Referenz Werbemittel Ihr Kompetenter Feuerzeuge Textil Atu Y
490 cafe bar lounge cabalo Goritz
cabalo cafe bar lounge in deutsch goritz...
cabalo.at Goritz Deutsch Cabalo Lounge Cafe Bar Cocktails Flammkuchen Bio Galerie Jimdo Logout Uns Säfte Y
491 Salzburgring
IGM Salzburgring 5325 Plainfeld...
salzburgring.at Salzburgring Reiner Plnefahrtraining Igm Streckeninfos Vip Galerie Karten Ansprechpartner Motorrad Rennen Automobil Version
492 Home Preise
studio-elegance.at Preise Anfahrt Nagelstudio Ausbildungs Gästebuch Galerie Ausbildungen Studioelegance Wwwdiehome Zachsdedesigned
493 ENERGETIK TAI CHI Gong
naturverstand.at Gong Qi Tai Kalender Standort Chi Energetik Tempel Wwwnaturverstandat Copy Ingrid Bilder Kurse Galerie Y
494 Alexander Kaimbacher Kaimbacher
alexanderkaimbacher.at Kaimbacher Alexander Login Medien Deutsch Galerie Biografie Repertoire English Kalender Downloadsy
495 traude kling | malen Wien
traude kling malen aquarell acryl wien bali galerie ausstellung kunst wien...
malen.at Wien Malen Traude Kling Kunst Ausstellung Galerie Bali Acryl Aquarell Meine| Sehnsucht Z
496 Home Sportverein Fiss Ihr Fiss
SPV Fiss Ihr Sportverein im tiroler Oberland www.spv fiss.at...
spv-fiss.at Fiss Sportverein Oberland Tiroler Verein Spv Galerie Kontaktformular Wwwspv Fissat Artikel Ansicht News Ihr Eco
497 Über uns Kachelofen Bau Georg Schlöglhofer Kachelofen
sg-ofenbau.at Kachelofen Georg Bau Schlglhofer Uns Produkte Ganzhausheizung Wellness Galerie Marien Willkommen Seit Baustellen Kundenperfektphilosophie
498 Rotary Club Telfs Seefeld Seefeld
rc-telfs-seefeld.at Seefeld Stadlfest Advent Xgolftrophy Telfs Seefelder Rc Galerie Rotary Club Wildmoos Partnerbetriebesponsors Gallery
499 Simmeringer Haidechor Veranstaltungen
simmeringer-haidechor.at Veranstaltungen Pressebilder Galerie Verein Haidechor Simmeringer Mach Geschichte Hörproben Bildtonträger
500 Startseite Kleingartenverein Gartenfreunde 12 Gartenfreunde
gartenfreunde12.at Gartenfreunde Vereinsgeschichte Linktipps Kleingartenverein Statuten Vereins Vereinsleitung Galerie Logout Sommerfest Jimdohomepage Bearbeiten Y
501 Baden in Weiß Baden
badeninweiss.at Baden Weiß Kommen Wir Vielen Fürs Dank Galerie Presse Design Midnight Weiss Eventumsetzung Z
502 Home Joomla
Joomla dynamische Portal Engine und Content Management System...
fritzheininger.at Joomla Fritz Presse Art Galerie Ausstellungen Biografie Malerei Login System Managementdynamische Wien Content
503 httpwwwmario ederat Galerie
Homepage von Mario Eder...
mario-eder.at Galerie Eder Mario Design Level Welcome Wiest Dennis Paragliding Parameter Ederat Homepage Templategleitschirm
504 freudeamlebenat Kurzbungen
freudeamleben.at Kurzbungen Energiearbeit Galerie Personen Resonanz Nlp Fhigkeit Freudeamlebenat Zeit Jedes Ortreiki Problem Coaching
505 buymanat photography by andreas Galerie
buyman.at Galerie Sport Infrarot Makros Ovh Natur Tiere Technik Fotografien Menschen Kaufmannandreas Galerien Panoramen
506 News springrock racings Webseite News
springrock-racing.at News Presse Partner Permanently The Springrock Webseite Racings Server Team Apachevereinsinfo Port Galerie
507 City Poker Poker
City Poker Die Alternative in Wien...
citypoker.at Poker City Citypoker Wien Galerie Spalte Fan Zweiten Wechseln Lugnerport Alternative Ersten Permanently The
508 RICHARD CONRAD Richard
richardconrad.at Richard Conrad Musik Galerie Gedichte Fotos Kontakt Intro überspringen Poweredhomepage Home Z
509 Cafe Bar Old Splendor Cafe
cafe-oldsplendor.at Cafe Splendor Getränke Snacks Themes Wordpress Allgemein Powered Old Club Galerie Fan Wienspectacula
510 Home Friedrich Kleinhapl Friedrich
kleinhapl.at Friedrich Kleinhapl En Portrait Galerie Musik Projects Special Downloads Diskographie Presse News Repertoirepartner
511 Hörstudio Maria Schobel Home Leistungen
wirhelfenhoeren.at Leistungen Produkte Request Galerie Tinnituszentrum Video Neuheiten Source Error Schobel Uns Hörstudioopen Cms
512 Rebensthein Rebensthein
rebensthein.at Rebensthein Wordpresscom Ten Port Server Galerie Apache Angebote Found Anfahrt Bild Hinterlasse Inhaltfound The
513 Klub Kragujevacki Kragujevacki
Copy Cut Klub kragujevacki serbien serben Mattersburg Österreich Burgenland...
klub-kragujevacki.at Kragujevacki Klub Copy Galerie Österreich Burgenland Serben Serbien Mattersburg Cut Sponsorensonstiges Bilder Z
514 Julia Svoboda Photography Julia
Julia Svoboda Photography Fotografie Web Design...
julia-svoboda.at Julia Svoboda Design Web Galerie Photography Retusche Henri Seele Photographyfotografie Photographie Schibratauge Bresson
515 KOGLERSPORT Reservierung
koglersport.at Reservierung Preisliste Ski Information Galerie Artwork Koglersport Snowboardrental Hestra Depot Snowboardschi Anon Red Impressum
516 Müllnerbau Müllner Bau Angebote
n...
muellnerbau.at Angebote Bau Müllnerbau Apache Permanently The Port Sanierung Hofer Adeg Galerie Dm Gebude Php +etchmllner
517 Willkommen exaktesat Spenglerei
Spenglerei Exaktes...
exaktes.at Spenglerei Exaktes Schön Exaktesat Spezialist Küng Bauspenglerei Galerie Dachwartung Abdichtungbildereinen Einblick Freundlich
518 Startseite Installateur Erwin Hafner Neuigkeiten
Startseite von inst hafner.at Home...
inst-hafner.at Neuigkeiten Jobs Galerie Leistungsspektrum Partner Installateur Hafner Error Erwin Besucher Bisherinst Cmsday Z
519 MK Franking Startseite Franking
Willkommen auf der Homepage der Musikkapelle Franking...
mk-franking.at Franking Mk Musikkapelle Foto Galerie Chronik Vorstand Found The Foundlaquo Musik Server Dirigierworkshop Apache
520 Startseite blackmoonranchs Webseite Moon
blackmoonranch.at Moon Ranch Black Uns Webseite Pferde Horsemanship Philosophie Seele Galerie Sponsorenprojekt Click Partner
521 Team Just4Fun Team
Team Just4Fun Weil der Spaßfaktor zählt Die Team Seite von Liebhabern des lauten Basses...
teamjust4fun.at Team Justfun Db Galerie Klicke Drag Bilder Designsserver Found The Terra Wettbewerb Bassrace Dezibel
522 etainment etainment Musik
etainment.at Musik Galerie Eventplanung Etainment Ganz Tainment Frageneinfach Webproficc Unseventargentur Willkommen Fragen Antwort
523 Sportfotos Andreat Sportfotos
sportfotos-andre.at Sportfotos Fotos Andreat Galerie Andre Foto Sport Urheberrechtinformationen Sportfoto Walter Innsbruck Verwendung
524 traude kling | malen Wien
traude kling malen aquarell acryl wien bali galerie ausstellung kunst wien...
kling.at Wien Kling Malen Traude Aquarell Galerie Acryl Bali Ausstellung Kunst Meine Sehnsucht| Z
525 Katrin Koch hairdesign Koch
katrinkoch.at Koch Katrin Partner Anfahrt Uns Galerie Designed Stylisten Nehmen Seiten Kontakt Rightszeit Einblick
526 Futus Futus
FUTUS Energiesysteme GmbH...
soplex.at Futus Energiesysteme Regelung Regelungs Team Galerie Request Produkte Steuerung News Anfahrterror Steuerungssysteme Rss
527 Cafe Frauenhuber Startseite Galerie
cafe-frauenhuber.at Galerie Chrome Found The Frauenhuber Chronik Different Tischreservierung Install De Portapache Reservieren Browser Office@cafefrauenhuberat
528 techfloorat Home Unternehmen
techfloor.at Unternehmen Leistungen Galerie Techfloor Techfloorat Mischpumpe Arbeit Betonsanierung Estrich Gewerbe Schnelligkeitmenu * Industrie
529 Galerie IMPACT Galerie
Galerie IMPACT Jutta Hutterer Austrian Art...
galerie-impact.at Galerie Impact Click Austrian_art Gallery Aquarell Wien Paintings Kunstwiener_neustadt Art österreichische_kunst Here Water_painting
530 Home Leistungen
compactgardenliving.at Leistungen Team Innovation Agbs Galerie Wohn Nutz Compactgardenliving Wirgarten Konzepteinterdisziplinär Entwurf Z
531 Startseite Spö
spoe-leonding.at Spö Leonding Abg Los Uns Eu Parlament Nationalrat Land Archiv Ortsgruppen Galerie Landesregierung – Bundesrat Angenommen
532 In Aut Jugendreisen Joomla
Joomla dynamische Portal Engine und Content Management System...
inout.at Joomla Web Systems Easy Jugendreisen Vereine Artisteer Reiseveranstalter Informationen Galerie Angebot Tourismus Liebe Aut
533 BubbleSeat Die sportliche Innovation Gtgt
bubble-seat.at Gtgt Bubbleseat + Kandinsky Bookmarken Galerie [x] Datenschutzhinweise Empfehlen Anfrage Ltzurück Gt Leer Version Y
534 K12 GALERIE |
Galerie für Gegenwartskunst K12 Bodensee Artclub Galerie für internationale und österreichische Kunst des 20. und 21....
k12galerie.at | Galerie Gegenwartskunst Marxx Artclub Bosch Kunst Bodensee Internationale Kunstgalerie Bregenzwerner Artcomk_indexhtm Bildende
535 Hundesalon HUND HAAR Hund
Hundesalon Hund Haar immer für Sie da...
julias-hundesalon.at Hund Hundesalon Haar Salon Hundehaare Entwollen Galerie Da Haare Schillab Trimmen Julias Immerpreise
536 Official Stylo Site Band
stylo.at Band History Benutzername Stylo Passwort Official Galerie Heimarbeit Blog Mich Administrationangemeldet Amazon Z
537 Smart4Art Value
Smart4Art...
smart4art.at Value Services Added Kunsttrans Smartart Kub Ansicht Logistik Vieartport Galerie Wwwkunsttranscom Auktionshaus Bitte Kauf Art
538 Startseite Preise
kindernest-waidring.at Preise Sicherheit Team Kleinkinderzwischen Kindernestgibt Jahren Galerie Kinder Kind Tagesablauf Rituale Orientierunganmeldung
539 Start ESSbar essen trinken mitnehmen Essbar
None...
essbar-traun.at Essbar Trinken Essen Team News Galerie Login Traun Mitnehmen Downloads Mittagsteller Panoramen | None Y
540 Willkommen Organisation
kinderwinkel.at Organisation Partner Galerie Team Sponsoren Paumldagogik Montessori Grätschenwinkelkinderwinkel Wild Kinderwerkstatt Pikler Z
541 Morrigain Auftritte
morrigain.at Auftritte Galerie Tanz Archiv Morrigain Unterricht Biografie Workshops Sagya Restaurant Liechtensteinstrasseauftritt Uhr Wien
542 Bobby Car EM 2011 Bobby
bobbyrace.at Bobby Rennen Bereits Thomas Galerie Partner Em Car Anmeldung Rahmenprogramm Schirgi Permanently Theunterkunft Read
543 Home Porsche Austria Gesellschaft Ausstattung
porsche.at Ausstattung Daten Galerie Porsche Dialog Detail Car Im Gebrauchtwagen Notice Configurator ökologisierungsgesetz Co Individualisierung Mbh
544 Steinhandel Galerie
stein-handel.at Galerie Steinhandel Gelangen H=cm Gartengestalltung Bodenplatten Lampen Alexanderhaindl@stein Baustoffe Fensterbnke Handelat Shopprchen B=cm
545 Index Sanierung
suschnig-parkett.at Sanierung Verlegung Parkett Bautrockung Galerie Profi Bautrocknung Boden Professionell Uns Parkettprofi Servicezu Zielschonende
546 bibern31 | Neue Galerie + Studio Galerie
bibern31.at Galerie Bibern Seitenanfang Studio Fotostudio Hide Direkt Weihergut Christineschnoellartworkscom Contentweihergut + Hauptmenü
547 Home News
Carpers and Friends...
carpersandfriends.at News Galerie Berichte Weblinks Tackletests Team Carpers Unserer Homepage Unspetri Maxe Friends Z
548 Start Kfz Reiter Rene GmbH Kfz Bosch
None...
kfz-reiter.at Bosch Kfz Reparatur Reiter Rene Servicemeisterbetrieb Downloads Büro Car Galerie Panoramen News Leistungen Login Uns
549 Galerie Feurstein Raum aktueller Galerie
galeriefeurstein.at Galerie Feurstein Mob Kunst Feldkirch Raum Vereinbarung Aktueller Juliaugust Rauminstallation Copythierry Strhle Kreuzgasse
550 Home Malschule Pigneter Pigneter
malschule.at Pigneter Tirol Johann Malschule Kurs Fotos Reservierung Kurstermine Rudolph Email Bilderuns St Galerie
551 Monika Dorninger Dorninger
monika dorninger malerei...
monika-dorninger.at Dorninger Malerei Monika Maler Venedig Acryl Ausstellungen Akt Zeichnung Galerie Homepage Toskanaburgenland Landschaft
552 BubbleSeat Die sportliche Innovation Gtgt
bubble-chair.at Gtgt Bubbleseat + Kandinsky Corporate Galerie Faq Leer Datenschutzhinweise Version Sportliche Ltzurück Innovationbookmarken
553 ESV Krottendorf Esv
esv-krottendorf.at Esv Krottendorf Chronik Vorstand Mannschaften Ergebnisse Galerie Mariostefan Weingartmannund Patrick Besonderen Herzlichste Schwarzl
554 91EsV93 Clan News News
esv-clanpage.at News Team Clan Esv Fightus Userliste Newsarchiv Forum Galerie Sponsoren Joinus Einsenden Archivlinkus
555 stornig artat NEWSNEWSNEWSNEWSNEWSNEWSNEWSNEWSNEWSNEWSNEWSNEWS Stornig
stornig-art.at Stornig Inge Artat Newsnewsnewsnewsnewsnewsnewsnewsnewsnewsnewsnews Gemeinschaftsausstellung Ausstellungen Galerie Homepage Graz Knittelfeld Nov Acrylarbeitenernst Schnecker
556 wwwetenhoferat STARTSEITE Design
ETI DESIGN Ihr Partner in Sachen EDV...
etenhofer.at Design Planung Software Eti Controlling Training Alarmanlagen Beratung Telefon Web Intern Galerie Wwwetenhoferat Sicherung Edv
557 STEWA Holzfachmarkt Stewa
stewa-holz.at Stewa Holzfachmarkt Galerie Downloads Dienstleistungen News Produkte Holzprofi Weltder Heusswort Uns Mrchen Gehen
558 Stranig Reaktiv Sporttherapie Rehabilitation
stranig-reaktiv.at Rehabilitation Reaktiv Stranig Praxis Galerie Sporttherapie News Mitarbeiter Prophylaxe Leistungen Diagnostik Koordinationz
559 A B A Home Joomla
Joomla the dynamic portal engine and content management system...
bonsai-austria.at Joomla Newsevents Contact Aba Gallery Clubs Ebaesa Downloads Organisation Convention Galerie System Neuestelastportal
560 Farben Bau | bau malerei Levitra
farbenbau.at Levitra Galerie Buy Sanierung Visit Farben Hits Trockenbau Renovierung Bau Generic Aushub Abruch Pharmacy |
561 WM SOUNDS Tour
WM Sounds Egal ob Maturabälle Zeltfeste Hallendiscos Open Airs oder Firmenfeiern WM SOUNDS ist...
member-card.at Tour Wm Sounds Dj Sound Paket Disco Partner Djs Balldisco Galerie Gästebuch Video Steiermark Sa
562 Bechter Installationen Bechter
bechter-installationen.at Bechter Team Javascript Leistungen Galerie Partner Geschichte Installationen Gesellschaft Websitekontaktaufnahme Solar Bregenz
563 bm bodendesignat Produkte
bm Bodendesign Mittermayr...
bm-bodendesign.at Produkte Kautschuk Parkett Unternehmen Laminat Mittermayr Linoleum Bodendesign Galerie Gummi Bm Teppich Teambodendesignat
564 christophknappat | Radio TV Moderator
christophknapp.at Moderator Christophknappat Radio Tv Proudly Tirol Wordpress Mediathek Unterwegs Inhalt Galerie Life |stadionsprecher
565 Startseite mit laufendem Fototaustausch Fotos
sindbad137.at Fotos Fototaustausch Lieblingsfotosfrühere Sindbad Gedanken Geschichten Foto Geschriebene Galerie Laufendemcopyright Startseiten
566 miro LOGISTIKSYSTEME GmbH Gmbh
miro-mobil.at Gmbh Galerie Produkte Logistiksysteme Ihrebedrfnisse Bord Hotline Jahren Einrichtungskonzeptbesuchihr Bereichfahrzeugeinrichtung Veinbarung Miro
567 KlangGut Klanggut
klanggut.at Klanggut Idee Galerie Programme Veranstalter Gut“ Musikhauptstädte Welthinausbedarf Forum Presse Klavier
568 Startseite Work
gamsriegl.at Work Zucht Galerie Newssimone@gamsrieglat Hunde Welpen Labradorzucht Simone Oberberguns Schmiedtbauer Link
569 Fotografie Maximilian Plöderl Fotografie Plöderl
Foto Plöderl Max Aschach Donau...
max-ploederl.at Plöderl Fotografie Aschach Maximilian Donau Max Permanently The Galerie Interessantes Photoshop Apachefoto Server
570 Galerie
camping-ferienhaus.at Galerie Appartements Gäste Campingplatz Preisecamping Freizeitangebot Anfahrt Allgemein Campinganlage Debt Anlage Field
571 Berufsfotografie Pressefotografie Scheucher Gtgt
Super Fotoalbum ein Projekt von MS Creative und I Connection...
ms-foto.at Gtgt Galerie Zur Creativecom Fotoalbum Ms Creative Office@ms Wwwpressefotografieeu Connection Fotografen Super Projekt Wwwvollfotografat Y
572 SCHüLERHEIM DER HTBLA HALLSTATT Hallstatt
SCHÜLERHEIM der HTBLA Hallstatt Malerweg 173 4830 Hallstatt...
hallstattn.at Hallstatt Htbla Schlerheim Schülerheim Personal Chronik Galerie Anreisetag Copyright Homepage Schlerheimesimpressummalerweg
573 Bio Hofladen und Hoffleischerei Mitterhuber Mitterhuber
Biofleisch...
bio-bissi.at Mitterhuber Hofladen Bio Hoffleischerei Josef Fleisch Produkte Hof Verkauf Ab Qualitt Galerie Uhr Wurstwaren Haidershofen Hoflieferanten
574 FRUCTOMAT HOME Vendingmaschinen Dispenser Partner
fructomat.at Partner Philosophie Dispenser Vendingmaschinen Downloads [] Benutzungshinweise FruchtgetrÄnke Galerie Fructomat Fruchtsaftautomatenlogin Jdm Modelle
575 ZZI Zentrum der zeitgemäßen Zentrum
ZZI Zentrum der zeitgemäßen Initiativen...
zzi.at Zentrum Initiativen Zeitgemäßen Zzi Galerie Nachrichten Berichte Projekte Linkliste Copyright Unsz
576 Art Galerie von eve s stoccholm Galos
evesstoccholm.at Galos Art Eva Decco Galerie Eve Stoccholm Rorschach Bilder Deccogalerie Gemäldegalerie Kreativ Künstlerkunst
577 wwwhc huttererat Hutterer
Homepage der Werbeagentur Hutterer Fotoservice Hutterer Galerie Impact und H.C. Hutterer Computer Sound Stereo....
h-werbung.at Hutterer Galerie Hc Impact Werbung Foto Fotograf Wiener Art Jutta Werbeagentur Kunst Sound Plakat Y
578 Justizcafe Home Galerie
justizcafe.at Galerie Agbfound Found The Server Apache Angebote Justizcafe Vorschau Bilder Jobs Partner Filmport
579 wwweventeat Joomla
Joomla dynamische Portal Engine und Content Management System...
evente.at Joomla Galerie Veranstaltungen Gästebuch Admin Fischen Epeer Content Erlebnisagentur Wwwepeerat Systemmanagementhome
580 Car Motion Motion
Joomla dynamische Portal Engine und Content Management System...
car-motion.at Motion Car Joomla Galerie News Leistungen Produkte Shop Engine Einbauten Mhlgasse Kundenfahrzeugeemail Diverse
581 Zapeterat Galerie Kunst Malerei Person
Willkommen auf der Website von Peter Zacek....
zapeter.at Person Ausstellung Kunst Daleeartz Zapeter Austellungen Featured Galerie Malerei Zapeterat Zacek Peterwebsite Z
582 Gut Seeleiten Seeleiten
gut-seeleiten.at Seeleiten Gut Moosdorf Tiere Zuhause Geschichte Fotobuch Umgebung Galerie Fische Gottfriedmoosdorfwillkommen Ponys Dengg
583 Seirl Karl Schreibbüro Startseite Leistungen
SKS...
seirl.at Leistungen Schreibbüro Uns Permanently The Texterfassung Unserem Kontaktformular Sks Galerie Schreibarbeiten Seirl Schreibservice Transkriptionserver
584 chorus music Purtscheller Wolf OG Chorus
chorus music Purtscheller Wolf OG...
chorus-music.at Chorus Music Purtscheller Wolf Og Studio Galerie Kompositionen Team Design Partner Adtinterior Dm Yamaha
585 Willkommen bei WOCA ART Eur
Künstlerhomepage von WOCA ART Wolfgang Caspari...
woca-art.at Eur Httpwwww Caspariatimagesstoriesheaders Acryl Jpg Art Leinwand Abstrakt Woca Joomla Verein Galerie Werke Dich Gnugpl
586 GK Business Hotel Hotel
GK Hotel A 2353 Guntramsdorf Klingerstrasse 2 Tel +43 0 2236 506680 ...
g-k-hotel.at Hotel Gk Business | Guntramsdorf Bezirk Mödling Hotels Klingerstrasse Hotelat Fax + Zimmer Mail Galerie
587 Stainless Design Welcome Pool
stainlessdesign.at Pool Design | Edelstahl Galerie Unternehmen Stainless Welcome Standort Visionen Filteranlage Wertpool überlaufgewerblich
588 brigitte hauck delmondo Hauck
Zeichnen Malen Kreativ sein. Website und virtuelle Galerie der Künstlerin und Kunsttherapeutin Brigitte Hauck...
hauck-delmondo.at Hauck Delmondo Galerie Brigitte Kunsttherapie Kunst Ausstellungen Acrylmalerei Virtuelle Website Akt Kunsttherapeutinsalzburg Malen
589 Startseite jennystifterat Malerei
jennystifter.at Malerei Galerie Biographie Servicesjenny Jennystifterat Acrylmalerei Internet Virtualweb Stifterhaftungsausschluss Gästebuch Urlaub
590 Klaus Frost Klaus
frost.at Klaus Request Frost Hostserver Client Galerie Wien Maler Ausstellungkärnten Kunst
591 Baden in Weiß Baden
baden-in-weiss.at Baden Weiß Vielen Kommen Wir Dank Fürs Galerie Presse Design Midnight Weiss Event Z
592 Golden Hours | Golden Retriever Zucht Golden
goldenhours.at Golden Hours Retriever Galerie Blog Zucht Mittelburgenland Hallo Nadine Zhoritschon Hoursgolden | Buzanich
593 home Dieter Kschwendt Michel Deutsch
kschwendt-michel.at Deutsch Bühne | Audio Derzeit Video Download Leben Repertoire Galerie Michelkritiken Projekte English
594 HG Concepts Hannes Grasserbauer GmbH I Concepts
HG Concepts Hannes Grasserbauer GmbH I...
