optional Stadt:
Webseiten Österreich ›

Galerie

Galerie Österreich


Google Anzeige:

Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 Flughafentaxi Wien Flughafentaxi Flughafentransfer
1100
Wien
Mit dem Flughafentaxi zum Wiener Flughafen oder vom Flughafen nach Wien, Wien Umgebung und Niederösterreich fahren. Der Wiener Flughafentaxi Service bietet..
wienerflughafentaxi.at Taxi Wien Flughafen | Flughafentaxi € Bestellen Webseite Galerie Anfahrt Fixpreis Autoklassen Angebote ✈ Günstig
2 Künstlerische Fotografie Fotografie
3100
3100 St. Pölten
Meine bevorzugten Themen sind Porträt-Fotografie, Spirituelles, Natur-und Makrofotografie, People/Children-Fotografie, Experimente, Impressionen, Fotoreisen. ​Seit 6 Jahren leite ich Foto-Workshops für Jugendliche an..
jaeggi-fotoart.com Fotografie Workshops Experimente Foto Children Spirituelles People Waldviertel Nude Impressionen Reisen Galerie News Nordalbanien Ua Hin Landschafts Erstreckt
3 Nature Adventure - Canyoning Outdoorsport
6652
Elbigenalp
Wir bieten geführte Outdoorsporttouren an und haben uns auf Canyoning, Rafting und Mountainbike spezialisiert. Zu Hause im Tiroler Lechtal, einer..
nature-adventure.at Canyoning Rafting Nature Adventure Lechtal Lech Programm Neuigkeiten Specials Tirol Galerie Bike Video Touren Mountain
4 DESIGN & FOTO cornelefant Grafikdesignerin &
8510
Stainz
Fotografin für Business- und Eventfotografie und entwickle als Grafikdesignerin Corporate Designs (Logo-, Drucksorten-, Website- und Werbematerialgestaltung), sowie Illustrationen und Mockups..
cornelefant.at Design Foto Galerie Fotografie Booth Corporate Photo Portrait Website Menschen Grafikdesign Grafikdesignerin Montage Info To
5 87xpictures - Hochzeitsfotograf Fotograf
2700
Wiener Neustadt
Hochzeitsfotografie... Diesen Moment mit euch zu teilen ist für jeden Hochzeitsfotografen eine große Ehre! Alle Emotionen, Freudentränen und Eindrücke von diesem Tag festzuhalten..
87xpictures.at Auge Preis Fotograf Wiener Neustadt Hochzeit Hochzeitsfotograf Hochzeitsfotografie Fahrzeuge Galerie Firmen Hochzeitsfotos Video Familie Xpictures Moment Erkennenein Timing Analysen
6 Hundepension und Hundesalon Hundepension
2201
Seyring
Hundehausen ist eine Hundepension mit hauseigenem Hundesalon. Wir betreuen Ihren Hund untertags, über das Wochenende, oder während Sie auf Urlaub..
hundehausen.at Hund Hundepension Hundesalon Liebling Hundehausen Hunde Bedrfnisse Leben Urlaub Spezialtarife Agbs Galerie Mich Betreuung Grund Formulare Philosophie Preise
7 Galerie Szaal Galerie
1010
Wien
Galerie Szaal ist bereits seit dem Jahr 1921 erfolgreich und eine fixe Größe im Wiener Kunsthandel. Wir führen unser florierendes..
szaal.at Künstler Ankauf Galerie Aquarelle Ditsch Wien Hugo Hubert Ausstellungen Carl Ausstellung Messen Gemälde Helmut Scheidl Moll Wigand Marie Scheibl
8 Salounge - die exklusive Salzgrotte Wellness
2230
Gänserndorf
Die Salounge ist nicht einfach eine Salzgrotte, sondern ein Raum, welcher mit Salzelementen geschmückt und mittels modernster Technik für die..
salounge.at Salounge Beauty Lounge Gänserndorf Süd Salzgrotte Marietta Danis Hygiene Mini Galerie Spa Beratung Salzqualität Privatsphäre Termin
9 Malerisak Malereibetrieb Erwin
8530
Deutschlandsberg
Malerbetrieb Isak ist spezialisiert im Bereich von: Historische Objekte Restaurierung, Fresken, Skulpturen, Wandmalereien, Innen-und Aussenstuck, Historische Maltechniken, Designmalerei, Holz-und Stein- Imitationen..
malerbetrieb-isak.at Isak Erwin Malerei Malerbetrieb Deutschlandsberg Maler Leistungen Wirklichkeit Filmreportage Firmenabcat Lehrlingsausbildung Galerie | Twittern Aufgaben Besten Perfekt
10 Weinbau Lozka-Werderits Weinbaubetrieb
7473
Hannersdorf
weinbau-lozka.at Werderits Erich Anni Weinbau Rheinriesling Lozka Weingut Blaufränkisch Galerie Grüner Weinbaubetrieb Weine Hannersdorf Pinot Veltliner Lozka * Familie
11 Fotograf Alexander Steppan Fotograf
2340
Mödling
Meine Bereiche: Hochzeitsfotos, Portraitfotos, Familienfotos, Kinderfotos, Studiofotos. Fotograf für Events, Firmenfeiern, Familienfeiern. Senden Sie mir bitte ihre Anfrage und Sie..
alexandersteppan.at Fotograf Alexander Wien Steppan Niederösterreich Mödling Familien Moedling Galerie Leistungen Portfolio Porträtshochzeitsfotografie Oesterreich
12 Specksteinofen Tulln Hafner
3004
Riederberg
Als Hafnermeisterbetrieb bieten wir Ihnen eine breite Palette an Specksteinöfen. Unsere Dienstleistungen umfassen die Beratung, Planung, Aufstellung und anschließende Wartung..
specksteinofen-tulln.at Specksteinöfen Specksteinofen Tulln Hafnermeister Abgeschlossene Speckstein Arbeiten Wärme Kleine Fragen Speicheröfen Erstgespräch Galerie Fachmann Scroll Gase Wohlfühlen Gesteins
13 Glamourshots Foto & Video Fotografie
1140
Wien
Meister Fotograf Harald Sahling setzt Kundenwünsche durch eine detaillierte Vorbesprechung und Einsatzfreude besonders gelungen in Bild (Foto oder Video). Zusätzlich erhalten..
glamourshots.at Fotos Philosophie Galerie Preisliste Video Leistungen Bewegt Glamourshots Hochzeitsfotograf Fotograf Fotografie Hochzeit Wien Druckgrafik Bewerbungsbilder Sahling Familien
14 Kunst Belebt Kunsttherapie e.U. Kunst Belebt Kunsttherapie e.U. Kunsttherapie Gesundheit
2500
Baden
Blockaden lösen, Traumata verarbeiten, Perspektiven finden, Ressourcen entdecken: Die Kunsttherapie wird in klinischen, pädagogischen, heilpädagogischen oder soziokulturellen Bereichen ausgeübt, also in..
kunst-belebt.at Kunsttherapie Kunst Belebt Ressourcen Webkatalog Perspektiven Wege Traumata Praxis Gestaltungsprozesse Room Strken Schulen Beispiele+methoden Behindertenhilfe Dennstedt Einrichtungen Gibt Galerie Krisen
15 Professionelle Fotografie Professionelle Fotografie Fotografie
2340
Mödling
PHOTOPAM, Ihre professionelle Fotografin in Wien, Wien Umgebung und Bezirk Mödling für Hochzeit, Porträt und Reportage. Photopam | Pamela Draxler..
photopam.at Photopam Porträt Draxler Fotografie Pamela Wien Leistung Hochzeit Reportage Birgit Lust Galerie Blog Rallye Oldtimer Beitrag Umgebung Wer | Babyfotos
16 LuXury StretchLimousinen Graz Umg. Autos
8401
Kalsdorf bei Graz
ab €79.- ( unter www.LUXURY-DHA.at & www.StarLiner-Limousinen.at sowie www.facebook.com/StretchLimoverleihLUXURY ) sind die aktuellsten Foto's unserer Fahrzeuge zu sehen ) StretchLimo's: •Lincoln Town Car..
luxury-dha.at Stretch Limousinen Graz Stretchlimousine Luxury Hummer Vip Stars Fuhrpark Shuttle Xxxl Galerie Preise Erstellen Lincoln Partner Organisation
17 Fertighäusern Angebot Holzbauhaus
310504
Romania - Arad
Wir sind die Firma "SC. HOLZ HAUS CONSTRUCTION SRL" – ein rumänischer Hersteller von Fertighäusern in Holzrahmen. ..
holzhauseco.com Schillingsfürst Ulm Galerie Bungalow Neu Materialien Hersteller Holz Mauerarbeiten Rumänischer Musterhaus Produktion Preis Haus Uns
18 Kunsthandel Seitz Kunsthandel
4020
Linz
Unser umfangreiches Angebot umfasst vorwiegend österreichische Kunst des 19. und 20. Jahrhunderts. Schwerpunkt des Sortiments bildet dabei die Malerei der..
kunsthandel-seitz.at [ ] Ankauf Galerie Mã–bel Seitz Kunsthandel Künstler Seitzat Uhr Gerne Gemälden Messen Rahmungen Wirberaten Website
19 Nicis Haarsalon Friseur Friseursalon
4850
Timelkam
Suchen Sie einen Friseur im Bezirk Vöcklabruck? Nicis Haarsalon ist ein neu eröffnetes Friseurstudio in Timelkam. Ich freue mich auf..