hg-concepts.at Concepts Grasserbauer Hannes Bistro Hg Leistungen Statements Office@hg Gasthaus Conceptsat Beratung Galerie Restaurantfirma
595 Willkommen bei fotomatat Fotografie
Wie unschwer zu erraten geht es auf fotomat.at um die Fotografie im Allgemeinen und im Speziellen natürlich um...
fotomat.at Fotografie Steyr Galerie Fotomatat Unschwer Mir Wallpapers Island Mygall Nacht Landschaften Hdr Allgemeinen Panoramen
596 Willkommen auf der Startseite Golden
Golden Retriever vom Goldberg...
goldberghunde.at Golden Retriever Goldberg Welpen Schiedlberg Oberösterreich Galerie Wurfplanung Hunde Newsbillingswesen Uns
597 öGV Wien Heustadlwasser G****
heustadlwasser.at G**** Heustadlwasser Wien Obedience Erfolge Kv Gv Cup Lernstunden Ergebnisse Welpen Spiel Galerie Agility Fortgeschrittene Allen
598 wwwff getzersdorfat Joomla
Joomla dynamische Portal Engine und Content Management System...
ff-getzersdorf.at Joomla Wwwff Getzersdorfat Portal Management System Content Galerie Mannschaft Getzersdorf Ff Feuerwehrjugendweb Wasserdienst
599 Gesundheitstreff Schönbrunnerstraße Dr
Gesundheitstreff Schönbrunnerstrasse OA Dr. Stanislaus Rakusan Internist OA Dr. Andreas Grabner Urologe...
dergesundheitstreff.at Dr Oa Rakusan Andreas Stanislaus Grabner Internist Gesundheitstreff Urologe Wien Schnbrunnerstraegemeinschaftspraxiswebsite Galerie Schönbrunnerstrasse
600 Startseite Tcore
T3core Basis...
verita.at Tcore En Apache Privat Incoreat Port Film Musik Basis Galerie Permanently The Swing Theaterbio
601 Fotoklub Hartkirchen fotoklub hartkirchens Hartkirchen
Fotoklub Hartkirchen...
fotoklub-hartkirchen.at Hartkirchen Fotoklub Fotoclub Gästebuchklubprogramm Webseite Raika Galerie Server Wettbewerb Portpermanently The Klub
602 Eibenhof Weingut
Weingut...
weinguteibenhof.at Weingut Eibenhof Galerie Trauungen Webcam Familie Weinesteiermark Gästebuch Glanzöstereich
603 humtata Archives
__DESCRIPTION__...
humtata.at Archives Humtata Notizen Galerie __description__ Permanently The Jahres Words Article Meisterwerk Textpattern Talkpressdieses Cms
604 Startseite Archiv
nwk.at Archiv Galerie Spö Flickr Aktiv Uns Los Team News Veranstaltungen Manifest Doppelt – Groß
605 Gottfried Kumpf Gottfried
Gottfried Kumpf...
kumpf.at Gottfried Kumpfdeutsch Tiergarten Inhalt Asoziale Galerie Schönbrunn Dorotheum Biographieausstellungen Navigation Galerien
606 IngHans Huber Huber
Website von Ing. Hans Huber und Elisabeth Huber...
huinfo.at Huber Elisabeth Galerie News Inghans Klampfer Foto Hans Grabtuch Video Website Grillparzer Last Vw Y
607 Lebenshilfe Steiermark Nahtloskunst Nahtloskunst
nahtloskunst.at Nahtloskunst Lebenshilfe Mürzzuschlagport Server Steiermark Permanently The Chronologie Apache Kunstmarken Archivliteraturwerkstatt Galerie
608 Primal Legion heißt euch Willkommen Forum
primallegion.at Forum Chrome Internetlegion Downloads Galerie Mozilla Videos Gildenrat Primal Bewerbung Server Goodwin Gpl
609 diefoliererei Startseite Galerie
diefoliererei.at Galerie Bekleben Uns Leistungen Services Kommen Unserem Foliererei Sie * Erlebenerlebenwir Fast Treten Kontaktformular Startseite *
610 Edelstahlauspuff Edelstahlauspuff
Edelstahlauspuffanlagen in höchster Qualität und bestem Klang....
edelstahlauspuff.at Edelstahlauspuff Wechseln Kfz Auspuffanlagen Galerie Arbeiten Rally Auto Spengel Lieferwagen Erforderlich Kompetentereparaturen Dellen
611 Regine Dapra Regine
Regine Dapra Salzburg Landschaften Bilder öl auf Leinwand...
dapra.at Regine Dapra Galerie Ausstellung Bilder Biographieöl Büchersalzburg Leinwand Landschaften Bcher
612 Vorschau
packard.at Vorschau Events Hintergrund Austria Galerie Uns Www Artistic Jahre Technik Loading Packard Historie Erfolgsgeschichte Y
613 Walter Strobl Walter
Homepage des Malers Walter Strobl...
walterstrobl.at Walter Strobl Grafik Lebenslauf Texte Malerei Akt Galerie Druckgrafikfabrik Oesterreich Gemaelde Radierung Werke
614 Anno 1900 Antiquitaeten aus Wiener
Kunstliebhaber und Sammler finden in meiner Galerie auf mehr als 200 Quadratmeter Ausstellungsflaeche eine grosse Auswahl an Originalobjekten...
anno1900.at Wiener Deco Wien Art Antiquitaeten Auswahl Quadratmeter Meinerhin Jugendstils Hagenbund Galerie Zeit Anno
615 LG Austria ® Startseite Galerie
Platz für Ihren Slogan...
lg-austria.at Galerie Austria Lg Gästebuch Kontaktformular Uns Webseite Foto Life Platz Private Slogan Informationen Just Y
616 wwwmyrottiat Wwwmyrottiat
homepagezeushundrottweilerdogrottitierewelpewww.myrotti.at...
myrotti.at Wwwmyrottiat Galerie Rottweiler Zeus Homepage Mich Welpe Hund Tiere Rotti Dog Trotzdem Homeengerl Z
617 Dark Age Entertainment Dark
Diese Seite ist zur Zeit in Arbeit. Hier entsteht der Webauftritt von Dark Age Entertainment....
darkage.at Dark Entertainment Age Team Legacy Downloads Softwareentwicklung Goldmedaillelinks Veranstaltungen Galerie Wm News Projektespiele Lukas
618 Messe Tulln Du Tulln
hundemesse.at Tulln Messe Tier Du + Kalender Int Musikantenstadl Anfahrt Galerie Kiddyworld Kulinar Energiesparen Bike Agrar
619 Home TK FladnitzT Fehler
tk-fladnitz.at Fehler Anforderung Ungültige Uns Galerie [] Aktivitäten Fladnitzt Ispconfig Tk Problemen Marschmusikwertung Poweredgnas
620 Atelier im Tal Reinhard Projekte
ateliersandhofer.at Projekte Reinhard Sandhofer Atelier Biografie Galerie Kunstmeile Maiersdorfkunsthandwerk | Ausstellung Installationtal Natur Collagierte
621 FIT HERMAGORAT Preisliste
fit-hermagor.at Preisliste Fit Hermagorat Foto Galerie Gymnastikplan Arcsin Khne Brigitte Mozilocms Designterminvereinbarung Fitdauerhaft Ernhrungstraining
622 Home Goller
geris-motoshop.at Goller Gebrauchte Lienz Adresse Vinzenz Team News Motoshop Galerie Geris Neufahrzeuge Agb Spambots Fax Y
623 Atelier Monika Schwinner Kunst
ölbilder Gemälde Galerie abstrakt...
atelier-schwinner.at Kunst Schwinner Monika Galerie Bilder Kaufen ölbilder Atelier Abstrakte Steckbriefmalerei Art Abstrakt Z
624 Drechselkunst Christoph Langreiter Saalfelden Langreiter
drechselkunst.at Langreiter Saalfelden Galerie Drechselkunst Christoph Profil Material Tel+ Werke Freundefindenauf Stücke Ausdruckinaustria Drechselkunstathandgedrechselte
625 Weingut Josef Fischer Huchenzucht Weingut
Weingut Josef Fischer Huchenzucht...
huchenfischer.at Weingut Huchenzucht Fischer Josef Neuheiten Sortiment Presse Weinbau Salonsieger Galerie Rossatz+auszeichnungen Z
626 Cafe Konditorei Eisverkauf Weltzer in Eferding Aschach
Willkommen bei Weltzer.at Eine süsse Sache...
weltzer.at Aschach Konditorei Weltzer Cafe Eisverkauf Eferding Galerie Sache Donausüsse Weltzerat Eis Konditoreis Z
627 VW Audi Club Defender Audi
vw-audi-club-defender.at Audi Defender Club Mitglieder Vw Galerie Sponsoren Events Clublokal Gästebuchwebsite Kontakt Gstebuch Z
628 Willkommen auf der Startseite Vibrations
Trommel Styrian Vibrations Styrian Vibrations Pinggau Djembe afrikanische Musik...
styrian-vibrations.at Vibrations Styrian Direkt Uns Djembe Inhaltschnupper Trommeln Php Galerie Afrika Anmeldung Hörbeispiele Trommel
629 photopassionat Manfred Kubanik Manfred
Fotografie Homepage eines ambitionierten Hobbyfotografen...
photopassion.at Manfred Tfp Fotografie Kubanik Shooting Portrait Fotomodel Photopassionat Location Galerie Fantasie Peoplefotografiehomepage Ambitionierten
630 Alfred Löscher Alfred
Website Alfred Löscher Freischaffender Künstler...
alfredloescher.at Alfred Löscher Lscher Galerie Malerei Künstlergraz Websitefreischaffender Abstrakt Großformat
631 ARS NOVA Home Nova
Ars Nova die Kunstagentur...
arsnova.at Nova Ars Kunstagentur Claudiana Kunstverein Galerie Hackl Kompetenzportrt Kunstgalerie Skulpturen Herbert Mensch Kunsthandel
632 Home Home Interior Inspiration
home-interior.at Inspiration Interior Produkte Aktuell Shopping Store Hause Diskret Igewerbepark Unsflagship Galerie Sache
633 Antonia Wöhrer Art Galerie Galerie
Antonia Wöhrer Art Galerie...
art-antonia.at Galerie Wöhrer Antonia Art Kreativtraining Antoniaat Namaste Zantonias Rose Graz Wwwart Kunst
634 Weinbau Wittmann Heuriger
weinbau-wittmann.at Heuriger Weinbau Weine Betrieb Verkauf Wittmann Galerie Webshop Anfahrt Poysbrunnweinejwittmann Märchendorf Gut Z
635 ALIVE | Ab 1 Juli im Alive
ALIVE Ab 1. Juli im Kino...
alive-derfilm.at Alive Kino | Ab Inhalt Presse Kinofinder Galerie Juli Trailer Thimfilm Nikz Minarolli Film
636 Pepe
Die Website von Udo und Pepe Narrisch Guat...
udo-pepe.at Pepe Udo News Video Narrisch Guat Galerie Faschingsquintettcabarett Quintett Lachen Harmonie Gilde Interview
637 Elterninitiative Lavida | Home Unser
Startseite...
lavida.at Unser Permanently The Powered Login Vida Uns Angebot Hacktech Galerie Lavida Elterninitiative Apache Laport
638 Willkommen auf der Startseite Gossam
Offizielle Homepage vom Florianifest der Freiwilligen Feuerwehr Gossam...
florianifest.at Gossam Florianifest Feuerwehr Freiwillige Fest Ff Programm Grimsing Video Galerie Anfahrt Sponsorentemplde Template
639 Eisrausch die Life Radio Linz
EISBOX Der Liferadio Eislaufplatz am OK Platz in Linz...
eisbox.at Linz Ok Eisbox Platz Liferadio Eislaufplatz Eisrausch Bilder Dächern Radiolife | Galerie Video
640 Art of Jull Jull
art-of-jull.at Jull Art Deutschland Newws Galerie Objekte Tilly Ereignis Mscorporate Prominenz Ibiza Design Interieur
641 Alexander Technik Studio für Technik
leichtes-leben.at Technik Alexander Hypnagoge Studio Lichterfahrung Hypnagogelichterfahrung Galerie Stunde Druckversion Ablauf Preise Loginerfahrung Z
642 archi64 indexhtml Ziviltechnikerin
architektur64.at Ziviltechnikerin Arch Fax Kothgasser Indexhtml Arbeit Daniela Reisinger Gleisdorf Diplhtl Pernerat Archiing Galerie
643 Home Z
weinstoppl.at Z Port Weine Galerie Anfahrt Apache Speisenpizza Server Gästebuch Permanently Thelunch Menu
644 BFG Login
gildenball.at Login Name Partner Faschingsgesellschaftschillerstraße Gildenball Bregenzer Mail Pehr Bfg Oberstleutnantbregenzwebmaster Alexander Galerie Verein
645 Heeressportverein WELS Permanently the
hsv-wels.at Permanently The Wandern Sites Wels Zweigvereine Uns Jahresprogramm Heeressportverein Wintersport Apache Serverport Vereinsvorstand Galerie
646 lumpererhofat | Biologischer Betrieb mit Direktvermarktung Allgemein
lumpererhof.at Allgemein Vogerlsalat Tomaten Beginnt Himbeeren Knoblauchernte Paprika Saison Produkte | Biologischer Galerie Poweredbetrieb
647 Massage Heidi Pedevilla Pedevilla
Genießen Sie eine entspannende Massage. Heidi Pedevilla und Team...
heidipedevilla.at Pedevilla Massage Heidi Ich] Ich Bin Biete Sprache Galerie Echo [kontakt] Wasserfalls [impressum] Entspannung Wohat
648 Home | EFS | Elementary Fighting System
Home EFS Elementary Fighting System ist ein Hybridsystem jahrhundertealter Kampfkünste und Kriegskünste aus Asien und...
efs-fightingsystem.at System Fighting Elementary Instructors | Schulen Ausbildung Efs Waffen Galerie Liste Unterricht Graduierung Downloads
649 Bilderspiegel Heiner Zimmermann Heiner
heiner-zimmermann.at Heiner Zimmermann Bilderspiegel Kunst Klagenfurt Galerie Glas Knife Ferlach Tod Werkeauergasse Komposch Leben
650 Tricolore Labradors Joomla
Joomla dynamische Portal Engine und Content Management System...
tricolabis.at Joomla News Eycko Galerie Tricolore Henry Justin Hunde Labradors Dynamische Website Edv Uns Portalengine
651 Grillhorns Grillmeisterschaft
grillhorns.at Grillmeisterschaft Grillkurs Rarr Fortgeschrittene Apache Aba Grillworkshop Galerie Beschreibung Grillteam Grillhorns Schmankerlfass Grillerport
652 WDA Innsbruck WDA []
{pagedescription}...
wda-tirol.at [] Wda Innsbruck Galerie Design Dtpprint Ausbildungsschwerpunktmediendesign Ausbildungsschwerpunktgrafikdesign Bewerbung | Bewerbungstag Ausbildung Advanced Gt Räumen Y
653 Ralfs Homepage Homepage
Homepage Ralf Vamosi Austria Information IT Technology Photography gallery Galerie Photo Foto...
vamosi.at Homepage Photography Foto Photo Ralf Gallery Galerie Information Austria Vamosi Technology Ralfsz
654 Hotel Alpenland Alpenland
Hotel Alpenland...
alp1.at Alpenland Hotel Unspreisliste Angebot › Galerie False Swfobjectembedswfflashintroswf {wmodereservierungsformular Corsariopl Flashexpressinstallswf
655 Leitnerhof Familie
leitnerhof.at Familie Sortiment Leitnerhof Betrieb Galerie Verkauf Events Video Land Kontakt Zwein Liebe
656 Galerie Leitner Hofherr Kunst Hofherr
Galerie Leitner Hofherr in Lermoos Tiroler Zugspitz Arena. Künstler Publikationen Ausstellungen auf Galerie Leitner Hofherr....
leitner-hofherr.at Hofherr Galerie Leitner Ausstellungen Lermoos Tirol Kunst Arena Künstler Zugspitztirolerzugspitze Bilder
657 Grillenberger Eventat Home Grillenberger
Die Grillenberger Event GmbH ist Ihr vielseitiger Ansprechpartner für Gastronomie und Eventorganisation....
grillenberger-event.at Grillenberger Event Ansprechpartnerkoch Gastronomie Ihr Sommernachtsball Eventat Galerie Basilikum News Balance Vielseitiger Leistungen
658 Promocams Bedruckte Einwegkameras als Gtgt
einwegkameras.at Gtgt Galerie Anfrage Cams + Kandinsky Promocams [x] Leer Bookmarken Paperboxltzurück Anfragenkorb Corporate
659 Kontrapunkt Kontrapunkt
Kontra Punkt Kontrapunkt vinssimo Vinothek Restaurant Slow Food...
kontra-punkt.at Kontrapunkt Food Galerie Lokal Slow Vinothek Restaurant Extremschrammeln Vino Neuwirth Weinwine Kontra Mi
660 Schwarzerkaterat
...
kosta.at Schwarzerkaterat Webdesign Shop Cms Verkaufsstände Giveaways Produkte Sk Agbs Galerie Artikel Atom St Klagenfurtletzte
661 Koutek Partner News
koutek-keg.at News Galerie Incentives Conventions Partner Koutek Meetings Events Gt Welt Momente Leben Madeerlebe
662 Rabenhof Theater und aus Rabenhof
rabenhof.at Rabenhof Saison Archiv Theater Gemeindebau Aid Apache Galerie Spezialitäten Partner Literatursalon Videos Abo Y
663 Galerie von Alois E Akt
endl-foto.at Akt Request Nginx Alois Kärnten Bodypainting Sport Abstrakt Galerie Portraitreisen Architektur Natur
664 Reit und Fahrverein Dachberg Fotos
dachberg.at Fotos Dachberg Csn B* Unser Fahrverein Reit Anmelden Cdn Angebot Folder Tagesritt Hippotherapie Csnhp Galerie
665 EMROS Emros
emrosbau.at Emros Galerie Immobilien Anfahrtsplan Sanierung Heizung Kundenbereich * Elektro Partner Registrierung Keh * Gw Group * Friedrich * Bau
666 Moden
ag-moden.at Moden Ag Firmen Markt Deutschland Rabatte Angebot Wirsind Mglichkeitvon Firmapreisverhandlungen Galerie Mengen Interesse
667 Home grranchs Jimdo Page Leistungenpreise
gr-ranch.at Leistungenpreise Anlage Unterrohrbach Page Training Team Galerie Gr Ranch Memoriam News Pferdehaltung Rv Himotion Y
668 the making of consulting eventmanagement Birkner
eventagentur und eventconsulting...
themakingof.at Birkner Eventagentur Gerald Eventconsultingenergie Office@themakingofat Making Consulting Eventberatungraum Galerie Farbe Eventmanagement
669 KFZ Technik HGC Über HGC Hgc
hgcarstyling.at Hgc Kfz Handel Werkstatt Login Technik Tuning Galerie Team Hgcarstyling Regersttten Hierzerfax Weiz Gerald
670 Web Seite Galerie
vws-breitfuss.at Galerie Vollwrmeschutz Web Saalfelden Fassadenausbesserungen Breitfuss Isoliertechnik Arbeitsleistungenziel Preisen Wohnhaus Umbauarbeiten Einsatzmodernster Ausfhrung
671 Home Autohaus Grohs GmbH Gebraucht
fiat-auto.at Gebraucht Neuwagen Wagen Media Galerie Abteilung Lkws Bmedia Port Lkw Permanently Theserver Grohs Pkw
672 Grafik Linz Linz
grafik-linz.at Linz Grafik Galerie Steingasse Künstler Admin Bildern Poweredmianara Kunstmianarawebdesign Webdesign Peter
673 Home Joomla
Joomla dynamische Portal Engine und Content Management System...
drschmatz.at Joomla Team Epeer Home Ordinationszeiten Bereitschaftsdienst Login Galerie System Managementengine Portaldynamische Wwwepeerat
674 WILDENSTOANA PERCHTEN Perchten
wildenstoana.at Perchten Wildenstoana Sponsoren Befrgruppen Historie Galerie Supportware Verein Ausstatter Ausbadcopyright Ischl Webseite Z
675 Ilztal Event GmbH Event
Ilztal Event GmbH Ihr Wegweiser zum perfekten Event...
ilztalevent.at Event Ilztal Events Technik Beratung Galerie Tickets Team Vip Schlager Perfekten Partnertel+ Platz Zug
676 Home Valid
Krampus und Perchtenmasken aus dem Hause Kopfkunst Michael Vallant...
kopfkunst.at Valid Galerie Krampus Shop Biografie | Jt Perchtenmaske Vallant Home Linelab Perchtenmasken Hause Michaelkopfkunst
677 Galerie Hilger modern contemporary Hilger
hilger.at Hilger Galerie Brotkunsthalle Dorotheergassewien Ausstellungen Fairs Ernst Künstler Editionennews Modern Contemporary
678 RAK ALEXANDER wwwrak1at Gtgt
rak1.at Gtgt Dokument Alexander Unbenanntes Gstebuch Sponsoren Galerie Rak Biografiewwwrakat Zeige Stepweb Mich Berichte
679 Willkommen auf der Startseite Malerei
Malerei Andrea Fuchsberger...
afuchsberger.at Malerei Gestaltherapie Galerie Mal Ausstellungen Vergangene Events Rights Mich Formgewordene Malen Sehnsuchtfuchsberger Dorothea
680 Dietmar Grundmanns Homepage Grundmanns
Dietmar Grundmanns Homepage. Jetzt ganz toll mit neuen Layout also vorbeischauen...
grundmann.at Grundmanns Homepage Dietmar Toll Galerie Internet Explorer Browser Leider Neuen Vorbeischauenkauf Also Ganz
681 Am Ende des Tages | Ab Tages
Am Ende des Tages Ab 26. August im Kino...
am-ende-des-tages.at Tages Kino Ende Ab | Musikvideo Inhalt Presse Galerie Kinofinder Besetzung Schwarzpayer Film Trailer
682 Art of Erwin Waldherr Balu
waldherr-nk.at Balu Landschaft Architektur Spotter Menschen Airshow Alteswr Züge Mollis Galerie Erwin Art Samedan
683 Start tibetan terriers jimdo Z
tibetan-terrier.at Z Tibetan Terriers Memoriam Offspring Galerie Pups Welpen Page Dogs Newszuchtgedanken Hunde Jimdo
684 Willkommen bei WOCA ART Eur
Künstlerhomepage von WOCA ART Wolfgang Caspari...
w-caspari.at Eur Httpwwww Caspariatimagesstoriesheaders Jpg Acryl Art Leinwand Abstrakt Woca Verein Joomla Galerie Dich Werke Vita
685 VIT DRIVE Drive
Vit Drive...
vit-drive.at Drive Vit Bildung Berufskraftfahrer Design Auszahlt Internet Free Fahrtechniksicheres Geld Galerie Training Verdienen
686 Line Design e U Design
CAD Decor 3D Visualisierungssoftware für Badplanung und Interieur Design...
line-design.at Design Line Badplanung Copyright Software Interieur Decor Cad Videos Visualisierungssoftware Socialweb Kundenzone Galerie Pgt Css
687 Startseite Haus
gruber-central.at Haus Mayrhofen Appartements Ferienregion Unser Galerie Ski Zillertals Eislaufplatz Ahornbahn Sportartikel Schwimmbad Einkaufsstrasseinhalt
688 Fragollo Reisen Medjugorje
Reisebüro Fragollo...
fragollo-reisen.at Medjugorje Reisen Gt Pilgerreisen Fragollo Vulkanland Rad Pilgertouren Foto Galerie Busreisen Neu Team Seiten Fuhrpark
689 GEO Immobilientreuhand Unser
geoimm.at Unser Ferienimmobilien Uns Angebot Immobilien Galerie Agb Unbebaute Nutzung Geo Immobilientreuhand Gewerbeobjekte Grundstückestandorte
690 Home Joomla
Joomla the dynamic portal engine and content management system...