nicis-haarsalon.at/ Gampern Timelkam Frisör Nicis Galerie Anfahrt Dienstleistungen Haarsalon Neueröffnung ã–ffnungszeiten Nici Wenige Neuerã–ffnungentfernt Damen Für
20 Bauernhofurlaub Österreich Tourismus
5582
St. Michael
Urlaub am Bauernhof ist pure Vielfalt für Groß und Klein. Das Angebot reicht vom Kinderbauernhof, Reiterbauernhof über den Radbauernhof und..
bauernhofurlaub-oesterreich.at/ Mail Galerie Sterne Logo Adresse Bauernhof Name Preis Navigation Website überspringen ã–sterreich Urlaub Familie Bauernhofurlaub Webcams Radurlaub öffnen Xxxdxxxxxxxexxxxxex
21 Mostviertel Alpaka Tierzucht
3353
Biberbach
Herzlich Willkommen am Mostviertler Alpakahof! Wir züchten diese sanftmütigen Tiere mit Herz und laden Sie ein, sich von der besonderen Ausstrahlung..
mostviertel-alpaka.at Alpaka Mostviertel Alpakas Biberbach über Mostviertler Galerie Seiten Alpakaprodukte Züchter â _das Faserlieferanten Besuch_ â â  â  â  â  â  â  Karlâ edermayr Anden_â â â â â â â â â â â â â â â â â â â â â â â â â 
22 Catering Wien - Hochzeits Catering
1220
Wien
Joshuas Sammlungen der besten Rezepte, zusammen gestellt aus der ganzen Welt und geprägt durch seine levantinischen Wurzeln, werden bei seinem..
joshuascatering.at Catering Wien Events Kochkunst Locations Partyservice Galerie Since Joshua Dishes Offering Emphasizing Menu Cooking Fingerfood
23 Drechselkurse Kunstdrechseln
4464
Kleinreifling
Drechselkurse für Anfänger Drechselkurse für Fortgeschrittene..
creationschnauer.at Schnauer Galerie Kurse Drechseln Carl Ausstellungen Objekte Unser News Shop Lernen Meditation Kunstdrechseln Mich La Handwerkskunst
24 Lollipop - Kinderkurse, Geburtstagsparties Kinderbetreuung
1190
Wien
Im Lollipop erwaten Sie und Ihre Kleinen Kinderkurse, Elternworkshops und auch Kinderparties und Geburtstagsfeiern planen wir gern mit Ihnen. Unsere..
q19.at/de/lollipop Wien Kinderbetreuung Döbling Darüber Fakten Hinweise â» Nutzungsbedingungen Shop Einkauscenter Galerie Bild Lollipop Team Straße Grinzinger Planshops
25 Physiotherapie Impuls Physiotherapie
5020
Salzburg
Physiotherapeut Kovac Ivica klassische Physiotherapie Lymphdrainage Cranio-Sacrale-Osteopahtie Heilmassage Akupunktmassage Crafta-Therapie: Gesichts-Kiefer-Kopfschmerzen und Halswirbelssäule-Problematik Passive Therapie: Elektrotherapie und Ultraschall Skoliosebehandlung Behandlung vor und nach Operationen..
impuls-praxis.at Hebammenpraxis Physiotherapie Angebot Behandlung Pagealarm Galerie Anfahrt Kurstermine Stock Rights Designed Impuls Faberstraßemail Reserved
26 Hebammenpraxis Hebamme
5102
Anthering
Hebamme Kovac Angelina Angebot: Mutterkindpass-Beratung Akupunktur Kinesiotaping Geburtsvorbereitungskurs Rückbildungskurs Babymassage Vor und Nachsorge ( ambulanter und vorzeitiger Entlassung)..
impuls-praxis.at Hebammenpraxis Physiotherapie Angebot Galerie Kurstermine Pagealarm Anfahrt Behandlung Mail Adresse Physiotherapie + Designed Anzeige Stock Y
27 Hebammenpraxis Hebamme
5020
Salzburg
Hebamme Angelina Kovac Hebamme für Salzburg Stadt und Flachgau Angebot: Mutterkindpassberatung Akupunktur Kinesiotaping Geburtsvorbereitungskurs Rückbildungskurs Babymassage Vor und Nachsorge in der Schwangerschaft in Salzburg Stadt und Flachgau..
impuls-praxis.at Hebammenpraxis Physiotherapie Behandlung Angebot Galerie Pagealarm Kurstermine Anfahrt Spambots Bewegungaristotelessofortkontakt Physiotherapie Leben Uns Designedimpuls
28 Opocensky Catering + Event Catering &
1030
Wien
Opocensky Catering + Event GmbH ist ein Wiener Cateringunternehmen mit Sitz im 3. Bezirk. Ob Brötchenlieferungen, Fingerfood-Service, Buffetkreationen, Gala-Dinner oder..
edelcatering.at Opocensky Edelcatering Eventcatering Lunch Business Brötchen Fingerfood Galerie Cateringlivecooking Unternehmen Z
29 Wandbilder Acrylbilder von Salvova Kunst
1030
Wien
Wandbilder kaufen bei Slavova Art Wandbilder kaufen. Hier finden Sie den Link zu den Bildern im Shop. Es sind alles handgemalte..
slavova-art.at Wandbilder Acrylbilder Slavova Bilder Kunst Moderne Material Bild Leinwandbilder Gutscheine Abstrakte Kaufen Galerie Shop Leinwand
30 InnTeam Eventservices Eventgestaltung
6200
Jenbach
Rundumservice für Ihre Veranstaltung - von der Konzeption bis zur Durchführung alles aus einer Hand..
innteam.at Eventservices Angebot Leitbild Galerie Innteam Fasser Office@innteamat Jenbach Manfred Begutachtenfeiern Kirchgasse Beisie Bisherigenarbeiten Innteam
31 Carwrapping Carwrapping Folierung
8055
GRAZ
Folientechnik,Carwrapping, Fahrzeugbeschriftung, Digitaldruck, Folien, Sonnenschutz, Steinschlagschutz, Lackschutz, Beschriftungen, Vollfolierung, Teilfolierung,..
schusterpromotion.com Neu  Produkte Kontaktformular Galerie Carwrapping Vorteile News Referenzbilder Werbung Galerie  Staubfreien Mein Besuch M  * Einfach
32 JB Fotografie Fotograf

Aschach an der Donau
juergen-brochmann.at Brochmann Jürgen Photography Gästebuch Aschach Hdav Galerie Versicherung Bild Fotokursleiterin_ Fotografieren Logout Adler Macht Ersten Jimdo
33 Feitsch Dominik Photography Wedding Hochzeit
2230
Gänderndorf
Fotograf aus Gänserndorf für Professionelle Portrait, Hochzeit und Firmen Shootings. Auch für High End Beauty Retouche und Bildbearbeitung sind Sie..
fd-photography.at Feitsch Intercar Bildbearbeitung Bilder Fotodesign Galerie Hochzeit Firmenportrait Videos Blog Friseur Angebote Tipps Making Strasshof Kinder Familienfotos
34 Belfigura Gesundheit
9500
Villach
Institut für Gewichtsabnahme, Cellulitebekämpfung und Bodycontouring im Zentrum von Villach..
belfigura.com Belfigura Bodycontouring Team Gesichtsanwendungen Studio Medizinische Villach Schlank Wellnessanwendungen News Galerie Bruststraffung Lang Ernährungsberatung ã„sthetik Leben Behandlungen Leistungen Belfigura Ganz
35 Appartement Stoderblick Ferienwohnung
8962
Gröbming
Appartement Stoderblick Im unvergleichbaren Panorama der obersteirischen Bergwelt gelegen bietet Ihnen das Appartement Stoderblick die ideale Unterkunft für Ihren Urlaub. Ob..
appartement-stoderblick.at Ausstattung Stoderblick Gröbming Dachstein Appartement Winter Galerie Sommer Anfrage Lage Urlaub Schladming Anfahrt Aktivitäten Zimmer Ferienregionschladming
36 Mobiles Experimentier-Labor Angelika Wallner Animation und
2640
Pettenbach
Alle Spürnasen aufgepasst! Ich bin Animateurin für Kindergeburtstage der besonderen Art. Was ich mache: Naturwissenschaftliche Versuche zum Anschauen und "Be- und AnGreifen"..
wissen.co.at Galerie Gästebuch Anfassen Experimente Wissen Biologie Hause  Menschen Montessori Naturerscheinung Neues Chemie Experimentierenalle Glas Ratund
37 Fotograf in Wien Fotograf

Wien
Fotograf in Wien..
valphotography.at/ Wien Hochzeitsfotografie Fotografie Galerie Hochzeitsfotograf Business High End Portraitfotografie Fotos Bewerbungsfotos Produktfotografie Fotobooth Kunden Fotogalerien Vorteile Galerien–
38 STEIN:WERK Steinbearbeitung Kunst
5166
Perwang am Grabensee
Als Tischler habe ich mich von dem Werkstoff Stein fesseln lassen und schafft mit meinem 2012 gegründetem Einzelunternehmen Werke..
stein-werk.at Steinwerk Werk Stein Archiv Ergebnis Shop Agb Vollendung Steinschlag Heinz Dekowerk Weine Presse Quellsteine Tätigkeit Steinwerker Download Feuerwerk Galerie Pinggau Holz
39 Schwimmkurse und Training Sport Schwimmen

Wien
Finswimming SpeedFish ist ein Verein hauptsächlich für Kinder und Jugendliche. Wir bieten Schwimm- und Flossenschwimmtraining für alle Leistungsstufen an. Vom Anfängerschwimmkurs..
speedfish.at Speedfish Schwimmen Wasser Scroll Flossenschwimmen Team Speed Galerie Gummiflossen News Spaß Jahren Kraul Name Blog
40 Andreas Bübl | Hochzeitsfotografie Hochzeitsfotograf
1220
Wien
Meine Leidenschaft für Hochzeiten findet sich in meinen anspruchsvoll-künstlerischen Hochzeitsfotos wieder. Bilder die berühren - mit viel Liebe fotografiert. Als..
bestwedding.at Hochzeitsfotograf | Wien Emotionen Bübl Andreas Momente Farbe Hochzeit Hochzeitsfotos Tag Lebens Bilder Erinnerungen Schaffen Galerie
41 Acrylbilder moderne Kunst Slavova Kunst
1030
Wien
Acrylbilder handgemalt abstrakte Acrylbilder mehrteilige Acrylbilder online kaufen Entdecken Sie meine handgemalten Acrylbilder. Aus jahrelanger Erfahrung kann ich Ihnen Acrylbilder und..
slavova-art.at Wandbilder Acrylbilder Bilder Slavova Abstrakte Gutscheine Moderne Kaufen Leinwandbilder Kunst Acryl Galerie Leinwand Abstrakt Seide
42 AubergPUB & PIZZA Bierpub
2084
Weitersfeld
hausgemachte Steinofen Pizza - Jeden Mitttwoch, Freitag und Samstag von 18:00 - 22:30. Dart, Wuzzler, Musikautomat,... Große Auswahl an Bieren, Spirituosen und..
aubergpub.at Aubergpub Galerie Pizza Steinofen Veranstaltungen Video Auberg Gästebuch Webmaster Impressionen Ausfahrt Mitnehmen Nöbez Pizza_jeden Homepage Shake
43 Wing Tai Schule für Kampfsport
4600
Wels
Die Wing Tai Kampfkunst Schule unterrichtet Kampfkunst auf hohem Niveau. Bei uns können Kinder ab 7 Jahren in eigenen Kinderklassen..
wingtai-wels.at Wing Tai Kosten Zeitpunkt Kinder Erwachsene Jugendliche Galerie Kids Ong Sommercamp Probetraining Boxen Thai Trainings Trainer Link Erfolg
44 Tanja und Josef - Fotografie &
9073
Viktring
Hochzeitsfotografie & Film aus Klagenfurt und Kärnten Die schönsten Momente erleben wir beim Fotografieren und Filmen der so atemberaubenden Hochzeitszeremonien unserer..
TANJAundJOSEF.at Hochzeitsfotograf Hochzeitsfilm Kärnten Galerie Klagenfurt Hochzeit Krnten Hochzeitsvideo Marryoke Fasching Uns Hochzeitsfotos Shoot Steiermark Standard Fär
45 Art On Screen - Kunst- und
1030
Wien
Ihr Kunst-Navigator für die wichtigsten Ausstellungen, die schönsten Museen und Galerien in Österreich, Deutschland und der Schweiz. Art On Screen -..
artonscreen.at | aos-magazine.com Kunst Relations Investor Kultur Bono Contact Art Galerie Peter Screen Cooperations Performing Spiritual Förderung Sponsor Redakteurin Artist Department Partner_  _ _
46 Johann Zugschwert Berufsfotograf
8010
Graz
Pressefotografie und allgemeine Fotografie, Landschafts- und Reisefotografie, freier journalistischer Mitarbeiter bei Kleine Zeitung..
zugschwert.at Posted Galerie Photos Zugschwert Johann Continue Allgemein Older Piloten Toblach Dolomiti Natur Ballonfahrten Mitglied Bennett Larr Air Gewo
47 Sem Musik

Professionelle Sängerin für besondere Anlässe - Hochzeiten, Taufen, Vernissagen etc. Wahlweise mit Pianobegleitung oder Halbplayback...
simply-sem.at Sandra Elisabeth Meinschad Media Galerie Projekte Leistungen Gala Licht Parkinn Facebooklinks Singer Writerkontakt +
48 willi huber gmbh natursteinhandel
6300
wörgl
granitsteine, Pflastersteine, terrassenplatten, natursteinplatten, brunnen, tröge, findlingströge, Palisaden, stelen, corten stahl, gartengestaltung, Figuren, Skulpturen, Feuerstellen, Randsteine, quarzitplatten, porphyrplatten, kalksteinplatten, travertinplatten..
hubernatursteine.at Galerie Brunnen Terrassenplatten Ausstellung Natursteine Wohlfühlen Waschbecken Palisaden Garten Mauersteine Koppen Trge Tiroler Werkhaus Mglichkeiten Ferdinand Umgebung Wohlfhlen Verarbeitungstechniken
49 Pop Art Künstlerin Tanja Kunst
5270
Mauerkirchen
Bilder - Kunst Bilder, Ölgemälde, Wandbilder, Kunst Deko, Kunstdrucke in limitierten Editionen oder Kunstdrucke in Fine Art open Edition. Bilder..
paint-art.at Kunst Kaufen Bilder Galerie Art Galerien Tanja Kunstwerke Exhibitions Pop Ausstellungen Playner Wien York Salzburg Vienna Saint Tropez Como Onex Australien
50 Harald H. Kaufmann Wirkliche Kunst
4160
Aigen im Mühlkreis
anders-dagmar.at Anders Dagmar Alfons Fine Galerie Art Offizielle Kunst Regisseurin Kunstmalerin Portraits Arts Bildhauerin Painter Artiste Kunstwerke Stilleben Atelieranders
51 Richard Wagner Konservatorium Musikausbildung
1120
Wien
Richard Wagner Konservatorium ist eine Institution, die sich im Bereich Musik auf die Befufsausbildung spezialisiert hat...
richard-wagner-konservatorium.at Wagner Richard Konservatorium Wien Abteilung Musikschule Studium Bewerbe Konservatoriums Mich Dozenten Galerie Aufnahme Wienerbergstraße Dozent
52 Thai Massage Neusiedl am Massagestudio
7100
Neusiedl am See
Die Original Thai Massage ist eine fernöstliche jahrhundertealte Massgeform, mit der man Körper und Geist wieder in Einklang bringt. Die..
thaimassage-neusiedl.at Massage Neusiedl Stone Lomi Thai Massagen Beauty Neusiedlat Galerie Ausprobieren Team Shiatsu Hauptplatz See Voranmeldung Entspannung
53 Messe Dornbirn Messeveranstalter
6854
Dornbirn
Messe Dornbirn - „Märkte live erleben“ Die Messe Dornbirn veranstaltet Publikums-, Fach- sowie Special Interest-Messen und vermietet ihre Infrastruktur ganzjährig..
messedornbirn.at Messe Dornbirn Bodensee Informationen Herbstmesse Intertech Frühjahrsmesse Gt Besucher Aussteller Ausstellern Dornbirner Schau Pressemeldung Gustav Hightech Foto Galerie Hocheffizientes
54 GALERIE ART5 Art
galerie-art5.at Art Galerie Presse Aktuell Services Office@galerie Artat Wientelbaden
55 Galerie Chobot Office@galerie
galerie-chobot.at Office@galerie Chobotatgironcoli Karl Chobotbruno Rennertz Manfred Galerie
56 Wir über uns Katalog
galerie-m.at Katalog Zufahrtsplan Seitenblicke Mat Uns Mmm@galerie Aktualisiert Mailmmm@galerie Webmaster Hinterholzkirchstetten Z
57 Startseite Deckensysteme Trockenausbau
dsp-pelzmann.at Trockenausbau Do Yourself Pelzmann Leistungen Galerie Deckensysteme Baustellen Homepage Firmalogin Logout Galerie Hier Arbeiten
58 GALERIE ULRIKE HROBSKY Galerie
galerie-hrobsky.at Galerie Ulrike Hrobsky Grundsteingasse Showroom Wien Young + Fax Wientel Art Hrobskyat Wwwhrobskyatoffice@galerie
59 [Edi´s Star Galerie] Star
Private Homepage...
edis-star-galerie.at Star Homepage Galerie Private Html Marina Gallery [edi´s Mark Skydesign Webdesign Galerie] Martinnockis
60 GALERIE ULRIKE HROBSKY Hrobsky
hrobsky.at Hrobsky Ulrike Galerie Showroom Grundsteingasse + Young Wien Wientel Fax Wwwhrobskyat Email Art Office@galerie Hrobskyat Y
61 Willkommen auf der Seite der Galerie Galerie
Galerie Lindengrün...
lindengruen.at Galerie Kunst Lindengrün Galerie@lindengruenat Möbel Kunstwerke Objekte Found The Map Apache Designport Bilder Server
62 Galerie Wien | Hans Staudacher | Galerie
Galerie Wien Neben Bildern der Klassischen Moderne befinden sich in unserer Galerie in Wien auch Werke...
galerie-kaiblinger.at Galerie Wien Helnwein Gottfried Staudacher Markus Prachensky Kaiblinger Bildern Office@galerie Kaiblingerat Hans Bilder Werke Schiele Klimtund
63 Johannes Kepler Haus Studentenheim Graz
Johannes Kepler Haus Graz Studentenheim Studentenwohnheim...