fh-transporte.at Joomla Team Unternehmen Galerie Jobs System Fuhrpark Content Fh Transporteengine Dynamic Management Wwwjumiat
691 Home KRAMURI Galerie
kramuri.at Galerie Agb Loginbereich Blog News Permanently The Made Kramuri Port Rsaquo Allgemein Uarr Simpleupload
692 Karten Mayrverlag Home Mayrverlag
Karten Mayrverlag...
innsbruck-plan.at Mayrverlag Karten Uns [] Httpwwwkarten Mayrverlagat Galerie Stadtplan Produkte Kontaktieren Permanently Thesonderprodukte Apache Port
693 Kreativfunke Home Raum
kreativfunke.at Raum Kreativfunke Jump Galerie Projekt Kinderecke Programm Ideen Searchnavigationsearch Preisebitte Uns Contentanfrage Javascript
694 Aichinger Tischlerei wwwaichingerat Aichinger |
Idee Team Massive Vorteile Individuell Unsere Partner Galerie Kontakt   Normal...
aichinger-tischlerei.at | Tischlerei Aichinger False Etiketten Partner Vorteile Meine Idee Massive None Galerie Individuell Team Y
695 Obersteirische Nachrichten Home Nachrichten
Obersteirische Nachrichten Die echte Regionalzeitung im Murtal...
obersteirische-nachrichten.at Nachrichten Kontaktieren Jede Woche Obersteirische Passwort Veranstaltungskalender Agb Unternehmenin Abo Galerie Uns Benutzername Echte Downloads
696 Herzlich Willkommen in der virtuellen Welt Vinorosso
Herzlich Willkommen in der virtuellen Welt des Restaurant Vinorosso Genießen Sie den Streifzug durch unser Haus und unseren...
vinorosso.at Vinorosso Monats Restaurant Virtuellen Welt Bar Pizza Rezept Oberndorf Uns Geschenkgutscheine Streifzug Di Galerie Steak
697 Liedertafel Straßwalchen Liedertafel
liedertafel-strasswalchen.at Liedertafel Impressumkornprobst Browser Lukas Simon Veranstaltungen Galerie Straßwalchen Strawalchenmitglieder Verein
698 Karten Mayrverlag Home Karten
Karten Mayrverlag...
innsbruckplan.at Karten Mayrverlag [] Uns Sonderprodukte Port Waltermayr@kompassat Apache Galerie Permanently The Mayrverlagat Kontaktieren Httpwwwkartentouren
699 Welcome to the Frontpage Joomla
Joomla dynamische Portal Engine und Content Management System...
licv.at Joomla Galerie Linzer Cartellverbands Heim Welcome Homepage Uns Frontpage Präsidium Prinzipien Veranstaltungenintern Wwwoecvat
700 Thomas Nechi | Training und Schulung Z
vip-security.at Z Partnerfirmen Presse Xbxfxexbixxxxxxeat Pm Designat Thomas Training Galerie Betätigungsfeld |schulung Nechi News
701 Startseite Siebdruck
goldstein.at Siebdruck Serverport Apache Print Webdesign Found Design Textilveredelung Downloads Galerie Agb Displays Vorteile
702 Babycafe Breitensee Breitensee
baby-cafe.at Breitensee Babycafe Pfarre Babycaf Findet Statt Galerie Platz Erfahrungen Kindern Erlebnisse Mag Wannpfarrsaal
703 Home Galerie
timmy.at Galerie Eindrücketripple Besuch Timmy Welgersdorfer Neo Welgersdorf Angefangen Ostern Kontaktdaten Gebenwwwbundeslandat
704 wf ein beagle kommt selten alleine Page
quotJimdo Page des Hofberichterstatters von Willi Flip. Auf dieser Page können sich alle Freunde von WF über...
williundflip.at Page Willi Flip Wf Ii Galerie Beagle Meint Williundflips Boschnerjimdopro Selten Hofberichterstatters Freunde Dieser
705 Lebensschmiede k u n s Lebensschmiede
die lebensschmiede besteht nun seit oktober 2000 und bietet verschiedenste kunsthandwerke von heinrich pansi vorwiegend in...
lebensschmiede.at Lebensschmiede Pansi Galerie Heinrichunserer Meinen Neben Bietet Veranstaltungen_ Veranstaltung Zeit Gartenplanung Hand Projekte
706 Flávio Marques Workshop Marques
Brasilianische Kultur Livemusik und Sambaworkshops...
flaviomarques.at Marques Workshop Flavio Flávio Brasilianische Biografie Galerie Samba Sambaschule Tanzen Brasil Siteswiftcomaustria Livemusik
707 Skischule Walchsee Skischule
schischulewalchsee.at Skischule Langlaufschule Skigebiet Alpin Standort Privatunterricht Snowboardschule Galerie Miniclub Walchsee Events Anmeldung Kinderz
708 Moderne Acrylbilder Modern Painting Painting
egger-kramer.at Painting Acrylbilder Galerie Modern Moderne Ausstellungen Presse Christianmoderneoptik Egger Elisabeth Tauber Bilderkaufpicture Bilder
709 Scharnsteiner Bibelkreis eV Willkommen Scharnsteiner
Scharnsteiner Biibelkreis e.V....
scharnsteiner.at Scharnsteiner Ev Bibelkreis Malznercom Biibelkreis Sondern Zuknftige Genehmigungc Galerie Design Hebräer Keine Fotos Y
710 Pythons Boas und Nattern von Patrik Nattern
Schlangenzucht von Patrik Schikl Phytons Boas Nattern...
schlangenzucht-scheikl.at Nattern Boas Patrik Pythons Scheikl Webdesign Galerie Abzugeben Schlangen Design Schlangenzucht Futterphytons Sch@pleracutes
711 Andreas Steiner Galerie Schau STALL Stall
Andreas Steiner Galerie Schau ST.A.LL...
schaustall.at Stall Steiner Schau Andreas Galerie Amstetten Objekte Kunst First Silberschmuck Mak Schaffen Stuttgart Installation Aquarelle
712 LH univital Lh
LH univital...
lh-univital.at Lh Univital Partner Mich Ich Fühl Anfrage Galerie Vitalpunktkarte Preise Team Anfahrt Weiss Attentionjavascript Muskelaufbau Y
713 indexhtml Bretthauer
Benno Bretthauer...
bretthauer.at Bretthauer Zeichnungen Benno Comics Nachdrucke Veranwortlich Portraits News Tour Bilderinhalt Lebenslauf Individuellen Galerie
714 CAM Fotografie | Kinderfotos Fotografie
CAM Fotografie Enzianweg 51 1220 Wien Unser erfahrenes Team bietet ihnen professionelle Betreuung u.a. bei Kinderfotos Hochzeitsreportage...
cam-fotografie.at Fotografie Team Kinderfotos Galerie | Cam Bildpreise Newborn Hochzeitsreportagen Schulfotografie Visionpark Layout Fotos Ideen Kinder
715 We make your Party Eventtechnik
DTC Eventtechnik We make your Party...
dtc-eventtechnik.at Eventtechnik Dtc Party Team Verleih Equipment Firmenprofil Downloads Winkl News Loginbereich Galerie Trappl Frauenhofen Y
716 Home Musikkapelle Neustift im Stubaital Neustift
Musikkapelle Neustift im Stubaital. meine Beschreibung...
mk-neustift.at Neustift Stubaital Musikkapelle Galerie Sponsoren Fest Foto Meine [] Chronik Mitglieder Tolles News Jugend
717 Gravur Manufaktur Alfred Woschitz Alfred
schilder.at Alfred Gravur Manufaktur Gravuren Schilder Woschitz Galerie Original Design Eindruck Alfredwoschitz Mozilocmsarbeit Schauen
718 DuoNuevo_Text Astor
duonuevo.at Astor Monica Piazzolla Tschallener Clemens Tarcsay Musik Tangonuevo Duonuevo Duonuevo_text Galerie Tangoduonuevomit Akkordeon
719 Pension Königs Cafe Pension Königs Cafe Cafe
pensionkoenigscafe.at Cafe Königs Pension Plan Karte Galerie Zimmer Straße Wien Copyright Telfaxkaiserebersdorfer
720 Willkommen Regenwald
kenzel.at Regenwald Aufnahmetechnik Xhtml Mich Multivisiondie News Faszination Michael Galerie Login Schlerentdeckenentdecken Martinkenzel Schüler
721 wwwferienhaus zubrunnat Willkommen Joomla
Joomla das dynamische Portal Engine und Content Management System...
ferienhaus-zubrunn.at Joomla Port Anreise Preise Content Server Permanently The Engine Galerie Portal Wwwferienhaus Zubrunnatlage Management
722 Pension Haßlwanter Home Pension
Die offizielle Homepage der Pension Haslwanter in Ochsengarten...
pension-hasslwanter.at Pension Haslwanter Zimmer Ochsengarten Anfragelage Offizielle Galerie Haßlwanterhomepage Wohnungen übernachtung Wellnessbereich
723 ApfelLand Konditorei Cafe Melounge Stubenbergsee Konditorei
Motivtorten der besonderen Art Lounge Kaffeehaus Galerie ein Haus mit Stiel am Hauptplatz in Stubenberg Konditorei mit Eisdiele...
me-lounge.at Konditorei Apfelland Melounge Cafe Motivtorten Stubenbergsee Hauptplatz Kaffeehaus Galerie Stubenberg Lounge Essbareburger Apfellandtorte
724 Freiwillige Feuerwehr Obertiefenbach Freiwillige Feuerwehr Obertiefenbach Feuerwehr
ff-obertiefenbach.at Feuerwehr Freiwillige Obertiefenbach Jahrfeier Dazu Ausflug Hans Tipps Feuerwehrobertiefenbach Kirchengast Stubenberg Galerie Websitehomepage
725 EHC Tulln Rss
Eishockeyclub Tulln...
ehc-tulln.at Rss Tulln Ehc Folder Archiv Allgemein Anmelden Vorstandkontakt Galerie Bank Erste Eishockeyclub Geschichtefoto Liga Httpwwwfairandfuncom
726 Antik Galerie im Lichtental Home Lichtental
galerie-im-lichtental-antik.at Lichtental Anfahrtsplan Unternehmen Aktionen Antik Galerie Found Pflanzen Seidewwwgalerie Php Ambiente +lenny Wetterfeste Login
727 Index Wein
cafegalerie.at Wein Weutz Neumeister Umgebung Ernst Weninger Sekt Galerie Lieboch Umathum Paul Achsrosenberg Strablegg
728 Weinbau Lozka Weinbau
Lozka Weinbau Weinbau Hannersdorf Werderits...
lozka-weinbau.at Weinbau Lozka Werderits Hannersdorf Anni Erich Winzerfamilie Auszeichnungen Weingut Weine Galerie Sonstiges Burgenlandwissenswertes
729 PEMANU ModeART Nussbaum
pemanu.at Nussbaum Petra Pemanu Maria Modeart Person Design Galerie Benjamin Events Designedz Diashow Copyright
730 Home Dienstleistungen
MC Reifenhandel Reifen Felgen und Montage zum Bestpreis in Marchtrenk.Marken wie Lassa...
mc-reifenhandel.at Dienstleistungen Reifen Reifenhandel Felgen Mc Sortiment Galerie Linz Finden Alufelgen Marchtrenk Montage Werbeagenturwuchten Monatage
731 Lazarusware just use it Lazarusware
homepage of lazarusware a little developer label owned by xlazarus promoting Linux systems and OpenSoure programming all cases...
lazarusware.at Lazarusware Linux Programming Programme Use Adminscripte Scripting Cases Opensource Shell News Galerie Neues Just Xlazarus
732 Home | Los Mariachis Mariachis
mariachi-wien.at Mariachis Musiker Foto Galerie Mariachimusik Media Instrumente Angebot Einziger Losnegros Mariachigruppelos Impressum Sterreichs
733 Dolinza Alm Willkommen auf der Dolinza Dolinza
dolinza.at Dolinza Alm Galerie Hütte Anreise Preisinformation Standort Vorderberg Pferde Straße Karnischen Typostandardinstallation Christophgrafenaueratgmxatnatur
734 Home Free
brilliant-nails.at Free Brilliant Templates Zimplit Nails Preise Powered Beim Babypause Css Feilmayr Copyrightmade Nagelstudio Galerie
735 Wiener Buchwoche 2007 österreich Galerie
buchwoche.at Galerie Buchwoche Erffnung Empfang Hvb Hauptverband Gemeinschaftststand Seitenbeginn Editorial Wiener Gemeinschaftsstand Fachkolleg Bilder Buecheratbuch
736 Start FAHRSCHULE KURT Inh Erdogan Kurt Kurt
None...
fahrschule-kurt.at Kurt Erdogan Fahrschule Inh Panoramen Führerschein Leistungen Video Galerie Standorte Kurstermine Mba Login Team |
737 Mike Ranz Photograph Mike
Mike Ranz Photograph Fotograf...
mikeranz.at Mike Photograph Ranz Fotografie Photography Oesterreich Medienkunst Austria Collections Galerie Fotografgallery Kunst Sammlung
738 Farben Helfer Lacke Dispersionen Anstrich Fassadenbeschichtung Farben
farben-helfer.at Farben Anstrich Produkte Galerie Port Lacke Fassadenbeschichtung Dispersionen Wandgestaltung Unternehmen Helfer Server Indivisualatfound The
739 WWWMARKUS PRANDSTAETTERAT FOTORAFIEGALERIEEVENTSDOWNLOAD Events
Die Seite für Fotografie Mit Galerie Events Downloads und vielem mehr. Werde Zeuge von Schlagenfütterungen in gestochen scharfer...
markus-prandstaetter.at Events Downloads Wwwmarkus Galerie Diabolisch Tutorials Vielem Gestochen Astrobilder Scharfer Zeuge Prandstaetterat Prandstaetteratfotorafiegalerieeventsdownloadfacetten
740 MAS Trockenbau u Handels Trockenbau
Platz für Ihren Slogan...
mas-trockenbau.at Trockenbau Handels Mas Galerie Angebot Lageplan Produkte Unser Uns Platz Slogan Kg Kg Linzerstraßeschachtwand Unserer
741 Galerie Home Galerie
Galerie...
galerie-aw.at Galerie Winnicki Kunst Geschmack Meinen Besttigen_ Maler Groteskes Bilder Armin Gezwungen Gedankenbigbenst Widersprechen
742 Home Pansilva Galerie
Homepage von Silvia Edinger Malschule und Atelier Pansilva dipl. Panart Lehrerin seit 2009...
pansilva.at Galerie Pansilva Atelier Edinger Silvia Malschule Homepage Panart Lehrerin Masu Lehrer Matthias Diplseit
743 Loamkuchl Stefanie Modritz Tonkunst Loamkuchl
loamkuchl.at Loamkuchl Modritz Tonkunst Stefanie Galerie Schloss Erde Tribuswinkel Tpferei Ostermarkt Post Fridau Mich Y
744 Die Welt in 360186 Ansehen
Panoramafotografie Hochauflösende 360 Grad Fullscreen Panoramabilder in Quicktime VR....
panoramapix.at Ansehen Panorama Panoramabilder Rtelstein Welt Panoramapix Bodenberg Wallpaper Grad Alpbichl Galerie Berge °panoramagalerie
745 Panorama Restaurant Gmunden Restaurant
panorama-restaurant.at Restaurant Panorama Gmunden Galerie Lageplan Speisen Kche Tagesangebote Gmundenvon Familienfeiern Herzen Frhstcksbuffet Taufenundesplanade
746 Fanclub LisaValentinat Records
fanclub-lisavalentin.at Records Gg Musical Fanclub Biografie Geheimnis Admin Galerie Copyright Schlagertexte Schlagermusical Lisavalentin Lisavalentinat Fanfotos Y
747 AMC Pacer Pacer
Oberts Garage. AMC Pacer Ersatzteile bilder Infos. AMC Pacer parts pictures and informations....
pacer.at Pacer Amc Oberts Ersatzteile Garage Geschichte Galerie Parts Wagon Fotos Tober Pacerersatzteile Toro Visuals Y
748 DDSG Blue Danube GmbH Wien
donauschiff.at Wien Linie Themenfahrten Ab Wachau Kombitickets Schiff Blue + International Charter Sonderfahrten Standorte Große Galerie
749 Origami österreich Crease
origamiaustria.at Crease Patterns Origami Diagramme Galerie Artikel Hauptseite Neu Gruppe Treffen Leider Lust Bcher Besucher Y
750 Willkommen Landkarte
oberpfennigmayrgut.at Landkarte Aufenthaltsraum Aufenthalt Tage Webseite Einquartier Willkommenpension Piritsch Machen Sie Umgebung Pension Galerie Anreiseurlaubsgast
751 Impuls Start Impuls
massage-impuls.at Impuls Schönesbauen Steinen Wolfgang Gelegt Galerie Angebote Willkommen Auch Johann Uns Pressegoethe Kontakt
752 1 MHC Austria Mhc
Informationen über Flug und Bau von Modellhelicoptern Info über den Modellhelicopterclub MHC Austria...
mhc.at Mhc Photo Austria Album Berichte Ecke Galerie Webmaster Sammlung Technik Modellhelicopterclub Startkistenparade Modellhelicoptern Httpwwwmhcat Rc
753 Finanztreuhand FIT Finanztreuhand
fit-balance.at Finanztreuhand Balance Fit Fitness Immobilie Aktuell Finanzierung Absicherung Karriere Galerie Anlage Coach Zufriedenheitbleiben Wir Erfolgnach
754 Stadtkapelle Dornbirn Haselstauden | Schottar Musig Dornbirn
schottar-musig.at Dornbirn Haselstauden Stadtkapelle Rss Jugend News Galerie Ehrenmitglied Mitglieder Schwendinger Hofsteiger Artikel | Stk Copy Balderschwangtag
755 Kienberger
mariokienberger.at Kienberger Mario Homepage Ladezeiten Foto Updates Basis Fotografieeu Werbung Tauglichkeit Galerie Gr٤en Einigeaufgrund
756 galerie ziwna ]
galerie ziwna bietet Ihnen Kunstgenuss auf 700 m2 Ausstellungsfläche mit inkludiertem Skulpturenhof in der Herrengasse 17....
galerie-artziwna.at ] [ Galerie Artziwna Waltinger Ty Nitsch Haring Roy Lichtenstein Ziwna Cryo Paintings Avramidis Josef Max Rainer Artconsulting
757 FALKE | Qi Gong | Geomantie Gong
paradiesgaertlein.at Gong Geomantie Falke | Galerie Seminarhaus Qi Bleiburg Loibach Seminar Ferienwohnung Renate Kärnten Lebenskraft Fax Okt
758 Made by you Linz Linz
Keramik selbst bemalen....
linz-madebyyou.at Linz Made Besuchen Keramik Voranmeldung Feiern Neuenwebshop Hufige Selbst Gemachtkeine Galerie Webshop Gruppen
759 GOLDEN RETRIEVER AUS LEIDENSCHAFT Retriever
passioningold.at Retriever Leidenschaft Golden Fotos Galerie Trainingsbilder Daumendrcker Sausal Kameraleute Workingtest Spirk Kflach+ Informationen Y
760 Leo Grübler | Photografie digitalArt Grübler
Möglichkeiten im Bewußtsein der Unmöglichkeit Possibilities conscious of impossibility...
leonarts.at Grübler Leo Leopold Arts Leon Bilder Art Unmöglichkeit Lg Galerie | Widescreen Panoramas Impossibility Fotokunstdesigner
761 GAK Wasserspringen Hauptmenü Tournament
gak-wasserspringen.at Tournament Alpe Adria österr Graz Mitglieder Int Jugendmeisterschaftenjugendmeeting Zufinale Paarspringen Ehrenmitglieder Galerie Trainer
762 Startseite Gtgtgt
filmbau.at Gtgtgt Anfrage Dekoteile Filmographie Galerie Requisiten Unser Team Textversion Kommenden Tage Geisterflotterechte Trailer
763 BYTE CREATIVE WALTER RIESEDER Creative
byte-creative.at Creative Galerie Byte Rieseder Partnerlinks Leistungen Walter Images Präsentation Digital Illustrationcreativeat Analog Z
764 Megahockey Megahockey
Megahockey...
megahockey.at Megahockey Uber Galerie Onofflinesro Produkte Fanartkel Lieferung Jersey Webseite Entwerfen Verarbeitung Unsteamdressen Hilfe
765 EGAmstetten Home Amstetten
Evangelikale Gemeinde Amstetten BEG...
egamstetten.at Amstetten Gemeinde Galerie Internes Anfahrt Evangelikale Veranstaltungen Evangelikal Uns Predigt Christen Frei Meldungenvorträge
766 Start expert_at Galerie
expert-foto.at Galerie Meine Cewe Entdecken Fotobuch Preisliste Mein Konto Wanddeko Lieferung Fotogeschenken Postkarte Fotosauftragssuche
767 Werkstatt Mizzotti Meisteraletier für Viola
Meisteratelier für Geigenbau...
mizzotti.at Viola Mizzotti Werkstatt Geigenbau Violoncello Meisteratelier Restaurierung Violine Gamba Meisteraletier Philosophie Da Galerie Goisern Pt
768 webad 2011 Home Phnomene
webad2011.at Phnomene Iab Lehrmeinung Welt Zeit Paradigma Gewinner Millionen Galerie Verfechtern Annahmen Inder Zukunftkonstante Setzt Ad
769 Galerie Zimmermann Kratochwill Home Zimmermann
galerie-graz.at Zimmermann Galerie Kratochwill Deutsch Without Goscinski Cooperations Represented Home Program Sofia Works Contacthead Past
770 Willkommen Carp
Infoseite rund ums carpfishing...
mission-carp-team.at Carp Team Fishing Austrian Ums Mission Galerie Carpfishing Riegersburgberichte Karpfen Gästebuch Hollenburg Infoseite
771 Brunnhofer Galerie Galerie
brunnhofer.at Galerie Sommerpause Brunnhofer Linz Kunstmessen Vergangen Aktuell Timptner Irene Kommend Deutsch Lucasedition English
772 Oppitz So will ich Planung
oppitz-wohndesign.at Planung Oppitz Galerie Wilde Geschmack Kundengesprch Anliegen Einrichten Terminen Gewinnergesprch Kundenbertholdverarbeitung Beste Oase
773 Dr Edmund Pabst Facharzt für Innere Facharzt
drpabst.at Facharzt Angiologie Innere Medizin Pabst Edmund Informationen Leistungen Intensivmedizin Krampfadern Galerie Lageplanarterien Venen
774 Homepage Schelch
lob-schelch.at Schelch Homepage Foto Galerie Karl Verantwortlichkundenliste Trofaiach Kinderlifte Sommerrodelbahnen Inhalt Sportsande Gerichtssachverstaendiger Mieteislaufplaetze
775 Buchhandlung Lerchenfeld Wir sorgen Buchhandlung
Buchhandlung Lerchenfeld Wir sorgen für Lesestoff. Regelmäßiger Lesezirkel....
lerchenfeldbuch.at Buchhandlung Lesezirkel Lerchenfeld Lesestoff Galerie Sorgen Buchtipps Events Wien Ffnungszeiten Mo Fr Wolfgang Bernhard Mtresse Zum
776 Home Q Resort überspringen
flairhotel-kitzbuehel.at überspringen Navigation Resort Jobs Port Galerie Gastgeber Ihr Entspannen Server Apache Partnerlage Geniessen
777 Kammgarn Programm Kammgarn
Kammgarn Veranstaltungsort...
kammgarn.at Kammgarn Sa Do Fr Musik Kinder Kabarett Programm Theater Eigenart Mi Galerie Partner Kulturwerkstatt Preise Veranstaltungsort Besenstiel
778 Rote Falken Österreich Kinderfreunde Dazu
rotefalken.at Dazu Galerie Kinderfreunde österreich Fehler Rote Falken Objekt Suchwort Rauhensteingasse Wien Fax Verschoben Das
779 judith roither schachl artpage Galerie
roither-schachl.at Galerie Gästebuch Judith Aktuell Roither Virtuelle Schachl Sponsoren Presse Personartpage Webmaster Spezial
780 Fichtenheim Emberger Alm in Greifenburg – Emberger
Herzlich Willkommen auf der Internetseite von Fichtenheim Emberger Alm in Greifenburg wo Sie Sommer wie Winter Erholung für...
embergeralm.at Emberger Fichtenheim Greifenburg Preise Alm Pauschalen Winter Galerie Anfahrt Küche Wetter Finden Abnehmen Wo Wintersport
781 CHRISTOPSOMMERSGUTER Sommersguter
Dies ist die offizielle Website des Musicaldarstellers Regisseurs Choreographen und Kulturmanagers Christoph Sommersguter....
christophsommersguter.at Sommersguter Christoph Galerie Vbw Presse Engagements Wake Musical News Kulturmanagers Christophsommersguter Regisseurs Vocal Elisabeth Y
782 Online Galerie Franz Haas Haas
Online Galerie des bekannten Weinviertler Künstlers Franz Haas...
franz-haas.at Haas Franz Galerie Grafik Abstrakt Kultur Kunst Pastell Weinviertler Malerei Bilder Radierung Knstlersfranzacryl
783 PUKL FILM private media Film
pukl.at Film Pukl Private Media Galerie Projekte Entertainment Zukunft Mittelnauslotung Grenzen Aufwand Infotainmentbereich Rahmensfrei
784 Pulsschlag Philipp Kerschbaumer Startseite Schlag
Schlag auf Schlag dem Ziel entgegen......
pulsschlag-wenigzell.at Schlag Pulsschlag Galerie Touren Mathematik Inline Skating Koordination Mountainbike Kerschbaumerdeutsch Bike Presse Port
785 Robert Ganisl Robert
robertganisl.at Robert Mail Eyedea Werbeagentur Ganisl Galerie Unternehmen Handwerk Showroom Mondseeshowroom Schlosshof Gaisbergstrmondsee Rufen
786 Dance Connection Dance
danceconnection.at Dance Connection Websiteihr Jahren Termineviel Gruppeund Seiten Galerie Partner Auftritte Amateurinformationen Team Programm
787 Maler Toth Startseite Toth
maler-toth.at Toth Maler Anfrage Leistungen Unternehmen Galerie Qualitt Stuck Einblick Kontakt Angebot Tapetenzgern Leistung_
788 We Will Rock You Rock
We Will Rock You...
queen-musical.at Rock Team Downloads Queen Videos Band Shop Galerie Creative Musical Tpl_beez_jump_to_nav Show Bboriginal
789 Herzlich Willkommen am Biohof Leimlehner in Leimlehner
Homepage des Biohofs Leimlehner Familie Paireder in St. Georgen am Walde....
erlebnis-planwagen.at Leimlehner Biohof Walde Georgen St Planwagen Planwagenfahrten Paireder Bioprodukte Mühlviertler Galerie Schmankerl Bio Johannfound The
790 Startseite | Krakauer Freunde Krakauer
krakauer-freunde.at Krakauer Pressemappe Biografie Sponsoren Galerie Mädls Freunde Krakaudorfer News Plattler Freundezvr Copyrighthomepageder | Kontakt
791 MV Harmonia Grossengersdorf Grossengersdorf
mvgrossengersdorf.at Grossengersdorf Foto Galerie Vorstand Besetzung GÄstebuch Mitglieder Wertungen Harmonia Homepage Mv Besucher Gegrmarschmusikbewertung
792 Allgemeines Startseite Veranstaltungen
Gemeinde Krumegg Aktuelles Immobilien Veranstaltungen Vereine etc....
krumegg.at Veranstaltungen Vereine Immobilien Krumegg Gemeinde Allgemeines Wirtschaft Galerie Javascript Umgebung Adresse Mail Gesundheitfax
793 Christine Eichinger Fotografie Fotografie
christine-eichinger.at Fotografie Christine Eichinger Zitate Galerie Tauche Fotowelt Vergleich Begeisterung Objekten Handy Christinesblick Strahlen
794 Feuerwehr Altach Altach
Ortsfeuerwehr Altach...
feuerwehr-altach.at Altach Jfw Einsätze Proben Bilder Galerie Fw Anlaesse Sonst Mannschaft Atemschutz _ Seit Feuerwehr Ortsfeuerwehr
795 Fotostudio Stummer Stummer
Inge Mandlr...
fotostudio-stummer.at Stummer Fotostudio Login Inge Galerie Mandl Team Besuch Sofort Galerieseiten Sofortgutschein Copygutschein Home|
796 Home Joomla
chorneubau.at Joomla Module Icons Chor Repertoire Templates Social Galerie Themeglobe Joomlacomsponsored Wien Informationenhochwasserhilfesofort Neubau
797 Studio Studio
Joomla dynamische Portal Engine und Content Management System...
nagelstudio-vera.at Studio Joomla Angebot Hände Unser Galerie Aktionen Dynamische Leistungen Sache Engineportal Copyright Charakter
798 Mozartgemeinde Wien
mozartgemeinde-wien.at Wien Mozartgemeinde Geschichte Auszeichnungen Wiener Mozart Figaro Mitgliedschaft Preise Vorstand Veranstaltungen Galerie Mozartsupdate
799 Rote Falken Wien Kinderfreunde Dazu
rotefalken-wien.at Dazu Kinderfreunde Rote Objekt Falken Fehler österreich Galerie Wien Faxverschoben Das Suchwort Rauhensteingasse Z
800 Herzlich Willkommen beim Motor Presse Klub Presse
Motor Presse Klub Austria...
mpka.at Presse Motor Klub Austria Spalte Zweiten Galerie Beimpixelweb Apache Server Permanently The Hauptnavigation Inhalt
801 Prometheus Öfen | Startseite Galerie
prometheuskachelofen.at Galerie Zeitlos Modern Traditionell Prometheus öfen Strahlungswärme Italiano Funktionsprinzip Bildergalerie Technikofenaufbau Uns Montage
802 p4uAgency Home Promotoren
promotoren.at Promotoren Agentur Unser Leistungen Galerie Jobs Team Puagency Arbeit Eventsangebote Erfahrung Wien Josef
803 Margit Feyerer Fleischanderl Z
fey-flei.at Z Projekte Künstlerin Bilder Illustrationen Galerie Zeichnungen Satire Figuren Fleischanderl Grafikerinkunst Feyerer Margit
804 Home Model
Romy Epikureer Model Pictures...
romyepikureer.at Model Sedcard Pictures Romy Gästebuch Shootingbereiche Steckbrief Vertrag Epikureer Galerie Besucher Heuteinternet =
805 Christine Cisarat Christine
Christine Cisar das etwas andere Portrait....
christine-cisar.at Christine Cisar Cisarat Photographie Galerie Etwas Sites Google Portrait Abuse Aktuell Herz__aufgooglesites Access
806 City Dach City
citydach.at City Stellenangebote News Galerie Unternehmen Fassade Partner Dach Steildach Spenglerei Team Flachdachfr Kontakt
807 rifftaucherat Galerie
rifftaucher.at Galerie Philippinen Laune Sammlung Gestern Philippinenreise Dropdownfeld Aufbau Dorthomepage Lust Statistik Wasser User
808 Fritz Marko Lebensart Marko Marko
Willkommen bei Fritz und Tanja Marko Lebensart Marko. Arbeiten in Öl auf Leinwand Platte und Holz in Verbindung...
fritzmarko.at Marko Lebensart Fritz Tanja Holz Wwwfritzmarkoat Leinwand Kunst Platte Arbeiten Steinmobile Galerie Verbindung
809 Herzlich Willkommen Ebensee
musikschule-ebensee.at Ebensee Seitenanfang Landesmusikschule Aktuell Schulgeld Verwaltung Galerie Unterrichtz Sommerferienzum Zeit Organisation Anmeldung Ferien Y
810 Start MÜHLBERGER 1a Installateur HEIZUNG + Installateur
None...
muehlberger1a.at Installateur Mühlberger Heizung Bad Login Panoramen News Flugblatt Angebote Galerie + Leistungen Mitarbeiter Bad Pfaffsttt Co
811 Muehlenteufl RAABA Raaba
Muehlenteufl RAABA...
muehlenteufl-raaba.at Raaba Muehlenteufl Mitglieder Gästebuch Login Galerie Chronikbeginn Homepage Reserved Findet Sommerfest Gruppe Uns
812 Galerie
Maja Jahn freischaffende Künstlerin Kreativtrainerin Maltherapeutin...
maja-art.at Galerie Jahn Maja Wirken Bilder Freischaffende Galerien Maltherapeutin Mich Margit Maltherapieauftragsarbeiten Kreativtrainerin Termineseminare
813 Knausserwald Penz | Because now Shorthorn
knausserwald-penz.at Shorthorn Penz Verkaufen Hochlandrinder Betrieb Galerie Knausserwald Unser Because Einloggen Bericht Kleinen Unter Familie |
814 Reformhaus Drack Gmunden| Startseite Reformhaus
reformhaus-drack.at Reformhaus Drack Produkte Aktionen Pdf Download Angebote Gmunden Unser Galerie Prospekt Reform Marktplatz Ffnungszeiten Y
815 Ramba Zamba Bar Herzlich Ramba
Der gemütliche Treffpunkt für Jung und Alt. Die Ramba Zamba Bar in Hippach im Zillertal......
rambazambabar.at Ramba Zamba Bar Events Member Galerie Gästebuch Treffpunkt Neuigkeiten Hippach Solutions Alt Pub Jung Kein
816 Die individuelle Randleiste mit Stil | Garten
Die Randleiste mit persönlichem Charakter exklusiv für Ihren Garten. Wir haben aus den USA ganz neu für österreich ein...
randleiste.at Garten Randleiste | Gartengestaltung Individuelle Betonrandleiste Ganz Die Jopuso Galerie Keinerlei Schnell Vorteil Usa Schmutz Socher
817 willy rast Rast
rastart.at Rast Willy Figural Kunst Werke Austria Galerie Atelierlandschaften Bild Steiermark Kuenstler Painter Ankaeufe
818 cr fotoat cr fotos Fotoat
christian rebl foto...
cr-foto.at Fotoat Cr Fotos Rebl News Gästebuch Galerie Foto Christian Vielschön Name Druckversion Bearbeiten
819 Home Yago
eppensteiner-doggen.at Yago Haus Jag Elfriede Tiefenbach Caca Rüden Sza Laude Summa Galerie Mail Vögel Wels Saz Adresse
820 Feuerwehr St Stefan ob Stainz Stainz
Homepage der FF St. Stefan ob Stainz...
feuerwehr-ststefan.at Stainz Stefan St Feuerwehr Einsätze Ob Ff Fuhrpark Homepage Mannschaft Xhtml | Galerie Verkehrsunfall Copyright Bewerbsgruppe
821 Willkommen Musikschule
musikschule-gnas.at Musikschule Musik Gnas Kinder Galerie Team Voranmeldung Homepage Smole_itdingen Gehirn Musikalisch Bildung Punkt
822 Club Cueva Cuevaat Cueva
Club Cueva Langenwang Willkommen auf der offiziellen Homepage. Infos zu Terminen Festen und die Cueva Galerie...
cueva.at Cueva Club Bon Langenwang St Cuevaat Fest Galerie Birthday Party Forum Gäste Ibiza Paddys Rauhnacht
823 Comebacksixty Band
comebacksixty.at Band Fanclub Demos Comebacksixty Galerie Programm Seecafe Jahrenzbbeatles Ton Stadt Livemusikmit Silvester Termin Fr Rollinganpassungfaires
824 Ricos World Ricos
ricko.at Ricos Download World Galerie Ricko Aktualisierung News Gstebuch Wolfgang Coming Bisher Wwwmatrixdesignat Umbaulatest
825 Autohaus Radauer | A 8820 Neumarkt Autohaus
radauer.at Autohaus Neumarkt Radauer Galerie Tankstelle Veit Team Peugeot Feiertage Suzuki News |mail Wirtschaftspark
826 Fredo Fredo
maler-fredo.at Fredo Galerie Bilder Formen Neuen Ausstellungen Gewohnheiten Netz Lange Bilderbei Pixelreduziert Meiner Farbenkontakt
827 Startseite radsport steixners Jimdo Steixner
radsport-steixner.at Steixner Jimdo Assos Hubert Galerie Page Radsport Partner Brands Jahren Highlight Radsportbrille Kundendruckversion
828 ***Feuerwehr Wien*** Erfolge
feuerwehrwien.at Erfolge Wien*** Khdrh Hunde Videos Archiv Galerie Einsätze ***feuerwehr Khd Skvwien Feuerwehruns Rettungshunde
829 Die Curt Goetz Seite Goetz
In Memoriam Curt Goetz und Valerie von Martens. Die Informationsseite über den bekannten Schauspieler Curt Goetz und dessen...
curt-goetz.at Goetz Curt Martens Valerie Copyright Memoriam Information Galerie Schauspieler Dimufidrainformationen Schauspielerleftpx Bekannten Informationsseite
830 Kleinnaglerhof Kleinnaglerhof
kleinnaglerhof.at Kleinnaglerhof Almrausch Pongau Help Galerie Johann Aussicht Seehhe Kinder Bauernhaus Sommer Gipfel Johannalpendorf Familieedelwei
831 Culture Club Club
culture-club.at Club Culture Geschichte Anfahrt Feste Galerie Programm Knstler Theaterevents Entstehung Cluban Rahmenprsentationen Feiern
832 Home Veranstaltungen
residenz-cafe.at Veranstaltungen Login Unser Angebot Jump Archiv Galerie Datum Zeit Searchnavigationsearch Mainjoomlar Schlunet Navigation
833 Home | rent Ebike Rent
Wir e mobilisieren...
rent-ebike.at Rent Ebike Galerie Werbefläche Ziele Preise Mobilisieren Privatemobil Mail Bord Bike Fahrradfahren Tel+fax |
834 Berufsfotografie Pressefotografie Scheucher Gtgt
Super Fotoalbum ein Projekt von MS Creative und I Connection...
msfoto.at Gtgt Galerie Zur Creativecom Fotoalbum Photos Projekt Fotografen Bildergalerien Wwwvollfotografat Wwwms Allgemeinen Fotos Creative Y
835 Willkommen Thalheim
musikschule-thalheim.at Thalheim Erfolgsanleitung Reifeneder Fcher Lehrer Galerie Informationen Mag Wolfgang Fotoalbum Organisation Querfltenklassesusanne Schlerin Lms Schick
836 AMCö Alaskan Malamute Club Malamute
malamute.at Malamute Club Alaskan Besuchern Amcö Neuigkeiten Minuten Galerie Login Rescuevorstand Website Rechte Amcalaskan
837 Bruckhaufen
primiz.at Bruckhaufen Breitensee Bilder Primiz Download Priesterweihe Gumpendorf Galerie Pfarre Letzte Beitrag Bewertenklauninger Druckbareversion
838 Promocams Bedruckte Einwegkameras als Gtgt
einwegkamera.at Gtgt Galerie Anfrage Cams Kandinsky + Promocams Empfehlen Bedruckte Version Werbeartikel Ltzurück Corporatewebsite Gt
839 index Kunstschmied
Der Kunstschmied aus dem Tullnerfeld...
kunstschmied-geiger.at Kunstschmied Mich Gallery Galerie Lindenstraße Website Designed Edelstahl Art Schmiedearbeiten Designschmiedeeisenaller Frauenhofentel Uzango
840 Sangeeta Indische Musik En
Sangeeta spielt Indische Musik. Rina Chandra Bansuri Peter Wiesinger E Gitarre begleitet von einem...
sangeeta.at En De Musik Wiesinger Rina Musiker Peter Indische Video Galerie Chandra Audio Sangeeta Perkussion Presse
841 Die Besondere Bibliothek Bibliothek
diebesonderebibliothek.at Bibliothek Besondere Intro Galerie Büchern Derbesonderen Jede Allerdings Bibliotheksgalerie Wurde * Ihres Genommeneinzigartigerbestand
842 Nagelstudio Picasso Nails Galerie
picasso-nails.at Galerie Blicke Nagelstudio Nails Picasso Ngel Bildung Lust Preise Besonderestudio Euromchten Nailart Designgehren
843 index Wurf
sanfter-riese.at Wurf Katzen Galerie Mail Spaßauf Foto Regenbogen Plan Zucht Erwartet Mittevergebene Homepage Tiere
844 Aktuell Joomla
Joomla dynamische Portal Engine und Content Management System...
die43er.at Joomla Musik Forum Content Jump Weblinks Dynamische Login Information Galerie Permanently The Endemitglieder Apache
845 marco colazzo | Home Unternehmen
marco-colazzo.at Unternehmen Jobs Stein Fliese Galerie Aktionen Uhr Colazzo Montagbis | Agbbad Wllersdorf Marco Resselstraße
846 RT10at RoundTable10 Klagenfurt Austria Roundtable
RoundTable Austria...
rt10.at Roundtable Klagenfurt Symbol Table Round Austria Laufen World Pin Fotos Galerie Contact Around Rtat Weihnachtsstand
847 Elektrotechnik Nebel GmbH Nebel
Elektrotechnik Nebel GmbH...
elektro-nebel.at Nebel Elektrotechnik Galerie Leistungen Firmenbeteiligungen Team Gmbh Elektro Zhauptmenü * Website Peter Uns Deutschlandsberg
848 Landmaschinen Hütter Gnas Hütter
Landmaschinen Hütter Gnas...
kfz-huetter.at Hütter Aktionen Landmaschinen Gnas Einfach Kommen Huetterat Fa Traktor Galerie Produkte Ansprechpartner Traktorenhuetter
849 Startseite Evangelische Pfarrgemeinde AB Eferding
evang-eferding.at Eferding Pfarrgemeinde Evangelische Galerie Angebote Ab Unser Jugend Mag Hochwasser Hilfe Pfarrer Mitarbeiter Hanek Geschichte
850 Sandor Csok Sandor
Skulpturen von Sandor Csok...
sandor-csok.at Sandor Csok Skulpturen Steinskulptur Holzskulptur Impressum Zeichnung Bsten Galerie Steiermarkallg Skulpturallg Graz Grafik
851 Feedhunter Robert Feedhunter
Sat Feeds Satellitenstarts Testbilder Galerie Technik und Anlagenvorstellung von Feedhunter Robert...
satfeed.at Feedhunter Sat Testbilder Anlagenvorstellung Launch Ariane Satellitenstarts Robert Dx Drehanlage Log Feeds Schedule Satfeeds Polarmount Galerie
852 Kesselreinigung Krassnig CALCIDEX Krassnig
kesselreinigung-krassnig.at Krassnig Kesselreinigung Calcidex Website Free Templates Hallegger Javascript Krassnigat Galerie Designedfax Copyright Bankdatenkontaktdaten
853 Eisrausch die Life Radio Radio
EISBOX Der Liferadio Eislaufplatz am OK Platz in Linz...
eisrausch.at Radio Life Linz Bilder Eisbox Ok Video Galerie Eisrausch Liferadio Platz Eislaufplatz Kunstwald Wettermelder Y
854 home paparazzipezi Jimdo
peterorlik.at Jimdo Logout News Orlik Galerie Bild Members Gelangen Einfach Bearbeiten Druckversion Home Contact Y
855 Schalmeienzug Lauterach Schalmeienzug
Information architecture Web Design Web Standards....
schalmeienzug-lauterach.at Schalmeienzug Lauterach Chronik Web Galerie Lieder Mitglieder Gästebuch Shows Design Architecturekeywords Beim Standards
856 Pfarre Sievering Pfarre
Pfarre Sievering pfarre sievering.at...
pfarre-sievering.at Pfarre Sievering Archiv Kirche Galerie Pfarrnachr Team Geschichte Derpfarre Frderer Wien Grüss Berichtegott
857 schafellnerArt Schafellner
Diese Website zeigt alle Bilder und Daten von Guenther Schafellner in mehreren Galerien kann man sich diese genauer...
schafellnerart.at Schafellner Guenther Schafellnerart Günther Ansehen Galerien Bilderwebsite Zeigt Daten Menu Genauereren Galerie
858 Willkommen in der Labstelle Wien Labstelle
labstelle.at Labstelle Wien Lieferanten Reservieren Finden Presse Jobs Trinken Essen Galerie Septembermo Sa Mo Fr Install Google Different
859 Startseite kranebitterklammlabradorss jimdo page Diego
labradorzucht.at Diego Jimdopro Dieses Last Jimdo Gästebuch Ausbildung Direct Meine Labradors+++ Inhalte Angebotaugenblicken Galerie
860 Gt
schachclub.at Gt Presse Artikel Endtabelle Dkt Events Beratung Finanzen Galerie Schach Einsehbar Passwort Opensslcserver Süd Genaue
861 Cantores Dei Startseite Cantores
cantores-dei.at Cantores Dei Band Hochzeiten Chor Webshop Galerie Gospel Siebert Disclaimer Dorn Uns Dei  *intern
862 Villa SunsetPalms Cape Coral Villa
Ab November 2012 wird Villa SunsetPalms in Cape Coral zur Vermietung angebote alle informationen stehen schon aktuell schon...
cape-coral.at Villa Sunsetpalms Cape Coral Florida Vermietung Preise Belegung Haus Front Seats Galerie Stehen Ab Y
863 Meine Website Stixenstein
labanda.at Stixenstein Fest Keller Halloween Galerie L Gruppe Meine Banda Lobo Hochzeit Ernesto Website Fabiola
864 Marktmusikkapelle StMarein bei Graz Marktmusikkapelle
Webseite der Marktmusikkapelle St. Marein bei Graz Aktuelles Termine Fotos allgemeine Infos...
mmk-marein.at Marktmusikkapelle Graz Joomla Stmarein Mitglieder Galerie Intern Joomlashinecom Uns Fotos Marktmusik Webseite Ahadesign Pickelbach Y
865 Willkommen im Gasthof Neupradl Gasthof
Gasthof Neupradl Essen und Zimmer Vermietung in Innsbruck im rustikalen tirolerischen Stil...
neupradl.at Gasthof Neupradl Zimmer Innsbruck Vermietung Nidy Design Essen Österreich Zentrumherzen Galerie Janesch
866 Main Kunstfaden Kunstfaden
kunstfaden.at Kunstfaden Leinen Uhr Kurse Handarbeitsabteilung Main Tracht Galerie Kunsthandwerk Hand Antiquariat Handarbeit Hoamgartenkontaktverkaufsausstellung Ausstellungsdauer
867 Werkstatt für systemische Tun | Startseite Literatur
mantaja.at Literatur Werkstatt Systemisches Arbeit Systemische Outdoor Team | Menschen Galerie Alters Idiolektischen Plattform Systemischen Y
868 wwwpiscesat Startseite Galerie
pisces.at Galerie Artenliste Anmeldung Joomla Publikationen Mich Direkt Wwwpiscesat Cichliden Wechselnpermanently The Moved Buntbarsche Hauptnavigation
869 Pongauer Sonntagsmusi Pongauer
pongauer-sonntagsmusi.at Pongauer Sonntagsmusi Wochenende Almabtrieb Besetzungen Gruppe Galerie Neuss Waren Reiseberichtgehtswebsite Beim Reisebericht Gehts
870 copy POOSCH GRAFIK KEG Keg
POOSCH GRAFIK KEG · Werbung · Fotografie · Text...
poosch-grafik.at Keg Grafik Poosch · Werbung Zell Fotografie Cooperate Afrika Webdesign Galerie Foto Design Prospektgestaltung Y
871 Wir über uns Most
Test...
kuchlbauer.at Most Kuchlbauer Mostbuschenschank Mostgut Galerie Spitzer Linkliste Anfrage Uns Obstwein Bestellung Od Apfelwein Vorau Sortiment Theresia
872 Landgasthof Höfer Landgasthof
Landgasthof Höfer Home...
der-wirt.at Landgasthof Höfer Galerie Reservierung Speiseplan St Lamprechtshausen Essen Bürmooshofer Hotel Gasthaus Landgasthaus Pantaleon
873 Willkommen auf der Startseite Joomla
Joomla dynamische Portal Engine und Content Management System...
nail-it.at Joomla Preise Design Ec Gesetz Galerie Mich Infoblatt Studio Dynamische [zur Vereinbarungwichtiges Pflegetipps Jeannette Link
874 Willkommen bei RS Stahlhandel Stahlhandel
RS Stahlhandel Rudolf Schobe...