johannes-kepler-haus.at Graz Johannes Kepler Studentenheim Haus Lage Studentenwohnheim Rehgrund Galerie Anfahrt Galerie Leitung Unser Angebot Ffentliche Fahrt Heim Lageunser
64 HOME Future Growat Neuheiten
future-grow.at Neuheiten Videos Aktion Galerie Map Shop Infoshop Future Zkontakt Growat Growat Galerie| Home
65 Christine Tomaschek Home Christine
patchwork.at Christine Tomaschek Galerie * Meiner Weebly Persnlichen Galerie Home * Mich Create Tomaschek *linkswillkommen
66 Galerie Rhomberg Aktuell Galerie
Galerie Rhomberg Innsbruck...
galerie-rhomberg.at Galerie Rhomberg Innsbruck Aktuell Videos Ausstellung Jump Biografie Nobuyoshi Araki Rhomberg@galerie Rhombergat Kunst Kranebitter Content Server Y
67 NEFF NEFF BAU GmbH Neff
....
neffbau.at Neff Leistungen Galerie Baumeister Bau Firma Uns Galerie links Gmbhstartseite Rauchfangkopf Bauunternehmen Office@neffbauat Kaminkopf Familienhäusern Neuen Edelstahlkamin
68 Galerie und Kunsthandel Didier Morteveille Gemälde Didier
galerie-morteveille.at Didier Kunsthandel Objekte Galerie Morteveille Grafiken Moderne Zeitgenssischen Messen Editionen Ausstellungen Wien Gemlde Gemälde Kunsthandel@galerie Morteveilleat Archiv
69 KBO home Qualität
Die Pulverbeschichtigung KBO Ihr Pulverbeschichtigungsprofi bis 136m Die Vorbehandlung Die Pulverbeschichtung...
kbo.at Qualität Kbo Pulverbeschichtigung Leibnitz Traun Transport Zertifikate Verfahrenstechnik Leistungsspektrum Downloads Galerie Vorbehandlung Pulverbeschichtigungsprofi Unternehmen Standorte Galerie * Hohe Graz Zertifikate *
70 Gerhard Hornischer Startseite Biographie
Platz für Ihren Slogan...
geho21.at Biographie Gästebuch Hornischer Bildergallerie Galerie  Gerhard Kontak Kontaktformular Robert Webseite Galerie Webseite Auf Persönlich Meiner Y
71 Galerie Fröhlich | Home Galerie
Die Galerie in Linz...
galerie-froehlich.at Galerie Fröhlich Fritz Prof Linz Welcome Kunst@galerie Froehlichat Web Ziel Hinweise Kunst Werke Linzer Auswahl Besuchs Künstlers Schaufensterder
72 Rahmen Galerie Böck HOME Rahmen
galerie-boeck.at Rahmen Galerie Böck Einrahmungen Kostenlose Galerie * News * News Ankauf * Home * Uns * Restaurierungen * Uns Create Y
73 Home Joomla
Joomla the dynamic portal engine and content management system...
msc-mitterdorf.at Joomla News Videos Galerie Gästebuch News * Galerie * Dynamiccontent Videos * System Renntermine Management Templates
74 Home Radunion Unterland Ergebnisse
Willkommen auf der neuen Homepage von Radunion Unterland. Einige Rennen und Veranstaltungen werden von uns geplant und bestens...
ru-unterland.at Ergebnisse Veranstaltungen Verein Unterland Training Radunion Rennen Beitritt Bike Veranstaltungen * Vorstand Galerie Sponsoren Bärnbad Galerie * Beitritt * Pinzgau Werner Kids
75 Komm wir finden einen Schatz | Trailer
kommwirfindeneinenschatz.at Trailer Schatz Presse Komm Trailer * Galerie * Inhalt Inhalt * Galerie | Kino Gewinnspiel *kinofinder Finden
76 Home Svö
svoe-weyer.at Svö Galerie Hund Gästebuch Weyer Mensch Fischer Homepagepartner Copyright Bietet Gästebuch Bewundert Galerie Schaut Weyer Wir
77 Filzkunst einzigartig und stilvoll Filzkunst
bimbolino lädt ein zu einer Traumreise durch seine Zauberwelt. Seiten zum Stöbern und Staunen. Filzkunst Fotodesign Bildergalerie bimbolinos...
bimbolino.at Filzkunst Bildergalerie Atelier Gästebuch Bilder Märchenwelt Zauberwelt Filz Filzdesign Galerie filz Literarisches Traumreise Galerie Mich Fotodesign Conart Träume Hallo Soul
78 Sommer 1972 | Trailer Trailer
sommer1972.at Trailer Kinofinder Sommer Presse Lahmacun Lahmacun * Galerie * Galerie | Inhalt Trailer *inhalt * Z
79 Sommer 1972 | Trailer Trailer
sommer1972-derfilm.at Trailer Presse Sommer Kinofinder Trailer * Lahmacun Inhalt *galerie * Lahmacun *inhalt Galerie |
80 Energetikzentrum Kreuttal Startseite Leistungen
Platz für Ihren Slogan...
elisabeth-dolezal.at Leistungen Galerie Energetikzentrum Uns Kreuttal Kommen Galerie  Business Unterolberndorf_ Kontaktformular Bearbeitung Galerie_               Birkengasse Startseite *kreuttal_elisabeth
81 The BÃ¥nnskis Home Story
Wein Weiber und Gesang...
bannski.at Story Galerie Kontakt Band  Band Weiber Wein Bånnskis Gesanglets Bånnskis Since Setlist Rock Musik Galerie rock  the
82 galerie7 Z
galerie7.at Z Galerie Y
83 Galerie H Z
galerie-h.at Z Galerie Y
84 Galerie G Z
galerieg.at Z Galerie Y
85 Galerie bei der Albertina Galerie
galerie-albertina.at Galerie Albertinay
86 Galerie Ambiente Startseite Ambiente
galerieambiente.at Ambiente Galerie Y
87 Willkommen in der Galerie DNS Galerie
galerie-dns.at Galerie Dnsy
88 veronika schubert Veronikaportraitschubert
veronika-schubert.at Veronikaportraitschubert Galerie
89 Galerie Ambiente Startseite Ambiente
ambientegalerieambiente.at Ambiente Galerie Y
90 Welcome to my World Welcome
simeon.at Welcome World Galerie Homez
91 Home Home
illphil.at Home Galerie Archivy
92 galerie schaffererat Galerie
galerie schafferer.at...
galerie-schafferer.at Galerie Schaffererat Here Go Zclick
93 Autohaus Galerie Galerie
autohausgalerie.at Galerie Wwwgebrauchtwagenat Autohausy
94 galerie haslingerat Galerie
galerie haslinger.at...
galerie-haslinger.at Galerie Haslingerat Clickz Go Here
95 Galerie Ernst Fuchs Galerie
ernst-fuchs.at Galerie Fuchs Ernsty
96 aa galerie is coming soon Y
aa-galerie.at Y Coming Soon Galerie Aa Z
97 freie galerie Galerie
freie galerie wir stellen es aus....
freiegalerie.at Galerie Freie Stellenz
98 Gerberhaus Culturproduktionen Galerie
project-antonia.at Galerie Culturproduktionen Gerberhausz
99 Home Atelier Galerie
galerie-kautz.at Galerie Atelier Kautzz
100 TWICE Galerie
twice.at Galerie Downloads Audio Twice Z
101 Klavier Galerie Klavier
klavierwettbewerb.at Klavier Galerie Browserz
102 stnetat Reisen
stnet.at Reisen Galerie Stnetaty
103 Home Uns
mail2rh.at Uns Galerie Beispieley
104 Galerie Lang Wien Langwien
galerielangwien.at Langwien Galerie Ausstellungkommende
105 Galerie Lang Wien Galerie
glw.at Galerie Lang Wieny
106 Joannas Boutique Joannas
joannas-boutique.at Joannas Galerie Aktuell Boutiquez
107 Webad 2007 IAB Webad
webad2007.at Webad Galerie Gewinner Iaby
108 wwwbulliat Wwwbulliat
stauderer.at Wwwbulliat Tipps Galerie Flashplayerkontaktimpressumvideo
109 Stifta Geigenmusi Galerie
stiftageigenmusi.at Galerie Geigenmusi Musik Stiftauns Z
110 CS Galerie Salzburg Impressionen Galerie
csgalerie.at Galerie Salzburg Impressionen Cscopyright Z
111 Genoveva Kleider Genoveva
genoveva-kleider.at Genoveva Galerie Kleider Michy
112 Startseite cousinbaus Jimdo Page Leistungenunternehmen
cousinbau.at Leistungenunternehmen Galerie Cousinbauspage Jimdo
113 galerie webartat Galerie
galerie webart.at...
galerie-webart.at Galerie Webartat Here Zgo Click
114 Familie Klinglhuber home Klinglhuber
klinglhuber.at Klinglhuber Home Galerie Familiez
115 WeinSinn Personen
weinsinn.at Personen Galerie Weinsinn Seminarz
116 Galerie Baumgartner Ars Temporis Galerie
galerie-baumgartner.at Galerie Ars Baumgartner Temporisz
117 Home Galerie
tc-frannach.at Galerie Vorstand Bewerbenews Home * Z
118 galerie cafeat Galerie
galerie cafe.at...
galerie-cafe.at Galerie Cafeat Goz Here Click
119 GALERIE RULL BILLY Galerie
galerierull.at Galerie Rull Billybrowser Ihrem Z
120 Galerie vor Ort Galerie
galerievorort.at Galerie Ortvor Menü Z
121 manfred_fuerst Galerie
manfredfuerst.at Galerie Layout Manfred_fuerst Michz
122 Galerie Barina Barina
barina.at Barina Galerie Browser Ihremz
123 wwwkunstmesseat Galerie Manfred Kern Kern
kunstmesse.at Kern Galerie Wwwkunstmesseat Manfredz
124 art galerie quotstudio wienblickquot Galerie
art-wienblick.at Galerie Quotstudio Art Wienblickquotz
125 INTEC REPAIRS Home Galerie
intec-repairs.at Galerie Repairsnewsen Intec Philosophie Leistungen
126 Galerie Johann Widauer Works
widauer.at Works Artistsexhibitionswidauer Johann Galerie Contact
127 Gästebuch
akil-arabians.at Gästebuch Galerie Vomek Nachzucht Z
128 Lesya Radon Home Radon
Lesya Radon...
lesya.at Radon Lesya Galerie Partner Mich Z
129 Startseite Tiereamhof
grabenbauerhof.at Tiereamhof Angebotezimmerpreisereich Erlebnis Galerie Grabenbauerhof
130 wwwphotographic artat Galerie
photographic-art.at Galerie Alte Bilder Brillewwwphotographicrotcyan Artat
131 Tischlerei Maringer Tischlerei
tischlerei-maringer.at Tischlerei Maringer Unternehmen Leistungen Galerie Z
132 Herzlich Willkommen Willkommenauf
blumen-gasser.at Willkommenauf Herzlichfloristikunserer Grohandel Galerie Homepage
133 creativ plan Philosophie
creativ-plan.at Philosophie Leistungsbereiche Galerie Seiten Creativplan
134 Hunde
spirit-dogs.at Hunde Gästebuch Galerie Newsuns Z
135 Startseite Fine
fine-fabrics.at Fine Error Galerie Contracttextilverlag Visiterequest
136 remixx galerie günter eisenhut Günter
galerie-remixx.at Günter Remixx Galerie Eisenhutz
137 Nachtschwärmer Startseite Nachtschwärmeruns
divine-event.at Nachtschwärmeruns Galerie Mediaangebot
138 Acryl Messner Aktuell
brigitte-kunst.at Aktuell Acryl Messner Mich Galerie Z
139 Generationen
weinbau-karner.at Generationen Galerie Angebote Weineweinbaukarner@aonat Z
140 duschl art Galerie
duschl-art.at Galerie Duschl Jutta Artz Rechte
141 Galerie Maierhofen Martin Schreiner Maierhofen
Galerie Maierhofen...
galerie-maierhofen.at Maierhofen Galerie Schreinerz Copywebway Martin
142 Aktdesign by Andi Mairhofer Mairhofer
aktdesign.at Mairhofer Andi Galerie Aktdesign Besucherz
143 | Home Fotografin
manuela-ullmann.at Fotografin |hochklassigfokus Copyright Galerie Produkte
144 Schobergruppeat Galerie
schobergruppe.at Galerie Mitgliederurheberrechtshinweisuns Besetzungen Hörbeispiele Schobergruppeat
145 Dr Manon Der Petrossian Dr
der-petrossian.at Dr Petrossianpersonleistungen Galerie Terminvereinbarung Manon Ordination
146 Home Kirchen
hochzeitszentrum.at Kirchen Meierhof Galerie Anfahrt Video Partnerz
147 Brigitte Lewisch Home Lewisch
brigitte-lewisch.at Lewisch Brigitte Galerie Ausstellungen Aquarellemich Acryl Z
148 Galerie Sikoronja Obro
galerie-sikoronja.at Obro Sikoronja Galerie DoÅ liz
149 Wielton Wielton
wielton.at Wielton Galerie Angebot Agro Wieltonwerk Anfordernz
150 Elterninitiative Elterninitiative
handicap-kein-hindernis.at Elterninitiative Mitarbeit Galerie Projekte Partner Handicapunshindernis
151 Mario Matt Mario
mario-matt.at Mario Presse Erfolge Galerie Matt Kontaktz
152 Gasthaus Ackerwirt Galerie
ackerwirt.at Galerie Gaststuben Ackerwirt Geschichte Saal Gasthausz
153 Peer Alois Alois
peerlois.at Alois Zeitraffer Peer Wwwpeerloisat Galerie Wochenbilderbilder Z
154 Pferdesport Physio Mich
pferdesport-physio.at Mich Physiopferdesporttraining Zusammenarbeit Galerie Behandlung Physiotherapie
155 Galerie Anneliese Lanner Galerie
galerie-lanner.at Galerie Auswahl Anneliese Kleine Collagen Lannerz
156 willkommen bei fraumaierat | fraumaierat Fraumaierat
fraumaier.at Fraumaierat Area Main Contentz Portfolio Galerie |
157 GoldenIndex Ausflug
pferdeschlittenfahrten.at Ausflug Zuchtwintergoldenindex Galerie Sommer Peterneuper@pferdeschlittenfahrtenat
158 Willkommen auf der Seite von Michaela Michaela
remplbauer.at Michaela Remplbauer Lebenslauf Galerie Seite Maria Z
159 Scorebay Home Scorebay
scorebay.at Scorebay Konfiguratorz Austria Galerie Kontaktanfrage Ecotherm
160 Fotoservice TU Wien Wien
Fotoservice TU Wien...
fotoservice-tuwien.at Wien Galerie Fotoservice Tu Unserer Bilderz
161 SUE IMK Galerie
sue-art.at Galerie Shop Grafikdesign Sue Imk Bagsz
162 Niclas Anatol Niclas
niclasanatol.at Niclas Galerie Anatol Blog Biografie Anatolnavigationz
163 Die Mentaltrainerin Galerie
die-mentaltrainerin.at Galerie Literatur Hundetraining Mentaltrainerin Mich Mentaltrainingz
164 Erika G Johannsson Galerie Atelier Austria
leolab.at Austria Atelier Erika Galerie Johannsson Stainzz
165 Podium Zukunft Podium
podium-zukunft.at Podium Zukunft Veranstaltung Plattform Bericht Galerie Z
166 FRITZBILD Bild
bild-vom-fritz.at Bild Fritz Michhauptseitegallerie Galerie Fritzbild Foto
167 Paul Zurl Fotos
paulzurl.at Fotos Ausstellungen Paul Zurl Galerie Michz
168 The Globe Event Galerie
the-globe.at Galerie Konzept Event Globe World Danceworldmusic Z
169 Haar Diva 8211 by Bady Bady
haardiva.at Bady Diva Team Galerie Preise Haarz
170 Photography by Andrea Silvia Galerie
photoes.at Galerie Silvia Photography Andrea Mich Impressum Z
171 TeamWesensMitte Home Partner|innen
wesensmitte.at Partner|innen Teamwesensmitte Agbs Galerie Homez
172 Rudolf Budja Galerie Artmosphere Galerie
artmosphere.at Galerie Galerien Rudolf Artmosphere Budja Javascript Wwwartmosphereat Z
173 Miguel Henz gt Aktionartist Aktionartist
m-henz.at Aktionartist Philosophie Miguel Archiv Vita Galerie Henzgt Z
174 Asia Huy das feine Asia
asia-huy.at Asia Speisekarte Huy Galerie Restaurant Asiatische Homefeine
175 Karl Wenninger Video
karlwenninger.at Video Vita Theater Filmfernsehen Galerie Karl Wenninger Z
176 Werner Crew Crew
werner-crew.at Crew Werner Galerie Produktez Preise Youre Beautiful
177 Dorfwirt Enzenhofer Enzenhofer
dorfwirt-enzenhofer.at Enzenhofer Dorfwirt Speisekarte Galerie Chronik Rights Reservedz
178 Gesund Sein Bewusst Leben Gesundheitsmesse
gesund-bewusst.at Gesundheitsmesse Leben Galerie Eisenstadt Alternative Bewusst Gesund| Z
179 MoveOn Pilates Studio Pilates Training Studio
pilates-training.at Studio Pilates Training Wochenplan Galerie Ausbildung Moveonz
180 Alfred Kubin Galerie Kubin
kubin-galerie.at Kubin Serverfound Thealfred Found Apache Galerie Port
181 Pferdeportrait Galerie von Brigitte Kienreich Brigitte
pferdeportrait.at Brigitte Kienreich Galerie Fotovorlage Pferdeportrait Technikenpreise Copyrigth Z
182 Bilder Lore Zumtobel Startseite Lore
lorezumtobel.at Lore Zumtobel Bilder Anfahrt Galerie ©z
183 Werners Art Galerie Home Galerie
werners-art.at Galerie Werners Gästebuch Biografie News Copyrightart Z
184 cosimaat | home Cosimaat
cosima.at...
cosima.at Cosimaat Mich Flohmarkt Cosima Meinez Feunde Galerie |
185 Health
dentalhealthcare.at Health Care Dental Galerie Nanny Found The Pressebeauty Z
186 Willkommen beim Sterzfest Sterzfest
Das Sterzfest...