rs-stahlhandel.at Stahlhandel Springen Rs Rudolf Stahl Edelstahl Schobe Kontaktseite Inhalt Navigation Programm Galerie Unternehmen Przisionssthle Y
875 Powerfrog Music Helmut F Powerfrog
Powerfrog music Helmut F. Slave Baff...
powerfrogmusic.at Powerfrog Helmut Music Dylan Members Gitarre Revival Pop Galerie Bob Slavefröschl Rock Referenz
876 Joomla
Joomla dynamische Portal Engine und Content Management System...
pranam.at Joomla Philosophie Imageslideshow Meditation Feuerpujas Galerie Wissen Healing Energiearbeitvedisches Kinderjugendliche Wann Praxis Leistungen
877 Startseite Rowalt Gebäudereinigung Galerie
rowalt.at Galerie Grundreinigunggebäudemanagement Schmutzmattenservice Hosting Uarruarruarr Personalleasing Richtiger Presse Ihr Partner Tankstellenreinigung Dev Industriereinigung
878 Kapfenberger Sport Verein Fitsport News
ksv-fitsport.at News Fitsport Verein Team Neuen Gästebuch Sport Galerie Kapfenberger Ksv Standortewebsite Unser Newsarchiv
879 == Prehm Reisen == Reisen
prehm-reisen.at Reisen Anfahrt Fuhrpark Reiseangebote == Unternehmen Partner Galerie Prehm Wellnessreisen Musikreisen Grenzen Gruppen Sonderfahrtenteam
880 Willkommen auf der Seite der Mortantscher Mortantscher
Mortantscher Plattler...
mortantscherplattler.at Mortantscher Plattler Spalte Tradition Videos Port Showprogramm Inhalt Ersten Portrait Galerie Hauptnavigationabmelden Server
881 dessl hat Dessl
Dessl Homepage...
dessl-h.at Dessl Prager Fotoschule Homepage Photo Urheberrecht Zitate Bild Foto Fotobcher Galerie Letzte Haraldklick
882 Kindergarten Marianne Home Marianne
kindergartenmarianne.at Marianne Kindergarten Bergmann Christoph Homepage Gruppen Galerie News Philosophie Murauer Kinder Eindruck Kindergartenplatzsuchencopyright
883 Ceterum Werbung Marketing Web Design
Web Site Gestaltung und Design sowie alles rund um die Werbung und Marketing...
ceterum.at Design Ceterum Marketing Web Werbung Medicus Management Galerie Agentur Besten Relationship Internet Arzt Total Art
884 freizeit bewegt Home Partner
pix4you.at Partner Freizeit Bewegt Aktiv Plan Programmangebot Galerie Veranstaltungen Bewegung Freude Informationsmaterial Michloading Lebenich
885 Kunst Melangerie | Aquarelle Kunst
Kunst Melangerie Aquarelle Kunststiche Skulpturen Kleinod Co zum güstigen Preis für jedermann...
kunst-melangerie.at Kunst Melangerie Angebote Philosophie Skulpturen Kunststiche Team Vernissagen Aquarelle | Galerie Co Kleinod Gemälde Unikate
886 Hannes Lumpelegger Lumpelegger
lumpelegger.at Lumpelegger Hannes Werken Mail Texte Ausstellungen Akte Galerie Aktstudien Bewegung Wipplinger Clemenswipplingerinteresse Copyright
887 kfz riedl Startseite Lageplan
kfzriedl.at Lageplan Berzeugen Rallye Galerie Gebraucht Agbs Leistungen Inhalt Terminvereinbarung Mail Autos Kompetent Zuverlssig Kfz Y
888 SABI foto Fotografin Steyr Foto
Herzlich Willkommen bei SABI foto. Es freut mich dass Du meine Seite besuchst. Auf meiner Homepage präsentiere ich...
sabi-foto.at Foto Sabi Kommunikativ Kreativ Galerie Individuell Fotografin Ich Querschnitt Blog Schaffens Homepage Mich Steyr Dir
889 Internes
kgvsuezbreitenlee.at Internes Kalender Homepage News Vereinsleitung Tipp Galerie Cabanova Geschichte Gaestebuch Letzte Kleingartenvereinsport Breitenlee
890 Kick Ass 2 | Offizielle Website Ass
Bereits Kick Ass brach mit kompromissloser Action und beißendem Humor genussvoll die Regeln des Superhelden Genres “KICK ASS...
kickass-derfilm.at Ass Kick Website X | Galerie Kino Inhalt Downloads Offizielle Trailer Einzig Legt Superheldenfilm Genres Superhelden
891 Willkommen Gemälde
dida.at Gemälde Favoriten Werbegrafik Galerie Design Photographie Digital Maskottchen Partner Emailz Empfehlen Hinzufügen
892 Kunsttherapie Gerstenmayer Kunsttherapie
Kunst als Therapie Claudia Gerstenmayer klinische und phronetische® Kunsttherapeutin in Graz Steiermark. Maltherapie Gestaltungstherapie und Kunsttherapie. Therapie mit...
kunst-als-therapie.at Kunsttherapie Graz Angebote Gerstenmayer Mich Praxis Therapie Kunst Galerie Kunsttherapeutin Claudia Steiermarkfarben Formen
893 Naturstammhaus Kalkalpen Home Naturstammhaus
naturstammhaus-kalkalpen.at Naturstammhaus Kalkalpen Aufbau Galerie Haus Schmidthaler Wald Linkshtml Kontakt Natur Garnweid Franztrinker@speedatmobil
894 Gemischter Chor der Dorfgemeinschaft St Jakob Jakob
Dorfgemeinschaft St. Jakob Musik Chor Kärntnerlied...
dg-st-jakob.at Jakob Dorfgemeinschaft Chor St Kärntnerlied Musik Inkürze Aktualisiert Fotos Unter Galerie Eurechronik Seiten
895 Foto WorX Foto
Foto WorX Ich mache ihre Fotos...
foto-worx.at Foto Worx Ich Fotos Mache Preise Bergmann Mrpuwu Leistungen Consulting Galerie Auftritt Bilder Internet Wo
896 Home Hotel
Entspannen Sie sich in bester Lage im Hotel Gasthof Mostwastl in Salzburg....
mostwastl.at Hotel Mostwastl Gasthof Salzburg Zimmer + Buchen Restaurant Aktivitäten Bar Uns Galerie Found The Copy Bester
897 Reinhard Breitner Homepage Reinhard
Homepage von Reinhard Breitner...
breitner.at Reinhard Breitner Homepage Galerie Login Texte Schule Gedichte Start Malererei Grafikbilder Hauptschule Songs
898 Ferienwohnung Jaufenthaler Ihr Urlaub Ferienwohnung
Urlaub in der Ferienwohnung Jaufenthaler am Zettersfeld mit Blick auf die Lienzer Dolomiten ruhige Ferienwohnung für Ihren Urlaub...
jaufenthaler.at Ferienwohnung Urlaub Zettersfeld Jaufenthaler Galerie Vacances Ruhige Privat Anfrage Ihr Wwwosttirolcomwwwdolomitenstadtat Günstig Anreise
899 Sunsara Farbenwelt Design
Sunsaras Website...
sunsara.at Design Sunsara Gallery Textilien Farbenwelt Projekt Sonne Website Homepage Bilderkunst Farben Kraftbilder Galerie
900 Startseite Gertis Salon Salon
Gertis Salon Geringergasse 222 1110 Wien...
gertis-salon.at Salon Gertis Wien Geringergasse Anfahrt Galerie Preise Logout Beauty Massage Gesichtsbehandlung Teint Alltag Mkm Y
901 Allgemeine Information TheoTag Linz Alt+
theotag-linz.at Alt+ Linz Workshops Vorlesungen Theotag Stellen Gibt Ausbildung Dann Ablauf Navigation Galerie Einblickeanmeldung Arbeiten
902 Startseite Damwild
Joomla dynamische Portal Engine und Content Management System...
wildgehege-schober.at Damwild Rotwild Joomla Galerie Muffelwild Portal Wildgehege Franz Teilen System Enginecontent Management Mufflon
903 Andreas Kogler Andreas
ae100.at Andreas Kogler Presseartikel Galerie Angebote Interpretationen Kogleroldo Lubicholdo Tonträgertontrger Lubichfrank Sinatra
904 Home Galerie
studiofoto.at Galerie Gesetzen Ihres Bilder Galerien Fotos Seiten Albumseite Besuchersollten Studiofotoat Inhalten Wichtiger Hinweisin
905 Hobby Hundefotografie Shootings
Hundefotografin Christine Faltner erstellt Hundefotos aus Leidenschaft die aktive Hundesportlerin zeigt Hunde im besten Licht und...
hundefotografin.at Shootings News Galerie Hobby Hundefotografie Christine Faltner Leidenschaft Licht Aktive Besten Hält Erstelltcopyright
906 Willkommen bei Galerie M Galerie
Willkommen bei Galerie M...
galeriem.at Galerie Kunst Magistris Margarete Galeriem Objektkunst Bildhauerei Fotografie Bildende Zeitgenoessische Grafikangewandte Film Design
907 Galerie Hofkabinett Linz Linz
hofkabinett.at Linz Bitte Eintreten Kunstgeschenke Fischnaller Josef Altstadt Vernissage Galerie Bronze Oberoesterreich Hofkabinett Kunstbronzeplastiken
908 joshuas catering und partyservice wien Catering
Since 2008 Joshua has run the catering business by himself emphasizing unique combinations of ingredients and cooking methods...
joshuascatering.at Catering Events Locations Partyservice Galerie Kochkunst Wien Offering Each Feiern Himself Büfett Thus Dishes Ingredients
909 vespastadlat Vespa
vespastadl.at Vespa Shop Werkstatt Fahrzeuge Galerie Reparatur Vespaverkauf Reparaturen Baujahr Rollerverkauf Vespastadl Adressemeine Vespas
910 Atelier Katharina Lindinger Atelier
Atelier Katharina Lindinger...
atelier-lindinger.at Atelier Katharina Lindinger Galerie Lebenskunst Karten Kunsttherapie Kurse Mich Partner Dominxcm Puppenkleider Stadtgeheimnis
911 GALERIE JOHANNES FABER | KOPPITZ Faber
Fotogalerie Faber mit wechselnden Ausstellungen Schwerpunkte sind österreichische und tschechische Fotografie der Klassik und Gegenwart. Gallery faber has...
johannesfaber.at Faber Johannes Galerie Wien Fotogalerie Exhibitions Gallery Koppitz Vienna Fotos Gegenwart Exhibtions |tschechische
912 Wofgang Razka Illusionsmalerei Illusionsmalerei
Illusionsmalerei...
atelier-r.at Illusionsmalerei Neu English Kuscheltiereporträts Razka Wofgang Galerie Auftragsabwicklung Prsentation Muralpainting Kunstmalerei Wall Information
913 tomgadnerat Startseite Galerie
Schnell Unkpmpliziert Bezahlbar...
tomgadner.at Galerie Leistungen Mich Fotodesign Hastbis Bilder Paar Schnell Tomgadnerat Entsteht Fotodesigner Unkpmpliziert Einfachstartseite *
914 Fischerstube Home Fischerstube
angelshop-fischerstube.at Fischerstube Partner Gästebuch Produkte Galerie Anfahrt Adminbereich Unsinnsbruck Maturaprojektes Unserervergnügen Webseite
915 Kontrapunkt Food
Kontra Punkt Kontrapunkt vinssimo Vinothek Restaurant Slow Food...
vinissimo.at Food Vinothek Restaurant Slow Kontrapunkt Essen Galerie Catering Punkt Vinssimo Vino Wine Weinslowfood
916 HOME | Tkalec | Tkalec
Tkalec Antiquitäten in Oberalm bei Salzburg. Überzeugen Sie sich selbst von unserem Angebot auf über 1000 qm Schauraum....
tkalec.at Tkalec Antiquitäten Schauraum Tisch Neuheiten Video Galerie Salzburg | Social Salzburger Schrank Qmob
917 whitecubeat Home Lukas
whitecube gallery from lukas eggerstorfer...
whitecube.at Lukas Galerie Fotoseite Homepage Whitecube Viel Whitecubeat Endlich Eggerstofer Betrachteneggerstorfer Webseite Bilder Kunst
918 Home Tkb
tkb ip tkb Fertigung Konstruktion CNC...
tkb-ip.at Tkb Template Lernvidcom Logout Ip Tkb Fertigung Konstruktion Cnc Login Videos Maschinenpark Leistungen Galerie Partnerin Hometechnischen Imber
919 Die Tanzschule in Wiener Neustadt Tanzschule
Die neu Tanzschule Weninger in Wiener Neustadt als Nachfolger der TS Polz...
tanzschule-polz.at Tanzschule Gtgt Neustadt Weninger Zumba Galerie Bernd ● Wiener Events Polz Uns Hop Hip Kundalini Nadelkurse
920 Tanzfreunde Weiz Home Tanzfreunde
Club Tanzfreunde Weiz...
tanzfreunde-weiz.at Tanzfreunde Weiz Club Galerie Tanzen Siewillkommenimclub Vorstand Bildungsmglichkeiten Bungsdann Gute Clubkalender News Gerne
921 Atelier im Hof Atelier
atelier-stadler.at Atelier Freistadt Mischtechnik Hof Aquarell Zeichnungen Galerie Malerei Keramik Kunst Pastell Sterreich Modernewaaggasse Stadlerat
922 Tamr Henna Dance Dance
Tamrhenna Dance...
tamrhenna-dance.at Dance Videos Biographie Company Unterricht Design Galerie Henna Tamr Uns Th Devina Tamrhenna Tanzkunst Enter
923 Trachtenmusikkapelle Schleedorf Schleedorf
tmk-schleedorf.at Schleedorf Pfarrkirche Trachtenmusikkapelle Feldkirchen Unser Turmblasen Datum Konzertwertung Salzburg Mitglieder Galerie Beginnmesse Veranstaltung
924 Traditionelles Taekwondo Graz Taekwondo
taekwondo-graz.at Taekwondo Graz Traditionelles Kampfkunst Galerie Energie Classic Entwickle Traditionell Wwwtaekwondo Grazattraining Selbstverteidigung Traditionellem
925 || wwwagt transat || Allgemeine Güter ||
www.agt trans.at ... moving forward logistics...
agt-trans.at || Güter Transporte Wwwagt Transat Forward Agt Logistics Moving Transport Europa Galerie Neuhodis Trans Unternehmen Y
926 wwwtonmalereiat Pottery Painting Painting
tonmalerei.at Painting Kunsthandwerk Pottery Galerie Wwwtonmalereiat Tonmalereikunst Bunt Art Kunstforum Bemalte Veranstaltung Tassen Galerien Kunstverzeichnis
927 Herzlich Willkommen Herz
wirtschaft-mit-herz.at Herz Spenden Veranstaltungen Solltest Galerie Anstehende Gstebuch Gemeinde Benefiz Zweck Team Allgemein Organisatorenzusammenschlu
928 achim gauger | gesehen Greetings
achimgauger.at Greetings Tonart Beyars Galerie Ars Art Achim Webstream Gauger Contemporary Genussgalerie Raika Basart Maggies Kunst Geht
929 architektursteinkogler Architektur
Beschreibungstext...
steinkogler-planung.at Architektur Energieausweis Profil Auz Werke Gru Team Architektursteinkogler Altmünster Steinkogler Covplanung Galerie Beschreibungstext
930 Jungunternehmerpreis 2013 Login
jungunternehmerpreis.at Login Jury Kategorien Gewinner Voten Galerie Jupito Archiv Jungunternehmerpreis Jw@wkooeat Hessenplatzjunge Linz Wirtschaft
931 WOHNTIPPat Motiv
wohntipp.at Motiv Halter Wohntippat Eichenholz Preis Galerie Beispiele Motive Höhe Tiefe Kinderschreibtisch Material Agbbht
932 Holo Con Con
Offizielle Seite der Holo Con...
startrek-larp.at Con Holo Larp Regelwerk Logbuch Trek Login Galerie Forum Star Verein Anmeldung Startrek Browser Sorry
933 home atelier art wallerseeat Homepage
home...
atelier-art-wallersee.at Homepage Atelier Software Henndorfmobiltel Shop Copyright Texte Anfahrt Pache Galerie Kaisergtla Letzte Literaturmariehujo
934 Gasthaus Atzmüller Server
gh-atzmueller.at Server Grillabendkarte Kulinarisches Galerie Found The Apache Gtgt Gtgtunsere Veranstaltungen Unser Speisekartefound Haus Port
935 Deitron Redaktionssystem Bildershop
Deitron Redaktionssystem...
bild-glas-bergmann.at Bildershop Deitron Redaktionssystem Galerie Glaserei Geschenke Spiegel Rahmen Uns Bilderrahmen Graztel+fax Bergmannaktuelles Sparbersbachgasse Kontakt Z
936 Galerie | Bild Bank Wien | Klaus
bildbank.at Klaus Pichler Marketing Kunst Forum Bild Galerie Homepage Wien Website Kommunikation | Bank Coach
937 Star Stone Stompersdokuphpid=start Stone
Dies ist die Homepage der Starstonestompers einer Linedance Gruppe aus Bad Leonfelden....
starstonestompers.at Stone Leonfelden Starstonestompers Bad Linedance Star Tanzarchiv Stompersdokuphpid=start Gruppe Galerie Stompers Internessternstein Gaestebuch
938 Herzlich Willkommen Fitness
starlife-gleisdorf.at Fitness Galerie Suspensiontraining Plate Belt Video Zumba Power Anmelden Jobs Leistungsspektrum Simply Teamfrenetic
939 GALERIE galerie wunderkammers Webseite Galerie
galerie-wunderkammer.at Galerie Pierre Emmanuel Luca Aufbau Vuitton Benda Hildegard Max Rizzi Wunderkammers Dalinger Angela James Y
940 hansns maggies timos website Gallery
das ist die private website von hansn maggie timo...
hansn.at Gallery Hansn Nützliche Maggie Timo Website Timos Speedtest Bad Maggieshansns Galerie Private Foto
941 Steirisch Pub Wien Startseite Pub
steirisch-pub.at Pub Steirisch Wien Galerie Poier Sparverein Rent Anfahrtsplan Wochenprogramm Steirerstammtisch Bringen Bilder Panorama Alfkeine
942 Home best Handels
Description Text...
bhp-austria.at Handels Products Galerie News Deutsch English Best Agbs Produkte Ansprechpartner Kontakt Wer Home Peter Fax Gmbh St
943 Herzlich Willkommen Sternwarte
sternwarte-stattegg.at Sternwarte Astrofotografie Galerie Rosettennebels Rosettennebel Stattegg Kuppel Sternwartenbau Eqascom Astronomie Garradd Bildeqmod Nordamerikanebels
944 Home Meeting
accg.at Meeting Crocodile Kids News Ps Informationen Sale Einlass Galerie Usa Flyer Gtgtgtgtgthierltltltltlt Stingers Anmeldung Doc Mopargarage Y
945 GALERIE JÜTTNER Jüttner
Millergasse 25 1060 Vienna...
juettner.at Jüttner Galerie Cssjockey Wordpress Login Powered Vienna Connectprogress Stay Work Millergasse Backend
946 Vermessung Wild Wild
vermessung-wild.at Wild Galerie Wildat Vermessung Innsbruck Mobil Ingenieurkonsulent Hubert Fax Vermessungsbro Vermessungswesen Philippmatt@vermessungstaatlich Grabenweg
947 stadtgalerie schwaz Schwaz
galeriederstadtschwaz.at Schwaz Editionen Stadt Server Archiv Found The Galerie Oswald Programm English Oberhuber Stadtgalerie Apacheversion
948 Restaurant Restaurant Hohenburgerhof Restaurant
Restaurant Hohenburgerhof Pizzeria Time Out Steiermark Voitsberg St. Johann ob Hohenburg...
hohenburgerhof.at Restaurant Pizzeria Hohenburgerhof Gästebuch Galerie Navigation Veranstaltungen Speisekarte Hohenburg St Steinkellner Solutions Partner Ob Web Out
949 Startseite Hartl
Startseite...
hartl-forellen.at Hartl Fisch Produktionsanlagen Speisefisch Aktuell Bilder Galerie Rezepte Warenangebot Copyright Personen Nahrungsmittel Erstellthomepagefix
950 Atelier Hirschberg Bilder
atelier-hirschberg.at Bilder Atelier Ausstellungen Grafik Hirschberg Kurse Galerie Mischtechnik Acrylbilder Biographie Hof Gästebuchgstebuch Links
951 Atelier Gstrein Landschaftsplanung Gstrein
Ingenieurkonsulent für Landschaftsplanung DI Dietmar Gstrein Valiergasse 58a 6020 Innsbruck Austria...
atelier-gstrein.at Gstrein Landschaftsplanung Atelier Uve Innsbruck Landschaftsarchitektur Austria Büro Galerie Biografie Login Garten Botanik Bestandsaufnahmenaturschutz
952 die betriebiclowns Clowns
betriebiclowns.at Clowns Nochwas Galerie Betriebiclowns Frderungspenunter Peppiunermdlich Wann Landobersterreich Winter Braucht Weil Trost Arbeitnehmern
953 Abersee Perchten Perchten
abersee-perchten.at Perchten Abersee Gästebuch Mitglieder Galerie Geschichte Diezeit Land Hompageperchten Es Finsterniss Dunkelheit Zeit Z
954 wwwjugend altachat Fotos
jugend-altach.at Fotos Sommers Galerie Fotogalerie Altacher Jugendarbeit Replay Last Gstebuch Gästebuch Altachat Sts Wwwjugend Programm Y
955 Herzlich Willkommen in der Galerie Weber Weber
Atelier und Galerie für Malerei und Keramik Ulla und Helmut Weber Zwettl an der Rodl Mühlviertel Oberösterreich...
atelier-galerie-weber.at Weber Galerie Atelier Helmut Ulla Malerei Zwettl Keramik Mühlviertel Rodl Bild Linzbilder Z
956 Juranitsch Racing Racing
Juranitsch Racing...
juranitsch-racing.at Racing Juranitsch Rad Saison Thomas Presse Material Magnum Equipment Rennen Verfgung Sponsoren Galerie Most Rijeka
957 Tina Bayer Physiotherapie Bayer
therapie-bewegt.at Bayer Philosophie Physiotherapie Tina Galerie Energie Mail Biografie Therapie Wienvoranmeldung Bewegtat Diplphysiotherapeutin Christina
958 Lanyards Bedruckte oder gewebte Gtgt
badgeholder.at Gtgt Anfrage Galerie Lanyards Premium Straps Logo Photodruck Leder + Ltzurück Agb Gt Gedrucktem Shoelaces
959 Nagelwerkstatt Adrien Startseite Leistungen
Außergewöhnliches Design und persönliche Beratung stehen bei mir an oberster Stelle....
tibor.at Leistungen Adrien Galerie Design Nagelwerkstatt Stelle Beratung Studio Uns Kaffee Ende Ihregelnägel Mo Fr Eintrages
960 we workshops for entrepreneurs Join
Intro...
we-workshops.at Join Archiv Downloads Idee Galerie Kosten Programm Workshops Anmeldung Vortragende Teilnahme Veranstalter Introentrepreneurs
961 Thai Massage Ungarn Massage
thaimassageungarn.at Massage Thai Preise Ungarn Gäste Galerie Fertőd Thaimassageungarnat Schauenstress Preis Tisch Seele
962 Welcome to Traditional Thai Massage in Massage
Ein Angebot für Traditionelle Wat Pho Thai Massage in Wien...
thai-massage-wien.at Massage Thai Anfahrt Neuigkeiten Ausbildung Haftung Kontaktformular Hinweise Galerie Preise Angebot Traditionelle Wien Pho Welcome
963 Kreativ Atelier Iko Art nachhaltige Objekte Objekte
das kreativ atelier iko art produziert fun art objekte aus nachhaltigen materialien. die deko objekte sind...
iko-art.at Objekte Art Atelier Workshops Nacht Kreativ Iko Fun Ausstellungen Stockobjekte Malerei Galerie Stcke Leucht Diverse Innen
964 Textil Art Siglinde Böhmer Siglinde
Siglinde Böhmer zeigt Textilbilder für Raumdesign. Vorbild für manche Textilcollagen aus Rohseide oder Loden waren Mondrian und Klee....