sterzfest.at Sterzfest Galerie Kirchenwirt Sterzwirte Sterz Kirchenwirtat Gastronomiewillkommenbeim
187 Startseite Fine
fine.at Fine Request Visitez Contract Error Galerie Textilverlag
188 Galerie Artconsulting Home Artconsulting
contempofineart.at Artconsulting Philosophycontact Profil Partnerdeutsch English Artist Galerie
189 Startseite Galerie Maier Maier
galerie-maier.at Maier Galerie Maria Theresien Palais Telefontrapp Innsbruck
190 Rottweiler Information Forum Chat Information
rotti.at Information Foto Galerie Shop Chat Forum Rottweileruvm Z
191 Anneliese Rauscher | Willkommen Anneliese
anneliese-rauscher.at Anneliese Rauscherillustrationen Galerie Portrait Altargestaltung| Ausstellungen Portfolio
192 Meise Architektur Meise
meise-architektur.at Meise Architektur Galerie Konzeption Biografisches Wohnberatung Entwurfy
193 Willkommen | VBFV Galerie
vbfv.at Galerie Permanently The|ergebnisse Links Uns Vbfv Wissenswertes
194 Person Port
haelge.at Port Apachehermann Gedanken Steidlperson Permanently The Server Galerie
195 The Next Fromberg
the-next.at Fromberg Jugend Videos Galerie Znext Gästebuch
196 Winden am See Galerie
windenamsee.at Galerie Wirtschaftvereine Kellerfest Windentourismus See Gemeinde Bärenfest
197 Galerie Artconsulting Home Galerie
galeriegetreidegasse.at Galerie Deutschcontact Partner Artistprofil Philosophy English Artconsulting
198 Startseite Haus
hoerbigerhaus.at Haus Location Galerie Hrbiger Wien Kontakthimmelstrae Hoerbigerhauspdf Z
199 Peter A Etzer Etzer
pae.at Etzer Peter Galerie Werke Ausstellungen Pa Englishy
200 Hubert Ebner Photographie Hubert
Hubert Ebner Photographie Bruck an der Mur...
ebnerhubert.at Hubert Photographie Ebner Admin Galerie Murz Bruck
201 wwwvasilikaat Home Highlights
vasilika.at Highlights Motivation Gästebuch Innenarchitektur Galerie Vasilikawwwvasilikaat Z
202 Hexen Baunkichen Baunkichen
hexen-baumkirchen.at Baunkichen News Galerie Hexen Chronik Sponsoren Aktuelly
203 Home Atelier
atelier-ursula.at Atelier Ursula Reservedz Galerie Rights Mich Copyright
204 Landjugend Brixlegg Zimmermoos Home Brixlegg
lj-brixlegg.at Brixlegg Landjugend Laquo Staudnfestfotos Mediares Galerie Zimmermoos Z
205 Galerie Sargant Galerie
galerie-sargant.at Galerie Sargant Kontaktwunschfragenanliegenz Umarbeitung Msargant@gmxat Email
206 FC Tarockierer Galerie
fctarockierer.at Galerie Wfv Website Mannschaften Tarockierer Partner Fc Z
207 Galerie Norbert Rathkolb Galerie
Galerie...
rathkolb.at Galerie Rathkolb Norbert Bildergalerie Michz Gästebuch
208 Startseite Margit Jirku Fotografie Jirku
margitjirku-fotografie.at Jirku Margit Galerie Fotografie Blazebit Entwickelt Michcopyrightleistungen
209 Die Welt der WCs Macromedia
daswc.at Macromedia Welt Sollten Betrachten Herunterladen Galerie Bittewcswwwfotographinat
210 Galerie Bibi Galerie
Bildergalerie...
pendel.at Galerie Bibi Forward Here Click Bilder Aquarellbildergalerie Kunst Z
211 Würstlstand Golosetti Würstlstand
wuerstlstand.at Würstlstand Rezepte Speisekarte Golosetti Galerie Unsz
212 index Galerie
doga.at Galerie Kundenihrerfamilie Ihrem Einfach Geschmack Tglich Naturell Haus
213 Galerie Mahler Wien Mailing
galeriemahler.at Mailing Join Wien Mahler List Galerie Kunstmaler Philippez
214 EMO Galerie Emil Oman Emil
emo-arte.at Emil Galerie Bleiburg Aichdob Oman Javascript Installieren Emoflashinstallieren Z
215 Box a Smile Photobooth Wordpress
boxasmile.at Wordpress Themesfaq Photobooth Elegant Galerie Box Warumsmile Angebot
216 index Zimmerweingut
Wein Kunst Zimmer...
plos.at Zimmerweingut Heurigen Baden Wein Vinothek Ploskunst Galerie Sooss
217 Unverblümt Schichtle Simone Schichtle Schichtle
Unverblümt Schichtle Simone...
unverbluemt-schichtle.at Schichtle Simone Unverblümt Altenmarkt Galerie Philosophiez
218 Q202 Q Atelierrundgangwer
q202.at Atelierrundgangwer Galerie Menu Webinfo Wannwo Presse Archivq Musik
219 Home ingridbeierat Ingrid
ingridbeier.at Ingrid Beier Angebote Ingridbeierat Galerie Ausstellungen Mischtechnik Acrylwwwingridbeierat Z
220 lupus corridor Lupusinlineframes
lupus-corridor.at Lupusinlineframes Corridors Konfiguration Corridor Bilderbogen Browserworkshops Mich Galerie
221 News Galerie
Trilogiecafe Franz Gmainer...
trilogiecafe.at Galerie Gmainerfranz Cafe Essen Weintrilogiecafe News Trinken Bistro
222 Golden Retriever Lucca Lucca
golden-lucca.at Lucca Retriever Golden Galerie News Gästebuch Browsergstebuch Z
223 Rottweiler Information Forum Chat Shop
rotweiler.at Shop Information Foto Galerie Chat Rottweiler Forum Uvm Z
224 Kingsport Kingsport
kingsport.at Kingsport Training Gesundheit Angebot Galerie Bewegung Mich Personalzielezuhause
225 MV Neidling Mv
mv-kremnitztaler.at Mv Neidling Galerie Geschichte Intern Gästebuchkremnitztal Kontakttermine
226 True Nails Preisliste
truenails.at Preisliste Galerie True Aktionen Leistungen Nails Headerz Table
227 Henrys Hundeschule Hundeschule
Hundeschule für alle Rassen...
henrys-hundeschule.at Hundeschule Henrys Nachrichten Anfahrt Galerie Entstehung Tirolrassen Navigation Z
228 Galerie Traunsee Galerie
galerietraunsee.at Galerie Kurzbiographie Aktuell Traunsee Technik Kinderbuch Milleniumsuhr Besichtigenz
229 Alfred Rauch Rauch
alfredrauch.at Rauch Alfred Kulturmanager Galerie Vita Schauspielersängerz
230 Tischlerei Moser Moser
tischlereimoser.at Moser Produkte Tischlerei Angebote Stellenangebote Planungen Galerie Uns|
231 Startseite | timeforfashion Kucharz
timeforfashion.at Kucharz Inhalt Marken Direkt Galerie English Fashionz Timeforfashion |
232 MB Events DER Partyveranstalter Event
partyevent...
mb-events.at Event Galerie Party Mb Events Home Partyveranstalter Technikbuchen Z
233 Kunstverlag WOLFRUM Wolfrum
Kunstverlag Wolfrum Buchhandlung Kunsthandlung Galerie...
wolfrum.at Wolfrum Kunstverlag Galerie Buchhandlung Kunsthandlung Lobkowitz Palais Webdesignz
234 Tattoostudio Contact Tattoostudio
Tattoostudio steyr website...
tattoostudio-steyr.at Tattoostudio Steyr Studio Galerie Location Contact Website Tattooaltgasse Z
235 Kreativideen Margit Mayr Kreativideen
kreativideen.at Kreativideen Mayr Galerie Margit Biographie Mich Dinge Angeboteseeleschnheit
236 Home | Holzmagier MEC Steinschnak Holzmagier
holzmagier marco steinschnak...
holzmagier.at Holzmagier Steinschnak Mec Marco Holz | Zeitlosigkeit Ausstellungenz Galerie
237 Kleine Villa Kunterbunt Start Kleine
kleinevillakunterbunt.at Kleine Villa Kunterbunt Galerie Paten Bahnhofstraezentrum Pippi@kleinevillakunterbuntatpitten Z
238 Home Produkte
radundnabe.at Produkte Portapache Galerie Gästebuchfound The Found Server Unternehmen
239 Melodium Peuerbach Melodium
Website des Kulturzentrum Melodium...
melodium.at Melodium Peuerbach Kulturzentrum Ausstattung Galerie Anfahrtdownloads Website Bilderkalender
240 peter sengl Galerie
Figurative Malerei Druckgrafik Grafik Bilder Galerie Deschler Galerie Walker...
petersengl.at Galerie Grafik Bilder Deschler Walker Figurative Malerei Druckgrafiksenglpeter
241 Galerie der Freischaffenden Galerie
galerie-der-freischaffenden.at Galerie Freischaffenden News Ausstellungen Wedenig Newsdie Geschlossen Zukunftbesucheundinteresse
242 andinet Willkommen Andinet
andinet.at Andinet Arcsinblog Gästebuch Permanently The Galerie Willkommen Changelog
243 index Hongkong
lightwish.at Hongkong Juventus Sturm Neuseeland Copyright Galerie Websiteandreas Cervinka Z
244 Maria v Ohmeyer akad Malerin 1896 Ohmeyer
Maria v. Ohmeyer akad. Malerin 1896 1983...
ohmeyer.at Ohmeyer Maria Malerin Akad Galerie Nachtwächterhausweinstadtpoysdorf
245 Luise Muschailov Stimmungsbilder Stimmungsbilder
Luise Muschailovs Stimmungsbilder...
stimmungsbilder.at Stimmungsbilder Luise Muschailov Galerie Mich Werkelaus Muschailovs Keilrahmen Z
246 Steirerbike Steirerbike
Steirerbike das steirische Bike...
scherz-bikes.at Steirerbike Radprogramminternationale Galerie Auszeichnung Steirisch Made Bikesteirische Anzeige
247 Galerie Mire Galerie
galerie-mire.at Galerie Mire Grazer Leibnitz Gasse Office@galeriewebseite Mireatentsteht
248 TANGO LINZ Tango
tango-linz.at Tango Kursejomo Workshops Linz Galerie Uns Vereinsanmeldungmilonga Powered
249 DASCHKARIA | Werkstatt für biophiles Design Design
daschkaria.at Design Biophiles Neues Galerie Daschkaria Produkte Werkstatt Team |z
250 GERDA ANKELE Aquarelle und Gerda
gerdaankele.at Gerda Ankele Ausstellungen Gouachen Galerie Biografie Aquarellegelassenheit_ Gouachen_ Z
251 Treiber Galerie Schauplatz treibergalerie Galerie
hermeling...
treiber-galerie-schauplatz.at Galerie Schauplatz Hermeling Presse Monats Treiber Angebottreibergalerie Uns Z
252 Achenseer Museumswelt Home Achenseer
achenseer-museumswelt.at Achenseer Museumswelt Museumsbereiche Gästebuch News Informationmitglieder Galerie Z
253 Roedler Roedler
roedler...
meisterroedler.at Roedler Leistungen Shui Galerie Threatlabs Feng Logincopyrightcavg Uns
254 Sensenwerk Deutschfeistritz Sensenwerk
sensenwerk.at Sensenwerk Deutschfeistritz Theatermuseum Altweiber Musik Galerie Walpurgisnacht Veranstaltungsmarkt
255 index Skigebieten
h-regina.at Skigebieten Link Galerie Ausstattung Preisliste Gstebuchwegweiser Gästebuch Z
256 Home Tischlerei Walter Walter
tischlerei-walter.at Walter Tischlerei | Found Galerie Port Apachefound The Mitsunobu Server
257 Wuxelweb Willkommen Wuxel
r-bahr.at Wuxel Wuxelweb Wuxelbildern Beispiel Galerie Robert Colorierte Einigenwuxelwebatbahrs
258 Seite 1 Website
nwerle.at Website Vigiliakomplimente Galerie Werlemmata Theologischevanitas Werle Parerga Nikolaus
259 Die Galerie Galerie
Galerie am Hofsteig...
galerieamhofsteig.at Galerie Hofsteig Kunstinvestmentverkauf Team Künstler Am Anfahrtuns Rundgang Kunstwerke
260 GoCadat Visualisierung Planung Objekt
gocad.at Objekt Raum Planung Kontaktimpressum Licht Visualisierung Gocadat Galerie Skizzenblogz
261 lomado Galerie
lomado.at Galerie Foto Lomado Management Partner Freunde Unsermusiktanzband Programm Jung
262 Stadlfest St Marein Stadlfest
Stadlfest St. Marein...
stadlfest.at Stadlfest Marein St Galerie Premoat Gästebuch Gstebuchknittelfeld Uns Z
263 Home | Katschberg Appartements Lage
katschberg-appartements.at Lage Anfahrt Galerie Grundrisse Katschberg Anfrage Appartements |wwwkatschbergappartementsat Mail
264 Golf Club Wien Club
Willkommen im Golf Club Wien...
gcwien.at Club Golf Wien Sport Galerie Platz Turniere Restaurant News Z
265 Boogie Woogie Club Stockerau Gerhardschneider@kikaat
boogiewoogie-stockerau.at Gerhardschneider@kikaat Galerie Woogie Ueber Boogie News Stockerau Clubunskontakt
266 Cinema Dornbirn Cinema
cinema2000.at Cinema Dornbirn Kino Wochenbersicht Preise Tagesprogramm Galerie Demnchstaktuell Agb Z
267 Urban Dance Theatre Innsbruck Urban
urbandancetheatre.at Urban Theatre Dance Nutzungsbedingungen Programm Artists Galerie Innsbruck Udtrechte Z
268 galerie web artat steht zum Verkauf Galerie
galerie-web-art.at Galerie Web Artat Domain Steht Wunschdomain Domainkaufkaufen Treuhandserviceverkauf Erwerben
269 Startseite | Ing Christian Schaufler Bau Schaufler
schaufler-bau.at Schaufler Bau Christian Ing Uns Galerie Schober Anfrage | Leistungenwebseite Z
270 Marion Fessl Fessl
fessl-art.at Fessl Marion Beendeten Ausstellung München Galerie Quotmysteriumquot Kunstgiessereiderkunstgiesserei
271 Imagine Verein für Kulturanalyse Imagine
My Website...
imagine.at Imagine Kunstraum Verein Kulturanalyse Galerie Aktivitäten Macfluxwebsite
272 Mass Schneiderei GUSEL Home Gusel
schneiderei-gusel.at Gusel Schneiderei Mass Lageplan Galerie Gästebuch Katschrgschneidereigusel@aonat
273 Cinema Dornbirn Dornbirn
cinema-dornbirn.at Dornbirn Cinema Programm Demnchst Galerie Kino Preise Aktuell Agbz
274 Leosch Leosch
Stahl und mehr...
leosch.at Leosch Galerie News Stahlcolor Rights Reserved Steel Eupowered Homac
275 CARMETIC Kosmetik für ihr Carmetic
triax-digital.at Carmetic Kosmetik Fahrzeug Preise Leistungen Galerie Kürzeihr Homepage Z
276 Der Glasgarten Wildburger Glasgarten
glasgarten-wildburger.at Glasgarten Presse Galerie Wildburger Office@atelier Allmendewegwildburgerat Fax Rankweil Z
277 Servizio 8211 Vespaland Vespaland
vespaland.at Vespaland Servizio Anfahrt Menü Hide Galerie News Menuz
278 massi milano Milano
MASSI MILANO FASHION MODE...
massimilano.at Milano Massi Fashion Galerie Kollektion Filialen Mode Wien Herrenhemdenherrenmode
279 Galerie Zauner Kunst
Galerie für moderne Kunst...
galerie-zauner.at Kunst Galerie Zauner Moderneausstellung Pernkopfleonding Linz Schmuckdesign Gegenwart Christa
280 Gerhard Klein Buchungsanfrage
Triesterstrasse 237 A 1230 Wien 0676 413 74 23 office@gerhardklein.at www.gerhardklein.at...
gerhardklein.at Buchungsanfrage Gerhard Galerie Mich | Klein Office@gerhardkleinatwien| Wwwgerhardkleinattriesterstrasse Pixelcloudat
281 CHRISTIAN MARSCHNER | Technisches Büro für Technisches
CHRISTIAN MARSCHNER Technisches Büro für Innenarchitektur...
marschner-innenarchitektur.at Technisches Marschner Christian Büro Innenarchitektur | Galerie Unternehmenpartner Review Z
282 Start Dr Kremer Eveline Galerie
None...
drkremer.at Galerie Leistungen Login Kremer | Eveline Evelinestart None Start Kontakt Dr
283 Martina Willmann Kochkurse Kochkurse
willmannkochen.at Kochkurse Foodstyling Presse Willmann Kochen Galerie Rezepte Martinawebseite Rsaquo Z
284 H W H A T Events
handwerkshaus.at Events Galerie Firmen Handwerkshaus Server Oberndorf Foundanfahrtport Found The Apache
285 diemalerin Diemalerin
diemalerin...
diemalerin.at Diemalerin Teamwork Leistungsangebot Galerie Brinckmann Lebenszeichnung Farbe Ernstfreude Gustav
286 Die Entspannten Inlineframes
dieentspannten.at Inlineframes Entspannten Galerie Gästebuch Wannz Warum Browser Hause
287 Homepage Alphorn Alphorn
stubaier-alphornblaeser.at Alphorn Homepage Galerie Zuverschiedenen Alphornweisenstubaitalanfrage Spielen Anlässen
288 Roedler Roedler
roedler...
xn--rdler-jua.at Roedler Leistungen Shui Feng Galerie Threatlabs Copyrightc Login Unsavgkontakt
289 Energie Quellen Energie
energie-quellen.at Energie Quellen Aromaöle Mwol Galerie Uns Agbhaftungsausschluss Z
290 Roedler Roedler
roedler...
xn--meisterrdler-cjb.at Roedler Feng Threatlabs Shui Leistungen Galerie Avg Copyrightclogin Uns Z
291 ertelhalja Herzlich Willkommen Lebenslauf
halja.at Lebenslauf Galerie Ausstellungen Herzlich Ertel Ertelhalja Webseitecopyrightmalerin Designed Halja
292 Home havana cocktailbar Offers
havana.at Offers Reservierungen Galerie Special Navigationwo überspringen Unshavana Cocktailbar
293 Technologie Sammel und Museumsverein Salzburg Salzburg
technologiesammler.at Salzburg Museen Technologie Sammel Geschichte Sammler Museumsverein Galerie Zsonderausstellung
294 kolorit Wien
kolorit.at Wien Post Kolorit Heumarkt Office@koloritatz Schlenthergasse Galerie Telfax
295 Helene Schorn Künstlerin Helene
heleneschorn.at Helene Film Schorn News Künstlerin Kalender Ansehenatelierdownload Galerie
296 Hermann Haase*index Hermann
haase-hermann.at Hermann Malerbildhauer Galerie Holzbildhauer Kunstmalerhaase*index Webdesigner Kunstgestalter Kuenstler
297 Slideshow 2 Michaela
patrickbaumueller.at Michaela Slideshow Galerie Stock Rothkrebschen Clubblumen Speakerscorner Wursthabererpatrick Baumller Z
298 Startseite Video
hannavictoriabauer.at Video Galerie Vita Theater Filmtv Theaterpädagogik Audioy
299 GALERIE erlas creativ gmbh Galerie
erlas.at Galerie Kunstlagercreativ Baukultur Ausstellungen Erlas Fotografie Künstlergebrauchsdesign Kreativarbeit
300 Steirerbike Steirerbike
Steirerbike das steirische Bike...