textil-art.at Siglinde Textil Böhmer Ausstellungen Klee Mondrian Art Galerie Vorbild Textilbilder Textilkunst Loden Wohnaccessoiresrohseide
965 Home Strasshof
inside2231.at Strasshof Forum Nordbahn Informationsaustausch Galerie Strasshofer Plattform Sstrasshof Pressecommunitybildung Besonderen Deiner Strasshoferinnen Interessierte
966 Panaceo TennisBase Villach Die Tennisbase
Panaceo TennisBase Villach...
tennisbase.at Tennisbase Villach Panaceo ] Team [ Plattform Jugendliche Dobnig Stefan Galerie Lagler Spieler Trojani Turnieren
967 Auto Frohn Frohn
auto-frohn.at Frohn Team Galerie Firmengeschichte Autohaus Lageplan Gebrauchtwagen Partner Auto Tuning Gebrauchtwagenankauf Ffnungszeiten Verkauffinanzierungsservice
968 Willkommen | Berggasthof Tenn Tenn
tenn.at Tenn Jump Ferienwohnung Tenner Galerie Stadl Berggasthof Hopfgarten |innersalvenbergwillkommen * Navigation Wahrstötter
969 WEGA live Die Band Band
wega-live.at Band Wega Live Hochzeit Tanzband Liveband Musikband Party Version Google Gpl Galerie News Ihr Partybands
970 Galerie von Alois E Request
aloisendl.at Request Akt Abstrakt Natur Kärnten Portrait Galerie Studio Verschiedenesport Reisen Architektur Outdoor Bodypainting
971 WDA Innsbruck WDA Wda
{pagedescription}...
wda-innsbruck.at Wda [] Innsbruck Ausbildungsschwerpunktmediendesign Bewerbungstag Design Advanced Bewerbung | Ausbildungsschwerpunktgrafikdesign Galerie Dtpprint Ausbildung Meet Good Offenen
972 High Hill Ranch Hill
highhillranch.at Hill Ranch High Paint Guestb Horses Pferde Galerie Trail Anlage Kuntner Franzaktuell Hildegard
973 Homepage Location
altelampe-wien.at Location Homepage Galerie Hour Happy Alten Findet Team Mieten Seit Lampe Uns Gstebuch Ihr Spezialittenverwhnt
974 Willkommen im Hotel Alte Post in Hotel
Webauftritt des Hotel Alte Post...
altepost-krems.at Hotel Alte Post Krems Restaurant Empfehlung Galerie Anfahrt Speisekarte Obere Wachau Weinherbsturlaub Bienvenue
975 imagetransferat Reichhold
christian reichhold moderator regisseur galerist autor galerie mango tango...
imagetransfer.at Reichhold Christian Galerist Regisseur Mango Galerie Moderator Gallery Tango Seitenblicke Imagetransferat Atelier Art Artshop Tv
976 Einfach
thestyle4you.at Einfach Gepflegte Second Hochzeitskleider Galerie Geld Teile Hand Cf Kleiderschrank Menge Markenmode Dann Jedentag Selection
977 Walters Burgrestaurant Burgrestaurant Obervoitsberg Burgrestaurant
walters-burgrestaurant.at Burgrestaurant Presse Restaurant Weinkarte Galerie Walters Obervoitsberg Speisekarte Voitsberg Restaurantfhrerakellergewlbe Burgtavernevom Angebot Feiern
978 dobnerdesign | Thomas Dobner _p
thomasdobner.at _p Thomas Juwelier Dobner Galerie Projekts Schullin Hypo Ziel Bescheid Wundervolle Weise Kahr Nr Cartier
979 Green Apple 1030 Wien Apple
Green Apple ist ein asiatisches Restaurant in 1030 Wien mit Lieferservice. Einfach online Essen bestellen und vomZustellservice Green...
greenapple-asia.at Apple Green Wien Greenapple Lieferservice Speisen Asiatisches Restaurant Lokal Essen Galerie Asiarestaurant Asiaatwwwmjamat
980 infinuvo QQ 3 infinuvo Qq
Infinuvo CleanMate QQ 2 Ihr erster effizienter und kompakter Saugroboter ein automatischer und intelligenter Staubsauger...
infinuvo.at Qq Infinuvo Cleanmate Automatischer Smarthome Faq Galerie Saugroboter Bestellen Evetras Wwwinfinuvo Rwe Staubsauger Request Passwort Vergessen
981 Honigland Honigland
hesch.at Honigland Galerie Auszeichnungen Shop Rudi Bienenzucht Silvia Aufbautagen Bitteweyer Imkerei Heschwillkommen  
982 Band
thedreamcatchers.at Band Downloads Dream Galerie Profil Presseinformation Catchersacoustic Catchers Cajon Myspace Geige Finden Klaviergitarre
983 Woche des Waldes Woche
waldwoche.at Woche Waldes Programm Galerie Presse Organisationen Rolle Erholungsraum Waldfest Bedeutung Waldtrinkwasser Alpenraum Wirtschafts
984 Theatergruppe Augustin Augustin
theater-augustin.at Augustin Herzogenburg Theatergruppe Galerie Produktionen Cooney Lügen Kirchenplatz Nordtor Zugangtheatersaal Beginn Gasse Stift
985 Cafe TIFF café Tiff
tiff.at Tiff Events Galerie Cafe Uns Office@tiffat Kein Mittagsmenü Andorf Stellentiffachtung Café Brunch
986 ÜBER UNS Galerie
hellmondbuehne.at Galerie Uns Gästebuch Server Quotprogrammquot Port Apache Anfahrt Geschichte Archiv Aktuell Beitrag Fotospermanently The
987 Irudiaat Blog
irudia.at Blog Galerie Uns Irudiaat Login Apache Schnappschuß Suban Partner Server Georgbesuchen Kranewitter Christian
988 ivents kulturagentur Villacher
ivents.at Villacher Aufsteirern Agentur Kunden Kulturagentur Tracht Kirtag Volxmusik Iventkalender Ivents Pracht Galerie Beim Hof Y
989 Willkommen auf der Startseite Galerie
Malerei Andrea Fuchsberger...
andreafuchsberger.at Galerie Events Vergangene Mal Gestaltherapie Malerei Ausstellungen Nach_ Unendlichen Reserved Fuchsberger Malen Dorothea Kunstwerk Y
990 Willkommen bei Panorama Telfs Topfield
Besuchen Sie Telfs und Umgebung als virtueller Tourist...
virtualtourist.at Topfield Telfs Panorama Virtueller Tourist Galerie Mode Httpwwwapplecomquicktimegallerycubicvr Coltd Mail Deutschsprachige English Hilfe
991 Azteca Trading e U Azteca
azteca.at Azteca Trading Veranstaltungen Kulinarik Tequila Espanol Deutsch Gästebuch Galerie Eventos Bearbeiten Eu Uns Wer Mexico
992 home | wwwtauernechoat | drei musikalisch |
tauernecho.at | Discografie Band Galerie Gästebuch Anfrage Downloads Brüder Drei Gesnbr Home Fax Venedigersiedlung Krahbichler Y
993 STEIERMÄRKISCHER KUNSTVEREIN WERKBUND Werkbund
werkbund.at Werkbund Steiermärkischer Kunstverein Galerie Mitglieder Vorstand Graz Email Telefonstmkkunstverein@utanetatheinrichstraße
994 GtVSJagdgasseat Gtvsjagdgasseat
jagdgasse.at Gtvsjagdgasseat Aktuell Fotos Gstebuch Ganztagsvolksschule Jagdgasse Galerie Angebote Tragen Empfohlene Team Klassenkurzinformation Sportfest
995 Startseite Tischlerei Wagner Wagner
Tischlerei Wagner Ihr Spezialist für Wohnträume...
tischlerei-wagner.at Wagner Tischlerei Spezialist Angebot Galerie Wohnträume Ihr Anfahrt Unser Logout Ehrung Rottenegg Jimdouns
996 baskets basketsat Spielplan
baskets.at Spielplan Eisenstein Archiv Server Sponsoren Teams Port Neuigkeiten Anmeldeformular Textil News Galerie Downloadopensslemod_hcgi
997 HOME Spirit
western-spirit.at Spirit Band Songs Westensundinterpreten Fotos Fotogalerie Veranstaltungen Interesse Gren Zeltfesten Club Galerie Gospelsongs
998 Tischlerei Wieland Herzlich Willkommen Wieland
Startseite Willkommen in der Tischlerei Wieland Ihr Spezialist für Altbausanierung Kastenfenster amp Individuellen...
tischlerei-wieland.at Wieland Tischlerei Kastenfenster Produkt Galerie Individuellen Altbausanierung Neuer Spezialist Ruhekissen Markt Willkommen * Ihrfachbetrieb
999 Battalion666 Battalion
battalion666.at Battalion Bilder Mhein Sports Ausarbeitung Betreten Airsoftteams Einstellungeninternetauftritt Erwerb Galerie Link Waffen Erklrung
1000 Basecaps Bedruckte oder bestickte Gtgt
basecaps.at Gtgt Anfrage Galerie Caps Kandinsky + Classic Schliessen Werbeartikel Leer Gt Beanies Bestickte Anfragenkorb Bucket
1001 Home Oben
gerd-koch.at Oben Springen Seitenende Katalog Galerie Navigation English Firma Inhalt Deutsch Italiano Spracheinstellungen Sprachauswahl *z
1002 barockhengsteat Startseite Pferdeausbildung
barockhengste.at Pferdeausbildung Tide Aize Galerie Deckhengste Verkaufspferde Beritt News Pre Sandramich Deckhengst Gekörter Plasser
1003 Volksschule Jagerberg Home Klasse
Volksschule Jagerberg...
vsjagerberg.at Klasse Jagerberg Volksschule Fotos Archiv Aktuell Galerie Team Druckversion Zwillkommen   Uns Wichtig Login
1004 Ambulatorium Helia Helia
Ambulatorium Helia Website...
helia.at Helia Behandlungsarten Galerie Therapie Ambulatorium Uns Uhr Bugajer Wien Gleitman Empfangszimmer Hava Eva Mitarbeiterinnen Heilgymnastik Richard Usa
1005 Weinbau Familie Gorth Weinbau
weinbau-gorth.at Weinbau Gorth Familie Heurigen Galerie Jahrgangsweine Termin Strict Info Besucher Unskuraufenthalt Fam Website Gorthnavigation
1006 Weinbau Schweighofer Schweighofer
weinbau-schweighofer.at Schweighofer Zistersdorf Betriebfamilie Weine Alte Galerie Buschenschank Marktstrae Weinbau Buschenschankterminflasche Pasteur Kontakt Johann
1007 Home Barbara Steinwandtner Galerie
Barbara Steinwandtner Design in Edelholz und Malerei...
barbara-steinwandtner.at Galerie Malerei Steinwandtner Holz Objekte Edelholz Barbara Design Holzbilder Impressionen Ausstellungen Galerien Michacryl
1008 HUTkultur Maria Wolschart Galerie
hutkultur.at Galerie Verein Programm Mitglieder Archiv Hutkultur Maria Wolschart Faiasalamanda Szabolcs Beginnnagy Stimmung Volles
1009 Der Gourmet Partyservice des Liezenerhofs Liezen
Der Gourmet Partyservice des Liezenerhofs. Gerd Riedel ist Ihr Ansprechpartner für Catering Dienste jeglicher Art Ob Hochzeiten Geburtstage...
gourmet-partyservice.at Liezen Partyservice Catering Gourmet Liezenerhof Unser Liezenerhofs Essen Ob Jede Gerd Galerie Art Geburtstage Zettler
1010 Donabaum Donabaum
weingaertnerei.at Donabaum Weine Galerie Wachau Heuriger Anfahrt Lebensfreude_ _ Heurigentermine Willkommenwinzer Bedeutet Berufunglinksberuf
1011 Weinbauverein Brunn Familie Niegl Familie
weingut-niegl.at Familie Webshop Niegl Brunnatport Pfeaschawein Geschichte Galerie Wein Weinwanderweg Apache Kartendarstellung Fenness Brunn
1012 Weinhof Prettner Buschenschank
Weine Buschenschank Glanz Steiermark...
weinhofprettner.at Buschenschank Produkte Prettner Weinhof Ferienhaus Familie Veranstaltungen Brennerei Glanz Weine Galerie Weinstrasse Steiermarkwein
1013 Hotel Alexado Hotel
alexado.at Hotel Alexado Galerie Preisebuchung Zimmer Beautyfarm Tv Zimmerservice Lan Zimmerausstattung Kost Suite Satelliten Delux Tirol
1014 Home Praxis
Praxis für Hundephysiotherapie und Rehabilitation für Hunde in Innsbruck...
vitality4dogs.at Praxis Innsbruck Hundephysiotherapie Leistungen Vierbeiner Workshops Anfahrt Therapieablauf Unterwassertherapie Tierphysiotherapie Rehabilitation Galerie Kostenerfahrungsberichte
1015 wwwgerhard aignerat Homepage
homepage dokument webpage page web netz...
gerhard-aigner.at Homepage Page Webdesign Dokument Web Netz Webpage Shop Galerie Vitae Biografie Curriculum Freizeit Standort Y
1016 Rabenhof Theater und aus Rabenhof
rabenhof.at Rabenhof Saison Theater Aid Archiv Gemeindebau Shop Abo Kassaöffnungszeiten Galerie Server Agb Wiederaufnahmen Freunde
1017 Babykarten Hochzeitseinladungen Einladungskarten Weihnachtskarten Taufkarten Danksagungskarten |
xlfoto.at | Faqs Mein Meine Kurzanleitung Babykarten Galerie Account Hochzeitseinladungen Hochzeit Einladungskarten Weihnachtskarten Taufkarten Papierauswahl Y
1018 Galerie Krinzinger Chan
galerie-krinzinger.at Chan Galerie Chie Residency Krinzinger Hungaryadi Vasileva Austriawilliam Eisenbergerthean Bernd Mekasi Stela Oppl
1019 Galerie Carinthia
Dr. Irmgard Bohunovsky informiert über die Künstler der Galerie, über die Galerie selbst und über Publikationen. ?-ffnungszeiten und Kontaktinformationen stehen ebenfalls zur Verfügung.
Bohunovsky Carinthia Irmgard Galerie Klagenfurt Web Homepage Ossiach
1020 Galerie Schloss Puchheim
Galerie für zeitgenössische Kunst. In jährlich 5-7 Ausstellungen wird Malerei, Grafik, Skulptur und Fotografie gezeigt. Informationen zur Galerie, Künstler, Ausstellungen und Veranstaltungen.
Peter Wolfgang Galerie Vernissage Einführende Worte Eröffnung Schloss
1021 Galerie Hubert Winter
Stellt die von der Galerie vertretene Künstler vor und berichtet über Ausstellungen.
Art Kunst Michael Galerie Galeriehubertwinter Internationale Birgit Konzeptuelle
1022 Galerie Lehner
Vorstellung der Galerie anhand von etwa 120 Bildern und dazugehörigen Texten.
Ausstellung Galerie Lehner Linz Nächste Wien Ausstellungen Hans
1023 Galerie Bar am Klopeiner See
Die Galerie Bar ist der Treffpunkt für junge Leute am Klopeinersee. Umfassende Bildergalerie, Veranstaltungen.
Galeriebarat Goclick Here Z
1024 Galerie Pehböck
Information über die ausgestellten Künstler, die Kunstwerke und die Galerie.
Galerie Pehböck Pehbck Kunst@pehboeckat Aktuell Naarn Künstler Erwin
1025 Mobile Galerie, Angelika Gall
Stellt das Konzept der Mobilen Galerie vor und bietet zeitgenössische Bilder und Skulpturen.
Kunst Bilder Fuchs Glasobjekte Zeitgenössische Galerie Skulpturen Abstimmung
1026 Mobile Galerie, Angelika Gall
Stellt das Konzept der Mobilen Galerie vor und bietet zeitgenössische Bilder und Skulpturen.
Kunst Bilder Skulpturen Galerie Fuchs Zeitgenössische Glasobjekte Art
1027 Galerie im Taxispalais
Nichtkommerzieller, öffentlicher Ausstellungsort für internationale zeitgenössische Kunst. Bietet Informationen zu Programm, Leseraum und Publikationen sowie eine Kustvermittlung und Fotos der Galerie.
Galerie Taxispalais Tirol Landes Navigation Kunst Art Programm
1028 Galerie im Taxispalais
Nichtkommerzieller, öffentlicher Ausstellungsort für internationale zeitgenössische Kunst. Bietet Informationen zu Programm, Leseraum und Publikationen sowie eine Kustvermittlung und Fotos der Galerie.
Galerie Taxispalais Tirol Landes Kunst Programm Art Navigation
1029 Galerie Ernst Hilger Wien
Bietet neben allgemeinen Informationen auch eine Künstlerdatenbank und eine virtuelle Galerie.
Hilger Galerie Modern Ausstellungen Fairsbrotkunsthalle Partner Ernst Künstlercontemporary
1030 Galerie Ernst Hilger Wien
Bietet neben allgemeinen Informationen auch eine Künstlerdatenbank und eine virtuelle Galerie.
Hilger Galerie Ausstellungen Dorotheergassefairs Editionen Künstler Contemporary Modern
1031 Galerie Brunnhofer und Siebdruck Brunnhofer Ges.m.b.H
Gibt einen Überblick über das Angebot im Sieb- und Digitaldruck mit Produktbeispielen und informiert über Künstler und Veranstaltungen in der Galerie.
Indra Galerie Bilder Rainbowgrey Ausstellung Brunnhofer English Indrablackbirds
1032 Galerie Tulbingerkogel
Galerie im Wienerwald.
Peter Hans Josef Karl Franz Ernst Kurt Walter
1033 Aura-Kachelöfen
Information über den Hersteller von Kachelöfen. Photo-Galerie, Skizzen-Galerie und Produktinformation.
1034 Galerie Judith Walker
Der Webauftritt informiert über die Galerie und ihre Ausstellungen im Schloss Ebenau in Weizelsdorf, erzählt aber auch die Geschichte des Schlosses und der Hollenburg. Ausserdem werden Anfahrtshilfen, Künstlerporträts und Kontaktinformationen angeboten.
Rosental Ebenau Ausstellungen Galerie Austria Walker Schloss Verständnis
1035 Werner Berg Galerie
Die Galerie bietet einen Rundgang durch die Ausstellungen, die Biografie des Künstlers, einen Shop für Billets und Karten sowie Informationen über ?-ffnungszeiten und Kontaktmöglichkeiten.
Rights Multi Teamall Passwort Panel Control Reserved Mscp
1036 Werner Berg Galerie
Die Galerie bietet einen Rundgang durch die Ausstellungen, die Biografie des Künstlers, einen Shop für Billets und Karten sowie Informationen über ?-ffnungszeiten und Kontaktmöglichkeiten.
Reserved Multi Teamall Rights Mscp Panel Anmeldung Server
1037 Galerie Pimmingstorfer
Zeitgenössische Kunst in der Galerie Pimmingstorfer in Peuerbach.
Z Y
1038 Galerie Pendel
Das "Pendel" ist eine Galerie, in der ein breites Spektrum an bildnerischen Ausdrucksformen Raum findet. Neben Malerei, Bildhauerei, Medienkunst und Fotografie gibt es einen eigenen Schwerpunkt für Design, Mode und Architektur.
Domain Kulturpendelat Informationen Parking Kulturpendel Programm Beacons Inhaber
1039 Atelier Raab
Das Atelier beherbergt neben einer kleinen Galerie auch eine Malschule. Kunst zeigen, schaffen und weitergeben macht dieses Haus zu einem kreativen Ort. Informiert über die Galerie und die Malschule.
Raab Atelier Galerie Schloss Mail Heidrun Seit Office@gwzat
1040 Werner Berg Galerie
Die Galerie bietet einen Rundgang durch die Ausstellungen und die Biografie von Werner Berg.
Passwort Teamall Multi Rights Reserved Mscp Panel Anmeldung
1041 Werner Berg Galerie
Die Galerie bietet einen Rundgang durch die Ausstellungen und die Biografie von Werner Berg.
Server Anmeldung Mscp Control Panel Teamall Reserved Multi
1042 Galerie Holzer, Jugendstil und Art Deco
Jugendstil, Art Deco, Art Nouveau, Wiens grösste Jugendstil Galerie auf 1000+?-?
Deco Jugendstil Lampen Wien Art Möbel Mbel Uhren
1043 Sportunion Grieskirchen
Teams, Galerie, Gästebuch.
Grieskirchenschloesserlauf Fg Faustball Leichtathletik Laufen Volleyball Sportunion Badmintonturnen
1044 Doerr
Galerie Dörr, Glas Dörr in Marbach an der Donau
Glaserei Glas Dörr Duschkabinen Küchenrückwände Stiegengeländer Galerie Wintergärten
1045 tex art
Agentur und Galerie für Textile Kunst in Salzburg.
Kunst Bau Textile Textilobjekte Ausdrucksstarke Sichtschutz Schalldämmung Faqs
1046 tex art
Agentur und Galerie für Textile Kunst in Salzburg.
Kunst Bau Textile Ausdrucksstarke Textilobjekte Sichtschutz Licht Farbleitsysteme
1047 Fiestamen
Zur Person, Tagebuch, Galerie, Forum und Gästebuch.
1048 SV Pregarten Tennis
Clubleben, Erfolge, Portrait, Sponsoren, Galerie.
Pregarten Herren Tabelle Sv Hofstadler Alles Klasse Martin
1049 Atomic Cafe
?-ffnungszeiten, Gastro-Philosophie und Photo-Galerie.
Jahre Atomic Bielbienne Biel Cafeacute Biennez Ans
1050 Sport- und Kulturverein FC Donald
Informiert über aktuelle Aktivitäten, mit Galerie.
Archiv Rennlauf Hauptmenü Frisbee Schi Gespannfahren Wandern Donald
1051 Galerie Erbler
Kunstdrucke, Originalradierungen, Grafikeditionen. [A-9562 Himmelberg]
Radierwerkstatt Werbegrafik Editionen Erbler Kupferdruck Galerie Graphik Bilder
1052 SV Gutenberg
Informiert über Chronik, Vorstand und Teams, mit Galerie und Gästebuch.
Gutenberg Events Sv gutenberg Mannschaften Vorstand Verein Bildergalerie Sportverein
1053 Seeappartement Erlberg
Informationen zu den Appartements, Preise, Anreise und Foto Galerie
Unbenanntes Dokumenty
1054 Aramis Quero vom Steinacherhof
Vorstellung des Zuchtrüden mit Galerie, Erfolge und Ahnen.
Konnten Versuchen Kontaktieren Website Seiten Austria Upcat Adresse
1055 Galerie Wuensch, Kunsthandel
Präsentation kubanischer Kunst in Linz, Austria
Art Kunst Wünsch Winfried Cuban Wwwartmarketat Contemporary Kubanische
1056 Ortag-Glanzer, Walpurga
Homepage der österreichischen Malerin mit Biografie und Galerie.
Glanzer_willkommen Walpurga Ortagy
1057 Ulfs Galerie
Bilder der Malerin Hadwig Schubert und des Malers Wolfgang Böhm.
1058 Andys Ein-Mann-Band
Informationssite mit Bilder- und Adio-Galerie und Kontaktadressen.
Band Wojik Andys Gegenwart Sacralmusik Gesang Andreas Sakralmusik
1059 Atelier photo
Presentation des services et galerie dimages. Lausanne, Vaud.
Photo Photos Suisse De Lausanne Photographe Book Studio
1060 Hauptschule Haselstauden
Aktuelles, Lehrer, Schüler, Galerie, Integration, Bücherei.
Japan [] Kat Vorarlberger Netzwerke Titel Schulen Support
1061 Stangl-Kurmulis, Konstanze
Eine Galerie ihrer Bilder und ein Gästebuch.
Bilder Kunstart Stangl Kurmulis Constanze Kunst Kreativitätz
1062 Take Five music
Coverband aus dem Südburgenland bringt Selbstvorstellung, Musikseite, Galerie, Gästebuch und Downloads.
Band Takewwwtakemusicat Takemusic Gruppe Auftritt österreich | Burgenland
1063 Grenzland Oldtimerclub
Neuigkeiten, Vorstellung des Clubs, Termine, Literatur und eine Galerie.
Neuigkeiten Weblinks Gästebuch News Galerie Joomla Poker Oldtimerclub
1064 SV Deutschfeistritz
Vorgestellt werden die Kampf- und Jugendmannschaften, der Vorstand und die Spielergebnisse. Mit Galerie und Archiv.
Permanently The Apache Port Serverz
1065 Galerie Ariadne
JüngereKünstlerinnen und Künstler, vor allem in den Bereichen Malerei und Zeichnung.
Versuchen Spteren Befindet Under Aufbaubitte Constructionplease Wwwariadneatdiese Noch
1066 Rosman, Johan
Galerie zur künstlerischen Entwicklung des Fotografen und Einblicke in seine Studien.
Rosman Johan Fotografie Internet Targets Managedby Meidlingtarget Anfanghosted
1067 Galerie vor Ort
Ausstellungen, Lesungen, Performances, junge zeitgenössische Kunst, Malerei
Galerie Ort Menüz
1068 Galerie Ariadne
JüngereKünstlerinnen und Künstler, vor allem in den Bereichen Malerei und Zeichnung.
Z Currently Aufbaubitte Europe Spteren Zeitpunkt Befindet Constructionplease
1069 Absurd-Das Cafe
Beheimatet auch ein Tatoo-Studio. Bar und Küche, Kalender, Forum, Galerie.
Just Segeln Sailing Skipper Absurd Team Forum Kornaten
1070 Puppenmuseum Villach
Museum der zeitgenössischen Puppenkunst mit angeschlossener Galerie für Künstlerpuppen und Teddybären.
Puppenkunst Künstlerbären Villach Puppenmuseumkünstlerpuppen Seiten Teddybären Z
1071 Ortag, Andreas
Homepage des österreichischen Malers und Grafikers. Biografie, Tagebuch, Galerie, Pinhole.
Ausstellung Raabs Startmenue Horn Raum Ortag Andreas Augenblicke
1072 Atelier Ultramarin
Anbieter für Dekorations- und Illusionsmalerei, Oberflächen- und Fassadengestaltung mit Galerie zu besichtigen.
Atelier Ultramarin Theatermalerei Wandmalerei Raumgestaltung Illusionsmalerei Techniken Stukkaturen
1073 Baxrainer, Wolfgang
Zeigt eine Galerie seiner Werke und informiert über Kurse und Aquarelltage.
Baxis Serviceseite Unterseite Wwwaquarellkurseat Wwwbaxrainerat Error Z
1074 Torjin Taro
Fansite mit Geschichten, Forum, Zitaten, Abenteuern, Gruppenbeschreibungen, Galerie und Charakteren.
Torjin Taro Geschichten Galerie Schwarze Auge Tretet Boronanger
1075 Puppenmuseum, Villach
Museum der zeitgenössischen Puppenkunst mit angeschlossener Galerie für Künstlerpuppen und Teddybären.
Puppenkunst Künstlerbären Seitenteddybärenpuppenmuseum Künstlerpuppen Villach
1076 Puppenmuseum Villach
Museum der zeitgenössischen Puppenkunst mit angeschlossener Galerie für Künstlerpuppen und Teddybären.
Puppenkunst Künstlerbären Puppenmuseumkünstlerpuppenvillach Teddybären Seiten
1077 Tirolkunst
Plattform für Tiroler Künstler und Galerie für Bilder jeder Art. Mit Terminkalender, Newsletter und Kontaktformular.
Galerie Künstler Kunst Tirol Internet Bildhauer Grafiker Art
1078 Alpencamping Nauders
Beschreibung des Platzes mit Preisen und einer kleinen Galerie auch von der Umgebung.
Alpencamping Nauders Camperzelt Mangalify Sonne Urlaub Caravan Seinen
1079 Miatapower
Tipps und Tricks werden zusammengefasst sowie Fotos in einer Galerie gezeigt.
1080 Alpencamping Nauders
Beschreibung des Platzes mit Preisen und einer kleinen Galerie auch von der Umgebung.
Nauders Alpencamping Camperreschenpass Camping Platz Jedem Zelt Caravan
1081 Knill, Christine
Abstrakte Acrylbilder der Malerin aus Hörbranz bei Bregenz am Bodensee. Mit Galerie und Vita.
Internet Tv Handy Alt+ Handys Abfragen Zusatzpakete Produktberater
1082 Alpencamping Nauders
Beschreibung des Platzes mit Preisen und einer kleinen Galerie auch von der Umgebung.
Nauders Alpencamping Jedemseinen Wohnwagen Zelt Camper Camping Mangalify
1083 Harringer, Rudolf
Virtuelle Galerie des Künstlers mit zahlreichen Kategorien wie Fantastic, Spaceart und Abstrakt.
Galerie Kunst Spaceart Natur Abstrakt Tiere Bestellung Mensch
1084 Puppenmuseum, Villach
Museum der zeitgenössischen Puppenkunst mit angeschlossener Galerie für Künstlerpuppen und Teddybären.
Puppenkunst Künstlerbären Künstlerpuppen Villachpuppenmuseumseiten Teddybären
1085 Volksschule
Eine Galerie mit Schülerarbeiten, ein Terminkalender und Infos für Eltern sind abrufbar.
Homepage Adnet Vsbrowserihrem
1086 Textilwerkstatt Ulrike Unterlass
Vorstellung des Sortiments an Filzviechern und -hüten. Mit Filzkunst-Galerie. [A-5541 Altenmarkt]
Ulrike Textilwerkstatt Unterlass Pongau Altenmarkt Marktplatz Spielzeug Unterlaß
1087 Innsbruck, Galerie im Taxispalais
Nichtkommerzieller öffentlicher Ausstellungsort für internationale zeitgenössische Kunst.
Galerie Taxispalais Tirol Landes Art Navigation Kunst Programm
1088 Alpencamping Nauders
Beschreibung des Platzes mit Preisen und einer kleinen Galerie auch von der Umgebung.
Alpencamping Nauders Urlaubcamper Platz Tirol Reschenpass Wohnwagen Mangalify
1089 Innsbruck, Galerie im Taxispalais
Nichtkommerzieller öffentlicher Ausstellungsort für internationale zeitgenössische Kunst.
Galerie Taxispalais Tirol Landes Programm Navigation Kunst Art
1090 Franks
American Bar, Restaurant und Musiklokal. Events, Galerie, Dinner, Drinks, Bar, Philosophie, Kontakt.
Z Y
1091 Hauptschule Frastanz
Schulhomepage mit Schulprofil, Terminen, Klassen, Aktuellem, einer Galerie und einem Gästebuch.
Fotoalbum Wienwoche Sportwoche Teil Klassen Nawi Klasse Sporttag
1092 Zaphyr
Informationen über die angewandte Technik, den Weg zum eigenen Abdruck und Bilder von fertigen Arbeiten in einer Galerie.
Document Untitledy
1093 UTC Leogang
Es werden Informationen über die Ranglisten, Club-Meisterschaften, sowie eine Foto-Galerie gezeigt.
Z Y
1094 Kunst Raum Goethestrasse
Die Galerie informiert über aktuelle Verkaufsausstellungen und ein Archiv mit Ausschnitten früherer Ausstellungen.
Kunstraum Andraschek Goethestrasse Projekt Foto Xtd Then Iris
1095 1.FC Christkindl
Der Fussballverein informiert über den Verein, die Spieler, errungene Erfolge und zeigt Bilder in einer Galerie.
1096 Galerie Chobot
Arbeiten auf Papier und Skulpturen, Betreuung von Nachlässen, z.b. Karl Anton Fleck
Galerie Karl Alfred Chobot Galerien Gironcoli Manfred Knstler
1097 Fischerbräu
Gasthofbrauerei mit einem schattigen Kastaniengarten in Wien. Restaurant, Musikveranstaltungen und eine Panorama-Galerie.
Hopft Fischerbräu Herzy
1098 Kern, Rupert
Online-Galerie des Malers mit Ausstellung der Arbeiten aus den letzten Jahren und Hinweise auf Veranstaltungen.
Galerie Rupert Acryl Atelier Kern Aquarell Holzbilder Holzbild
1099 Fischerbräu
Gasthofbrauerei mit einem schattigen Kastaniengarten in Wien. Restaurant, Musikveranstaltungen und eine Panorama-Galerie.
Herz Fischerbräu Hopfty
1100 Hotel Marmotta
Lage, Anfrage, Preis, Essen, Galerie, Kontakt und Informationen über das Haus und die Betreiber.
Hotel Gargellen Skischule Beschneiung Video Skigebiet Pension Familienmitglieder
1101 Volksschule Gutenberg an der Raabenklamm
Die Schule stellt sich vor. Kinder, Lehrer, Termine, Kindertexte und eine Galerie.
Gutenberg Volksschule Vs Kindertexte Bilder Projekte Raabklamm Hotpotatoes
1102 Stars nStripes
Hits der 60er und 70er Jahre bis zu aktuellen Titeln. Repertoireliste, Galerie, Terminplan und Veranstalterinfos.
Künstler Musik Band Festplanung Hochzeit Veranstaltung Fest Showacts
1103 Schlechte Zeiten
Ironische Site über "die schlechteste Serie der Welt" mit Foto-"Galerie des Leidens", Enzyklopädie, Archiv.
1104 Galerie bei der Albertina
?-sterreichische Kunst des 20. Jahrhunderts mit Exponaten des Jugendstils, der Wiener Werkstätte und der österreichischen klassischen Moderne.
Albertina Galeriey
1105 Keramikum
Die Galerie für Keramik, Malerei, Grafik und Kunstgegenstände präsentiert einige Werke und stellt die beteiligten Künstler vor.
Malerei Kunstkiste Grafik Keramik Gugl Kunstschaffende Künstler Design
1106 Galerie Fotozeile
Präsentation der Fotografien der Studenten aus den Kursen der Fotoschule Wien als Abschlussausstellung. Bilder zu unterschiedlichen Themen.
Fotoschule Fotogalerie Fotozeile Fotokurs Fotokurse Wien Galerie Fotografie
1107 Murauer Jugend Portal
Präsentation des Fotoprojekts für Jugendliche aus Murau. Mit Archiv, Galerie, Forum, Gästebuch und Chat.
Heimat Mei Leitung Browser Fallsz Httpwwwschlosslindatmei Link
1108 Galerie Baumgartner
Veranstalter von Ausstellungen und Kunst-Genuss-Ausflügen. Details und aktuelle Künstler. [A-5020 Salzburg]
Baumgartner Temporis Ars Galeriez
1109 Poszvek, Angelika
Informationen über die Wiener Posaunistin. Lebenslauf, Studium, Bands, Termine und eine Galerie mit Bildern.
1110 Poszvek, Angelika
Informationen über die Wiener Posaunistin. Lebenslauf, Studium, Bands, Termine und eine Galerie mit Bildern.
1111 Poster-Galerie Innsbruck
Rahmen sowie Auswahl von über 1000 gerahmten Bildern. Produktüberblick und Kontaktinformationen.
Z Y
1112 Poszvek, Angelika
Informationen über die Wiener Posaunistin. Lebenslauf, Studium, Bands, Termine und eine Galerie mit Bildern.
1113 Poszvek, Angelika
Informationen über die Wiener Posaunistin. Lebenslauf, Studium, Bands, Termine und eine Galerie mit Bildern.
1114 Museum moderner Kunst - Stiftung Ludwig Wien
Allgemeine Informationen, aktuelle Ausstellungen, virtuelle Galerie.
Stil Wille Kunst [lesen] Moderne Klee Picasso Beuys
1115 Galerie Ernst Hilger
Gezeigt wird ein Programm von Klassischer Moderne bis zur zeitgenössischen internationalen und österreichischen Kunst.
Hilger Galerie Ernst Ausstellungen Fairseditionen News Brotkunsthalle Partner
1116 Galerie Klingberg Salzburg
Präsentiert zeitgenössische Malerei in Ausstellungen und Vernissagen der Salzburger Künstlerin Ines Höllwarth.
Domain Galerie Parking Domains Klingbergat Website Programm Klingberg
1117 TC-Altenberg
Es werden die Mannschaften der Meisterschaftsbetrieb sowie Sponsoren präsentiert. Zudem gibt es eine Foto-Galerie von Festen.
1118 Audi4ever
Bietet eine grosse Galerie, Neuigkeiten rund um Audi, einen Downloadbereich sowie ein Forum zum Erfahrungsaustausch.
Audi Michl Hölli Videos Update Fotos Presse Stammtisch
1119 Ariadne
Galerie für junge österreichische und internationale Malerei und Fotografie in Wien. Stellt Bilder und Künstler mit Lebensläufen vor.
Z Under Host Versuchen Spteren Zeitpunkt Einmalthis Currently
1120 Art Design & Creation
Galerie für Airbrush- und Acrylbilder, Photos, 3D-Art, Gedichte, Links. Stellt den Künstler vor und bietet eine Bildergalerie.
Ms Sklerose Storys Multiple Gedichte Dahlke Rüdiger Meditation
1121 Kulturtreff Altes Kino
Informiert über das aktuelle Programm, bietet ein Archiv und eine Übersicht der aktuellen Ausstellungen in der Galerie.
Browseraltes Stflorian Kulturtreff Technologien Leider Daher Kino Homepage
1122 Creativstudio
Erstellt Hochzeitsfilme für den schönsten Tag im Leben. Informiert über das Team und zeigt eine Galerie erstellter Arbeiten.
Spots Tv Hochzeitsvideos Musikvideoskonzert Google Bogataj File Download
1123 Ariadne
Galerie für junge österreichische und internationale Malerei und Fotografie in Wien. Stellt Bilder und Künstler mit Lebensläufen vor.
Z Constructionplease Host Zeitpunkt Befindet Currently Spteren Wwwariadneatdiese
1124 Galerie Ernst Hilger
Gezeigt wird ein Programm von Klassischer Moderne bis zur zeitgenössischen internationalen und österreichischen Kunst.
Hilger Galerie Brotkunsthallepartner Contemporary Fairs Wien Dorotheergasse Ernst
1125 Sky Surf
Homepage mit einer grossen Galerie zum Thema Fallschirmspringen, weiterhin gibt es noch Sektionen für Fallschirmspringer und Tandempassagiere.
Found Hereserverport Click Found The Proceed Apache
1126 VW-Heaven.at
News, Infos, Galerie, Tuning, Forum, Vorstellungen, Studien und anderes rund um Volkswagen, Audi und Seat.
Z Y
1127 Hotel Berger
Geschichte, Galerie, Ausstattung, Zimmerpreise, Verpflegung, Freizeitmöglichkeiten, Anreise und Online-Anfragemöglichkeit.
Z Y
1128 10er Haus
Galerie in Gmunden. Informiert über die ?-ffnungszeiten und die ausgestellten Gemälde, Skulpturen, Keramiken, Glaskunst, Schmuck, Kerzen und Künstlerbedarf.
Dokument Unbenanntesy
1129 Galerie Johannes Faber
Includes exhibition schedules, photographs from current exhibitions, and contact information. Located in Vienna, Austria.
Faber Galerie Johannes Fotogalerie Wien Exhibitions Gallery Vienna
1130 Drobil, Andreas
Zeigt eine Galerie seiner Werke, erläutert deren Bedeutung und bietet Möglichkeit zur Preisanfrage.
Error Information Services Setup Common Microsoft Custom Administrative
1131 Galerie Fotohof
Art photography in Salzburg, Austria. Information about exhibitions past and present, a photo library and an Austrian Photographers Directory.
Togu Mail Passwort Adresse Fitness Gesundheit Obermaier Mein
1132 Holzbau 1
Zusammenschluss von Holzbauunternehmen im Hausbau in Oberösterreich. Informiert über die Mitglieder und zeigt eine Galerie ersteller Holzhäuser.
Holzbau Erfahren… Holzbauat Betriebe Bildergalerie Dämmung Partnerfirmen Mitglieder
1133 Weingut Melcher Schloss Gamlitz
Vorstellung des Schlosses mit dem Museum Steirische Weinkultur, der hauseigenen Buschenschänke mit Galerie und dem Übernachtungsangebot. Fotos und ein Veranstaltungskalender.
Schloss Gamlitz Feiern Melcher … Hochzeitsfeiern Tagungen Hotel
1134 Galerie 1990
Sowohl junge als auch arrivierte Künstler, vier bis sechs Ausstellungen pro Jahr, mit den aktuellen Terminen. [A-7000 Eisenstadt]
Domain Information Upcz
1135 Fliesenjoe Niederbrucker Josef
Der Fliesenleger aus Mondsee beschreibt die Leistungen in Bad, Küche, Terrasse, Böden, Stein und zeigt in einer Galerie durchgeführte Arbeiten.
Fliesen Niederbrucker Bad Qualität Böden Bäder Spezialist Stiegen
1136 Holzimpuls Kitzmüller
Versteht sich als Problemlöser in Sachen Innenraumgestaltung. Berichtet über das Unternehmen und zeigt eine Galerie mit erstellten Werken.
Holz Georg Impuls Kitzmüller Begleitung Tischler Holzimpuls Druckversion
1137 Kunsthandel Elisabeth Michitsch
Die Galerie ist spezialisiert auf Jugendstil, Art Deco und österreichische Kunst. Schwerpunkte bilden Glas-, Keramik & Metallarbeiten, Möbel & Malerei
Elisabeth Michitsch Emichitsch@elisabeth Michitschat Webseite Aktuell Kunstmanagementberatung Geplanter
1138 Erste ?-sterreichische Taucherakademie
Die Schule bietet Informationen zu Kursen, Reisen, Kundenservice, Tauchguiding und eine Galerie mit ansprechenden Unterwasseraufnahmen. [A-1150 Wien]
Uns Tüv Tauchertreff Wien Reisen Urlaub Tauchen Deine
1139 Mobile Galerie, Angelika Gall
Lithographien und Radierungen namhafter österreichischer Künstler, Originale in ?-l, Raumgestaltung, hochwertige Rahmen. Vor-Ort-Besuche für individuelle Lösungen.
Kunst Bilder Glasobjekte Galerie Fuchs Skulpturen Zeitgenössische Exquisite
1140 Veith, Martin
Zeichnet Karikaturen und Tier-Portraits nach Fotos. Bilder können in Auftrag gegeben werden. Vita, Galerie und Kontakt.
Karikaturen Geschenk Hochzeit Karikatur Bilder Veith Geburtstag Martin
1141 WLB Wiener Lokalbahnen AG
Personen- und Güterverkehr Wien - Baden ("Badner Bahn"). Geboten werden ein Unternehmensportrait, Tarife, eine Galerie und ein Link zur Fahrplanauskunft.
Bahn Tarif Fahrpläne Badner Wiener Auskunft Shop Rechtliche
1142 WLB Wiener Lokalbahnen AG
Personen- und Güterverkehr Wien - Baden ("Badner Bahn"). Geboten werden ein Unternehmensportrait, Tarife, eine Galerie und ein Link zur Fahrplanauskunft.
Bahn Tarif Fahrpläne Badner Wiener Hinweise Auskunft Wlb
1143 Schachclub Raika Rattenberg
Berichtet über Veranstaltungen und Termine sowie über Ergebnisse von Mannschaftskämpfen. Fotos aus dem Vereinsleben werden in einer Galerie angeboten.
Rattenberg Schlossberg Bester Schachklub Chronik Google Leute Tirol
1144 WLB Wiener Lokalbahnen AG
Personen- und Güterverkehr Wien - Baden ("Badner Bahn"). Geboten werden ein Unternehmensportrait, Tarife, eine Galerie und ein Link zur Fahrplanauskunft.
Bahn Fahrpläne Tarif Badner Wiener Shop News Hinweise
1145 WLB Wiener Lokalbahnen AG
Personen- und Güterverkehr Wien - Baden ("Badner Bahn"). Geboten werden ein Unternehmensportrait, Tarife, eine Galerie und ein Link zur Fahrplanauskunft.
Bahn Tarif Fahrpläne Badner Wiener News Shop Auskunft
1146 Mobile Galerie, Angelika Gall
Lithographien und Radierungen namhafter österreichischer Künstler, Originale in ?-l, Raumgestaltung, hochwertige Rahmen. Vor-Ort-Besuche für individuelle Lösungen.
Kunst Bilder Fuchs Galerie Glasobjekte Skulpturen Zeitgenössische Städtemotive
1147 Artbits - Galerie & Edition
Digital erstellte, bearbeitete und gedruckte Werke aus den Bereichen der Fotografie, des Graphic Designs, der 3D- und Rendering-Art, Computer-Art und digitaler Konzeptkunst.
Galerie Artbits Kunst Art Markus Wien Keramik Gerald
1148 Kids-Web Austria
Veranstaltungstipps, Galerie von Kinderwerken und Link-Listen. Angebot strukturiert nach Altersgruppen: small (6-10), medium (10-14), large (ab 14) und Stadtinformationen für Wien.
Rezepte Kidsweb Natur Basteln Malen Menschen Freizeit Wien
1149 Galerie aRtelier Peter Meier KEG
Präsentiert Arbeiten junger noch weitgehend unbekannter Künstler und eine Auswahl Thangkas (tibetischer Rollbilder).
Galerie Kunst Art Wien Galleries Artelier Künstler Bild
1150 RBT Tuning
Tuning und Carstyling. Neuigkeiten, Produkte, Galerie, Standort. [A-4501 Nehofen/Kr.]
Domain Rbt Parking Domains Tuningat Informationen Thema Umzug
1151 ?-sterreichische Galerie Belvedere
Informiert über die Sammlungen und Veranstaltungen in den Belvedere Schlössern.
Belvedere Haus Ausstellungen Sammlungen Programm Museum öffnungszeiten Schloss
1152 Hepp.art
Bildende Kunst von Elmar Paul Hepp. Mit Online-Galerie.
Internet Tv Handy Handys Alt+ Abfragen Produktberater Zusatzpakete
1153 German Alizee Fanpage
Fanpage mit Wallpaper, Skins, Galerie, Songs, Lyrics und Neuigkeiten.
1154 Kulturverein Multikulti
Multikulturelle Events für multikulturelle Menschen. Mit Veranstaltungshinweisen, Rückblick, Galerie, Anfahrtsbeschreibung und Forum.
Stpaul Multikulti Multikulturelle Wriesnik Kulturverein Kulturstätte Events Sternath
1155 Sternwarte der Benediktiner Kremsmünster
Informationen über die Geschichte der Sternwarte, Publikationen sowie Galerie von Museumsobjekten.
1156 Sternwarte der Benediktiner Kremsmünster
Informationen über die Geschichte der Sternwarte, Publikationen sowie Galerie von Museumsobjekten.
1157 Sternwarte der Benediktiner Kremsmünster
Informationen über die Geschichte der Sternwarte, Publikationen sowie Galerie von Museumsobjekten.
1158 Sternwarte der Benediktiner Kremsmünster
Informationen über die Geschichte der Sternwarte, Publikationen sowie Galerie von Museumsobjekten.
1159 VDSt Graz
Studentische Verbindung mit dem Ziel, die Tradition des Studententums aufrecht zu erhalten. Informiert über Veranstaltungen, Mitglieder und Geschichte und bietet Galerie, Forum und Gästebuch.
Vdst Studenten Leoben Deutscher Graz Wien Straßburgtagung Verein
1160 VDSt Graz
Studentische Verbindung mit dem Ziel, die Tradition des Studententums aufrecht zu erhalten. Informiert über Veranstaltungen, Mitglieder und Geschichte und bietet Galerie, Forum und Gästebuch.
Vdst Studenten Leoben Deutscher Wien Graz Straßburgtagung Verein
1161 Schlossbräu Dornbirn, Brauerei Restaurant Bar
Der wiedereröffnete Braugasthof im Dornbirner Oberdorf wird mit einer Galerie, einem Gästebuch und seinem Shop vorgestellt.
Domain Kaufen Domains Aftermarket Kauf Register Golem Hilfe
1162 Die jungen Orangen
Informationen zum Jugenddepartment mit Vorstellung der Themen und Terminen. Präsentiert das Team und zeigt eine Foto-Galerie zusätzlich einen Newsletter.
1163 Galerie Cult
Präsentation von aktueller internationaler und österreichischer Kunst. Zusätzlich werden Ausstellungsprojekte für andere, teilweise kunstfremde Orte konzipiert und realisiert.
Z Y
1164 Galerie Unart
Präsentation nationaler und internationaler bildender Kunst mit dem Schwerpunkt neue gegenständliche Kunst.
Access Apacheerror Thereis Forbidden Z
1165 Gs Diskus
Private Webseite von Gerd Schönbauer mit Tipps zur Haltung und Zucht plus eigener Diskus-Galerie.
Austria Finden Upcat Erstellen Thema Hilfe Seiten Fehler
1166 Hauptschule Lavamünd
Die Schule mit Informatik- und Musikklassen, stellt sich, die Direktion, das Lehrerteam und die Projekte vor. Angeboten werden eine Galerie, ein Rundgang, Schülerberatung und ein Gästebuch.
Centos Apache System Operating Test Centosproject Enterpriselinuxvendor Contact
1167 Benefit Wirtschaft & Training Gmbh
Spezialisiert auf das Organisieren von Seminaren und Events im In- und Ausland. Galerie der letzten veranstalteten Workshops. Übersicht der Förderungsmöglichkeiten durch den Staat.
Benefit Event Unternehmensberatung Bauwirtschaft Training Seminare Trainer Seminarleitung
1168 Löffler, Dagmar
Die in Wien lebende Malerin präsentiert ihre namenlosen Bilder in einer Galerie und informiert über aktuelle Ausstellungen. Mit Fotoalbum und Links zu Wiener Lokalen.
1169 Guldegg English Setter
Historie der langjährigen Zucht. Portrait der Hunde mit Beschreibung, Bildern, Stammbaum und Prüfungs- und Showresultate. Dazu Galerie der Zuchtrüden in und aus der Zuchtstätte.
English Setter Setters Guldegg Hunde Welpen Breed Qualitt
1170 Japan Bonsai
Das Museum bietet Informationen und Bilder zu den Themen Bonsai, Japanische Gärten, Bonsaizubehör und Bonsaischalen mit Galerie und Online-Shop.
Z Y
1171 Team V-max
Stellt sich und seine Fahrer vor. Dazu gibt es eine Datenbank, Presseberichte, ausstehende Termine, eine Galerie und Neuigkeiten.
Team Max Langstrecken Racing Kartnews Kartteamergebnisse Fotos Erfolgreiches
1172 Gertrauds Seifenseite
Bietet Beschreibung der Inhaltsstoffe von Seifen, Anleitungen zum Herstellen von Seife sowie eine Galerie mit selbst hergestellten Seifen.
Seife Seifen Pflanzliche Weihnachtsbillets Fette Seifenseiten Sheabutter Spezielle
1173 Kunsthaus Rondula
Die Galerie zeigt ihre Ausstellungsstücke, Künstler, Programm und Service. Abgebildete Druckgraphiken können über das Kunsthaus bezogen werden.
Kunsthaus Kunst Rondula Künstler Vorschau Kaffee Ganz Ausstellungsobjekteraumtasse
1174 Der Rabe Softwareentwicklung
Preist Individuallösungen und Projektleitung als Kernkompetenz für die Entwicklung und den Neueinsatz von Software. Ausserdem Angaben zur Tätigkeit als Fotograf nebst einer Galerie mit einigen Arbeitsbeispielen.
Fotoshooting Bodypainting Akt Uv Outdoor Zebra Animation Studios
1175 Freeclimber
Mit vielen Informationen zum Training, aktuellen Tourenberichte und Neuigkeiten sowie Topos vieler Klettergebiete in der Zentralschweiz. Dazu gibt es Tipps für Einsteiger, eine Galerie und Links.
1176 LaFemme, Gina
Die in Wien lebende Künstlerin stellt sich vor und präsentiert ihre Bilder, Portraits und Projekte in einer umfangreichen Galerie. Mit Presseartikeln, eigenen E-Cards und Ausstellungskalender.
1177 Radenthein
Offizielle Homepage der Stadtgemeinde Radenthein mit Informationen über öffentliche Einrichtungen, Bürgerservice und Gemeindedaten. Eine Galerie, ein Stadtplan und ein Veranstaltungskalender werden angeboten.
Radenthein Stadtgemeinde Bürgerservice Nockhalle Gemeinde Anreise Vereine Objektnummern
1178 Kunst- und Kulturverein Gundl Graz
Die Seite über die schwul-lesbische Subkultur in Graz bietet eine Galerie, Termine, Lifestyle und berichtet über den Verein.
Graz Wolfgang Kunst Fotos Besser Coming Fühlt Gruppe
1179 Kunst- und Kulturverein Gundl Graz
Die Seite über die schwul-lesbische Subkultur in Graz bietet eine Galerie, Termine, Lifestyle und berichtet über den Verein.
Graz Wolfgang Kunst Fotos Gruppe Fühlt Coming Besser
1180 Kunst- und Kulturverein Gundl Graz
Die Seite über die schwul-lesbische Subkultur in Graz bietet eine Galerie, Termine, Lifestyle und berichtet über den Verein.
Graz Wolfgang Fotos Kunst Immer Gruppe An“ Coming
1181 Ballooning Vorarlberg - G. Schabus
Informationen zum Ballonfahren in Vorarlberg, zur Ballonwerbung mit Preisen und Foto-Galerie. Die Beschreibung einer Alpenfahrt und Sicherheitshinweise werden angeboten.
Impressum Ballooning Gehen Bestellung + Sicherheit Vorarlberg Ballone
1182 Alex Trading-Cards
Die Seite bietet eine Plattform für an NBA-Cards Interessierte, aufgeteilt in unterschiedliche Rubriken und mit einer Galerie von Scans zu dem Thema.
Found Apache Portz Additionally Errordocument Server Found The
1183 Tourismus in der Dachstein-Tauern-Region
Informationsmagazin für Touristen mit Hinweisen zu Veranstaltungen, Diensten, Gastronomie und Einkaufen. Mit einer reichhaltigen Galerie mit Fotos aus der Region.
1184 Ballooning Vorarlberg - G. Schabus
Informationen zum Ballonfahren in Vorarlberg, zur Ballonwerbung mit Preisen und Foto-Galerie. Die Beschreibung einer Alpenfahrt und Sicherheitshinweise werden angeboten.
Preise Ballonfahrt Faq Anzeigen + Sicherheit Bestellung Wo
1185 Kunst- und Kulturverein Gundl Graz
Die Seite über die schwul-lesbische Subkultur in Graz bietet eine Galerie, Termine, Lifestyle und berichtet über den Verein.
Graz Wolfgang Fotos Kunst Besser Coming Gruppe Fühlt
1186 Verein Deutscher Studenten (VDSt) zu Graz
Studentische Verbindung mit dem Ziel, die Tradition des Studententums aufrecht zu erhalten. Informiert über Veranstaltungen, Mitglieder und Geschichte und bietet Galerie, Forum und Gästebuch.
Vdst Deutscher Leoben Studenten Wien Graz Straßburgtagung Verein
1187 Verein Deutscher Studenten (VDSt) zu Graz
Studentische Verbindung mit dem Ziel, die Tradition des Studententums aufrecht zu erhalten. Informiert über Veranstaltungen, Mitglieder und Geschichte und bietet Galerie, Forum und Gästebuch.
Vdst Deutscher Leoben Studenten Wien Graz Straßburgtagung Vereine
1188 Galerie sb13
Rober Trsek - Kärntner Maler, Vertreter der klassischen Moderne, aber auch Werke anderer Künstler werden im Internet ausgestellt und sind käuflich zu erwerben.
Trsek Galerie Sb Malerei Robert Vernissage Bilder Graphik
1189 Aichhorn, Margit
Die ?-sterreichische Künstlerin nutzt ihre eigene ?-lbild-Technik und verarbeitet die kräftigen Farben mit Spachtel und Fingern. Eine umfangreiche Galerie zeigt über 120 ihrer Werke.
1190 Martin Mascherl Manufaktur
Spezialisiert auf ausgefallene Kreationen in Form von Fliegen oder Krawatten für den Hals. Die unterschiedlichsten Materialien, wie Spiegelsplitter, werden dafür verwendet. Eine Galerie ist zu finden.
Mascherl Shop Martin Vienna Manufaktur Unserem Material Kunstwerke
1191 Mandl & Bauer
Der österreichische Hersteller stellt einige seiner Referenzobjekte in einer Galerie vor. Es wird ein FAQ-Bereich (Frequently asked Questions) zum Thema Kaminbau geboten. [A-4170 Haslach an der Mühl]
Inhalt Mandl Installieren Bauer Flashinstallieren Html Alternativer Browserskriptunterstützung
1192 Mandl & Bauer
Der österreichische Hersteller stellt einige seiner Referenzobjekte in einer Galerie vor. Es wird ein FAQ-Bereich (Frequently asked Questions) zum Thema Kaminbau geboten. [A-4170 Haslach an der Mühl]
Inhalt Installieren Bauer Mandl Browser Stellen Flashinstallieren Fürdiesenadobe
1193 Installateur Kreidl
Installateur Meisterbetrieb. Bietet Badezimmer und Bäder sowie Solar-Heizung oder Holzheizung mit Pellets und Hackgut. Mitarbeiter, Jobs, Galerie, Shop.
Content Elektro Kreidl Wärmepumpen Biomasse Solar Page Wasser
1194 von der Gis
Es wird über den Werdegang der Zucht berichtet, die Zuchthunde in Wort und Bild vorgestellt und über die Nachzucht informiert. Weiter wird der Rassestandard dokumentiert und eine Galerie gezeigt.[A]
Server Port Permanently Theapache
1195 Rattenhausen
Unter Ratten und Galerie findet man viele Fotos von Petras Ratten. Zusätzlich gibt es Hinweise zum Wiener Rattenstammtisch und zur österreichischen Notfallvermittlung.
Hilfe Siesicher Website Austria Finden Erstellen Konnten Bitte
1196 Volarte Contemporary Editions
Volarte ist eine Galerie für zeitgenössische Artprints. Präsentiert werden Exponate für ein inspirierendes und beflügelndes Wohn- und Arbeitsambiente.
Z Y
1197 Kahler, Urs
Der Kärntner Fotograf präsentiert seine Werke: Porträt, Akt, Landschaft, Collagen. Die Site bietet ausserdem eine Galerie mehrerer Kärntner Maler.
Maler Kahler Photographie Urs Walkensteiner Kolig Landschaft Janusch
1198 Docekal, Jan
Der tschechische Maler, Grafiker und Kunsthistoriker stellt seine Kollagen vor, in denen er durch Schichtung unterschiedlicher polygraphischer Materialien ein plastisches Relief erzeugt. Vita, Erfolge, Ausstellungen, Galerie.
1199 Schloss Traun
Das Schloss präsentiert sich als Gebäude für Kulturveranstaltungen, Seminare und Feste. Berichtet über die Geschichte, die erfolgte Renovierung, Anreise und zeigt eine Galerie mit Fotos.
Traun Vest Schloss Kulturschloss Detection Abonnement Künstlerinnen Haydnsaal
1200 M-ART internationale Galerie am Börseplatz in Wien
Zeigt Künstler aus der ganzen Welt im Zentrum von Wien. Informationen über die aktuelle und frühere Ausstellungen, ein Künstlerarchiv, Vernissagen, Pressemeldungen, Kontakt, und die ?-ffnungszeiten.
Forbidden Founderrordocumentport Apache Server
1201 Kleinstaasdorf im Tullnerfeld
Kleinstaasdorf liegt am südlichen Rand des Tullnerfeldes und gehört zur Stadtgemeinde Tulln an der Donau. Präsentiert wird unter anderem eine Galerie mit historischen Fotos.
1202 Eckankar ?-sterreich
Die "Uralte Weisheit für die heutige Zeit". Eckankars Lehre betont den Wert persönlicher Erfahrungen als den natürlichsten Weg zurück zu Gott. Mit Infos zu den Seminaren und Veranstaltungsterminen, sowie Galerie und Bücher.
1203 Galerie Dagmar Aichholzer
Werke zeitgenössischer Künstler werden von der Kunstkritikerin Dagmar Aichholzer ausgewählt und zum Kauf angeboten.
Galerie Kunst Dagmar White Aichholzer Spezialisiert Zeitgenössische
1204 Neue Galerie Graz - Egon Schiele
Presents the Leopold Collection at the Neue Galeria Graz, Austria.
Steiermark Eingabeeingegeben Browserleiste Tun Adresse Vernetzen Landtag Steiermärkischen
1205 Anton Tantner
Die Seite des Historikers Anton Tantner (Universität Wien) bietet eine Galerie der Hausnummern, Informationen über Publikationen und Lehrveranstaltungen
1206 Fotoclub Aigen Schlägl
Der Fotoclub zeigt Bilder und Experimente, sowie eine Virtuelle Galerie und Informationen über die Dauerausstellung im Kulturhaus Aigen.
Fehlergefundenfolgender Aufgetreten Die Webmaster Schreibweise Hauptseite Serverbitte Ispconfig Powered
1207 Wiener Schule für Kunsttherapie
Die WSK bietet Weiterbildungen in Kunsttherapie und Phronetik an. Auf den Seiten kann man sich über die Schule und Inhalte erkundigen. Mit Galerie. [A-1090 Wien]
Kunsttherapie Wiener Schule Ausbildung Kultur René Ernst Bildungen
1208 Ansichtskarten aus Unterach am Attersee
Online-Galerie von historischen und aktuellen Ansichtskarten aus Unterach und Umgebung.
Unterach Attersee Ansichtskarten Allgemein Sicht Pinkl Menue Punkte
1209 ?-sterreichisches Notgeld
Für Sammler und Interessenten österreichischen Notgelds ist diese Seite ein absolutes Muss - finden sie doch auf ihr umfangreiche Informationen um ihr Hobby. Eine umfangreiche Galerie zeigt den Besuchern die Vielfalt der Notgelder.
Z Y
1210 ?-sterreichisches Notgeld
Für Sammler und Interessenten österreichischen Notgelds ist diese Seite ein absolutes Muss - finden sie doch auf ihr umfangreiche Informationen um ihr Hobby. Eine umfangreiche Galerie zeigt den Besuchern die Vielfalt der Notgelder.
Z Y
1211 Crazy Trike Wozak
Verleih und Verkauf von Trikes im Raum Salzburg. Dazu Informationen über die Werkstatt und Zubehör. Links und eine Foto-Galerie sind auch vorhanden. [A-5081 Niederalm bei Salzburg]
Dreirder Trikes Vorderrad Trike Dreirad Fahrzeug Hinterrad Klasse
1212 Mein Sierra
Stellt seine Automobile, einen Sierra und einen Capri vor. Ausserdem Berichte von Treffen, Links, Galerie und eine Liste verfügbarer Ausschlachtobjekte.
1213 Kunst und Politik im Naziregime
An vier Kunstwerken wird exemplarisch die Aneignung der Kunst durch das Naziregime betrachtet, daneben gibt es einen Beitrag über die "Führersammlung" für die Neue Galerie in Linz.
Adrian Mitarbeit Germany Network Sculpture Robert Gestaltung Politics
1214 Kunst und Politik im Naziregime
An vier Kunstwerken wird exemplarisch die Aneignung der Kunst durch das Naziregime betrachtet, daneben gibt es einen Beitrag über die "Führersammlung" für die Neue Galerie in Linz.
Adrian Redaktionelle Wassermann Gestaltung Kunstpolitik Woelfl Braun Germany
1215 TUG Racing Team
Ist ein Studentenprojekt und beschreibt was sich hinter der Formula Student verbirgt. Darüber hinaus ist eine Auflistung der Teilnehmer, Neuigkeiten, Pressestimmen, eine Galerie und ein Forum vorhanden. Der Bezug eines Newsletters ist möglich.
Tankia News Team Maxwheel Partner Admin Graz Alumni
1216 TUG Racing Team
Ist ein Studentenprojekt und beschreibt was sich hinter der Formula Student verbirgt. Darüber hinaus ist eine Auflistung der Teilnehmer, Neuigkeiten, Pressestimmen, eine Galerie und ein Forum vorhanden. Der Bezug eines Newsletters ist möglich.
Tankia News Team Partner Maxwheel Admin Graz Alumni
1217 TUG Racing Team
Das Studentenprojekt beschreibt, was sich hinter der Formula Student verbirgt. Darüber hinaus ist eine Auflistung der Teilnehmer, Neuigkeiten, Pressestimmen, eine Galerie und ein Forum vorhanden. Der Bezug eines Newsletters ist möglich.
Tankia News Team Maxwheel Partner Admin Graz Alumni
1218 TUG Racing Team
Das Studentenprojekt beschreibt, was sich hinter der Formula Student verbirgt. Darüber hinaus ist eine Auflistung der Teilnehmer, Neuigkeiten, Pressestimmen, eine Galerie und ein Forum vorhanden. Der Bezug eines Newsletters ist möglich.
Tankia News Team Maxwheel Partner Admin Graz Alumni
1219 Riccis Homepage
Eine Zusammenfassung von der Restaurierung der eigenen Fahrzeuge, einen Corvette Stingray und einen Cadillac. Zudem werden in einer Bilder-Galerie verschiedene Fahrzeuge veröffentlicht.
1220 Caldonazzi Grafik-Design
Das Atelier und die Künstler Martin Caldonazzi und Wilma Zündel werden vorgestellt, Einblicke ind die Galerie aber auch in professionelle Designs werden gewährt sowie Kontaktadressen angeboten.
Caldonazzi Grafik Design Martin Atelierz
1221 Chow Chow Club Austria
Informationen über den Club, Ausstellungen, Rassestandard, Züchter, Welpen und Chow Chows in Not, Deck- und Wurfmeldungen, Champ-Galerie, Ausstellungs-Ausschreibungen und Terminkalender für Clubabende.
Chow Tulln Ccca Club Chows Clubtreffen Wurfmeldungen Kalender
1222 Causa Bloch-Bauer
Die Seite des amerikanischen Anwalts Randol E. Schoenberg hat eine Klage auf Herausgabe von sechs Klimt Gemälden aus dem Besitz der ?-sterreichischen Galerie zum Inhalt. Materialien zum Verfahren und zum Problem "Raubkunst" (deutsch, englisch). Presse-Schau. Links.
1223 Vokalensemble Voices
Das Repertoire des Ensembles umfasst sowohl geistliche als auch weltliche Musik, Messen, Motetten und Madrigale aus der Renaissancezeit, Gospels und Spirituals, Folksongs, Lieder, sowie Schlager und Hits. Konzerttermine, Galerie, Hörproben und die Möglichkeit, E-Mail-Benachrichtigungen zu erhalten.
Voices Vokalensemble Konzert Passau Rahmen Auftritte Wordpress Mariendom—
1224 Katholisches Bildungshaus Tainach
Das katholische Bildungshaus Sodalitas wird als Ort für Seminare und Konferenzen in 5 Sprachen vorgestellt. Schwerpunkte sind die Geschichte mit einer Galerie, das Seminarzentrum, Veranstaltungs- und Bildungsangebote. Ein Gästebuch, ein Dialogforum, Anreise- und Kontaktinformationen ergänzen da Angebot.
Dom Sodalitas Projekt Poletna Tinjah Prihodnost Klangwelten Poti
1225 Katholisches Bildungshaus Tainach
Das katholische Bildungshaus Sodalitas wird als Ort für Seminare und Konferenzen in 5 Sprachen vorgestellt. Schwerpunkte sind die Geschichte mit einer Galerie, das Seminarzentrum, Veranstaltungs- und Bildungsangebote. Ein Gästebuch, ein Dialogforum, Anreise- und Kontaktinformationen ergänzen da Angebot.
Dom Tinjah Poletna Sodalitas Projekt Bildungshaus Ločene Nutzungsbedingungen
1226 Katholisches Bildungshaus Tainach
Das katholische Bildungshaus Sodalitas wird als Ort für Seminare und Konferenzen in 5 Sprachen vorgestellt. Schwerpunkte sind die Geschichte mit einer Galerie, das Seminarzentrum, Veranstaltungs- und Bildungsangebote. Ein Gästebuch, ein Dialogforum, Anreise- und Kontaktinformationen ergänzen da Angebot.
Dom Projekt Poletna Tinjah Sodalitas Prireditve Poti Klangwelten
1227 Sammlerseite für ?-sterreichische Banknoten
Johann Kodnar informiert rund ums österreichische Papiergeld. Mit einer umfangreichen Galerie von Banknoten, einer Auflistung der derzeit erzielbaren Verkaufspreise sowie geschichtlichen Details der Alpenrepublik.
Banknoten Notgeld Sammler Geldscheine Kronen Gulden Papiergeld Schilling
1228 Astronomischer Arbeiskreis Salzkammergut (AAS) und Sternwarte Gahberg
Die Seite stellt die Tätigkeiten des Vereins vor und bietet daneben von Berichten und Reportagen über astronomische Ereignisse (Sonnenfinsternisse, Meteore und Polarlichter). In einer Galerie werden eigene CCD-Aufnahmen ausgestellt. Ein Newsticker informiert über aktuelle Projekte und Veranstaltungen des Vereins.
Sternwarte Gahberg Salzkammergut Astro Astronomie Arbeitskreis Astronomischer Kamera
1229 Pandeka Mihar G=Sentak Austria
Meisterlehrer Mihar Walk Pangeran unterrichtet in Wien Kampfkunst auf der Basis verschiedener "silek"-Stile der Minangkabau. Aktuelles, Entwicklung der Schule, Seminare, Artikel, Photo Galerie. Sprachen: Deutsch, Englisch, Bahasa Indonesia, Baso Minang, Ungarisch.
Paureh G=sentak Tradition Mihar Fighting Kostenlose Sanggar Pmg=sentak
1230 Pandeka Mihar G=Sentak Austria
Meisterlehrer Mihar Walk Pangeran unterrichtet in Wien Kampfkunst auf der Basis verschiedener "silek"-Stile der Minangkabau. Aktuelles, Entwicklung der Schule, Seminare, Artikel, Photo Galerie. Sprachen: Deutsch, Englisch, Bahasa Indonesia, Baso Minang, Ungarisch.
Pandeka Pandekamihar@yahoode Pmg=sentak Tradition Mihar Kostenlose Einstiegskurse Motion
1231 Lentos - Kunstmuseum Linz
Im Auftrag der Stadt Linz errichtet das Baumanagement der LINZ Service GmbH (vormals SBL) am rechten Donauufer nahe des Brückenkopfes das neue Museumsgebäude Lentos Kunstmuseum Linz für die Neue Galerie.
Error Runtime Thecurrent Server Noteserror_ Urldescription Application
1232 Initiativen des Vereins Lebenswertes Leben
Die Sammelseite für die Initiativen des Vereins Lebenswertes Leben. Behindertendorf Altenhof, Kulturzentrum und Galerie Hausruck, Projekt Wege, Fachmesse integra, Projekt Casa Linz, Institut für Physiotherapie, Logopädie und Ergotherapie.
Hilfe Behinderung Menschen Betreuung Altenhof Integra Bildungszentrum Dorf
1233 Bundesgymnasium Dornbirn
Das Bundesgymnasium stellt die Schule, ihre Organisation und ihre Projekte vor. In einer Galerie könne Schüler ihre eigenen Objekte präsentieren, die Schulbibliothek wird durch eine eigen Site repräsentiert, ausserdem gibt es Kontaktmöglichkeiten zu Beratungs- und anderen Einrichtungen, die mit der Schule in Zusammenhang stehen.
Dornbirn Browserbg Ihrem Z
1234 Permanent Brain
Ein kleines Museum führt durch eine Galerie mit Covergrafiken klassischer Schachprogramme. Man kann bedeutende "Mensch gegen Maschine" Partien im Browser nachspielen [benötigt Java] oder herunterladen. Neben einem Quicktest für die Kombinationsstärke von Schachprogrammen finden sich Kommentare über die Schachnovelle, kommentierte Links sowie einige kostenlose Eröffnungsbibliotheken zum Engine-Testen.
Computerschach Permanent Brain Chess Computers Schach Schachcomputer Oldies
StadtBranche.at Österreich Web Katalog für Galerie Österreich - Statistiken: 3 StadtBranche.at Österreich Punkte für "Galerie Österreich" - In die Bewertung wird die Anzahl der Besucher und Erfahrungsberichte dieser Themenseite mit einbezogen. Galerie › Taxi Wien Öffnungszeiten Österreich Bewertungen Galerie Österreich Erfahrungen und Öffnungszeiten Datum: Kontakt StadtBranche.at

Neuer Eintrag 

Tipps & Tricks für Arbeit & Leben:



△ nach oben kostenfreier Eintrag Datenschutz