steirerbike.at Steirerbike Bike Made Internationale Steirische Auszeichnung Steirisch Galerie Radprogrammanzeige
301 Wuxelweb Willkommen Wuxel
wuxelweb.at Wuxel Wuxelbildern Beispiel Wuxelweb Galerie Wuxelwebat Bahrs Einigenrobert Colorierte Z
302 Michael Gindl Weinviertel | Galerie Michael
4ergindl.at Michael Gindl Galerie Apacheweine Weingut Server | Aktuellpermanently The Port Weinviertel
303 Homepage Fair
RACEWORLD Modellautosammlung Andrew Fair...
raceworld.at Fair Andrew Homepage Automobilia Modelle Impressumkontakt Raceworld Galerie Modelleautosmodellautosammlung Z
304 DD Cocktail Bar Cocktail
cocktailbar-dd.at Cocktail Bar Dd Cocktailbar C Reserved * Copyright Rights Zevents Galerie
305 Neuhaushof Neuhaushof
neuhaushof.at Neuhaushof Brennereiunser Zimmer Anreisehaus Schmankerl Almhütte Galerie
306 Start Restaurant Pizzeria Modena Pizzeria
pizzeriamodena.at Pizzeria Speisekarte Login Galerie Modena Uns Impressum Start|restaurant
307 Willkommen bei der Tischlerei Hausensteiner Tischlerei
hausensteiner.at Tischlerei Planung Hausensteiner Galerie Umsetzung Holzverarbeitung Ecgwillkommenhand Veranstaltungen Tischler
308 Willkommen auf wwwholzschlaegerungat Holzschlägerung
Holzschlägerung Aster Der Profi im Forstbereich...
holzschlaegerung.at Holzschlägerung Videoteam Profi Forstbereichaster Unternehmen Wwwholzschlaegerungat Galerie
309 hautzentrumat Hfner
xn--hfner-jua.at Hfner Kundenmagazin Shop Zentrum Galerie Reinhard Hautzentrumat Gesundheitsthetikschnheit Einfach
310 Beatique Beatique
Unikatschmuck von Beatique...
beatique.at Beatique Schmuck Wienunikatschmuck Galerie Silber Vision News Goldunikat Design
311 Startseite cart Archiv
c-art.at Archiv Künstler Vorschau Galerie Editionen Prantl Boch Ausstellung Cartprantlcart Z
312 Pressekarten
stiftskonzerte.at Pressekarten Verein Künstler Team Archiv Hörprobenprogramm [] Kontaktformular Galerie
313 Buddhistisches Zentrum Scheibbs | Eine e Zentrum
bzs.at Zentrum Anfahrt Preise Galerie Veranstaltungen Scheibbs Buddhistisches Buddhismus Mitgliedschaft Wordpress| Z
314 fernitzgrafik | hier drucken profis | |resch
fernitzgrafik.at |resch Grafik Galerie Profis Produkte Fernitz Drucken Fernitzgrafikat Gtgtgt Fernitzgrafikdazu
315 Anna Ballwein Anna
Anna Ballwein...
ballwein.at Anna Ballwein Anfahrt Galerie Gästebuch Album Biographiepöchlarnwiener
316 Start TG Security GmbH Events
None...
tgsecurity.at Events Login Mitarbeiter Leistungen Ausbildung Galerie Start Security Gmbh Unsnonetg
317 BEST AGE CONSULTING Ueber uns Uns
best-age.at Uns Abcconsulting Galerie Ueber Projekte Age Leitbild Team Best Agbsunternehmen Angebote
318 REITERHOF NAPOLEON Deutsch Wagram Deutsch
reiterhof-napoleon.at Deutsch Reiterhof Wagram Napoleon Anlage Letzte Aktualisierung Galerie Western Preiseleistungen Z
319 Jenny Gazelle Travestie aus Gazelle
lamirage.at Gazelle Jenny Presse Travestie Showprogramm Galerie Weststeiermark Markushieger Michdesign Fotos
320 DJ LJ SchaWo Schawo
schawo.at Schawo Dj Inhalt Equipment Mantra Galerie Lj Poweredby World Wordpress Z
321 home Glas
gabriela mayrhofer textil glas kunst design workshop glasperlen...
gabriela-mayrhofer.at Glas Textil Workshop Glasperlen Gabriela Galerie Design Mayrhofer Kunst Cv_kontakthomeprojekte
322 Galerie Mondsee Galerie
galerie-mondsee.at Galerie Steine Shop Mondsee Uhren Schmuck Trauringe Design Künstler Y
323 GF Bau GmbH Gf
GF Bau Gruber Franz Bauunternehmen...
gf-bau.at Gf Bau Bauat Galerie Gruber Franz Bauunternehmen Unsereruns Website Cgfbau
324 Rallye Beifahrer Christoph Friesenegger Christoph
rallye-beifahrer.at Christoph Rallye Beifahrer Friesenegger Gästebuch Fuhrpark Newsfahrergeschichte Ifahrer Galerie
325 Schnitzkunst Schnitzkunst
schnitzkunst.at Schnitzkunst Nr Johann Haibachz Ledermüller Tel++mobil Galerie
326 Afghane Gino Old Shatterhand Gino
Gino stellt sich vor...
afghane-gino.at Gino Afghane Shatterhand Old Bethsheba Letzten Galerie Fotos Ausstellungsergebnisse Disclaimerstellt Neuigkeiten Z
327 Home Doppelpack
wm-pongau.at Doppelpack Anmeldung Video Galerie Aussteller Ansehen Gfrererat Wohnenthistischlerei Info@remove Z
328 SPLENDID bar italia Getränke
splendidbaritalia.at Getränke Speisen Splendid Galerie Weinkarte Italia Seiten *z Bar
329 traude kling | malen Wien
traude kling malen aquarell acryl wien bali galerie ausstellung kunst wien...
aquarell.at Wien Traude Malen Kling Acryl Bali Galerie Kunst Ausstellung Aquarellsehnsuchtmeine |
330 Sophie Berger | Theater | Musical Berger
sophie-berger.at Berger Sophie Film | Demo News Musical Galerie Theater Vita Designtigerwebdesigndesigntigerwebdesign
331 L O K A L M Anfahrt
lokalmueller.at Anfahrt Specials Galerie Philosophie Zeiten Essen Trinken Unsz Kochen ü
332 hautzentrumat Hfner
hautzentrum.at Hfner Galerie Shop Zentrum Reinhard Kundenmagazin Einfachgesundheit Hautzentrumat Sthetik Schnheit
333 Startseite Link
brand-art.at Link Lebenslauf Galerie Ausstellungen Künstlerischer Farberights Reservedcopyright Homepage Meiner
334 Haus Marlies am Keutschacher See Haus
hausmarlies.at Haus Keutschacher See Foto Galerie Route Marlies Toplage Englisch_hausmarliespdf German_hausmarliespdfltlt Gtgt Z
335 Residenz Zillertal Zillertal Joomla
Joomla the dynamic portal engine and content management system...
zillertal-residenz.at Joomla Residenz Zillertal Portalengine Content Lifestyledynamic Management System Anmeldung Galerie
336 home Sirisshow
SIRIS Welcome to the SHOW...
siris.at Sirisshow Found The Apache Band Welcome Guestbook Downloadsfound Playlist Server Galerie Port
337 Home dilettantens Webseite Z
dilettanten.at Z Permanently The Webseite Port Galerie Dilettantens Apache Anfahrt Uns Serverstadttheater Gespieltes
338 Appartements Ferienzimmer | Haus Helpferer Appartements
haus-reiter-helpferer.at Appartements Helpferer Reiter Ferienzimmer Haus | Appartementabendsonne Kontaktlagezimmer Galerie Preise Wordpress
339 MFC Bruchpiloten Kemeten Intern
bruchpiloten.at Intern Mitglieder Veranstaltungen Galerie Videos Bruchpiloten Kemeten Uns Sponsoren Kemetenhauptmenmfc Z
340 Wilfried
hedenborg.at Wilfried Hedenborg Hedenborgswilfriedkazuki Music Safari Bottle Copyrightblog Mozillafirefox Galerie Wine
341 Margit Amon Garser
margitamon.at Garser Portrait Margit Amon Christkindlmarkt Galerie Werke Kontakt Ausstellung Besuchenhomeuhr
342 Homepage Patrizia Rausch Foto
patrizia-rausch.at Foto Galerie Rausch Homepage Sponsoren Patrizia Wrgl Gästebuch Gstebuchbesucher Z
343 Burgenland singt Willkommen Burgenland
burgenlandsingt.at Burgenland Notendownload Singt Projekte Galerie Jahresprogramm Veranstaltung Schickenwillkommen Volkskultur Homepage Z
344 Atelier Paul Joachimsthaler Paul
Galerie Paul Joachimsthaler...
joachimsthaler.at Paul Joachimsthaler Galerie Atelier Bilder Zeichnungen Biografie Zmedia Tp Kontakt
345 2 Rad Breinlinger Breinlinger
2rad-breinlinger.at Breinlinger Halleinrad Bikes Motorrad Galerie Salzachtalstrasse Fax Klug Newszweirad Veranstaltungen
346 Helene Schorn Künstlerin Helene
helene-schorn.at Helene Film Schorn Künstlerin Galerie Kalender Atelier Download Newsansehen Z
347 fotostudio |1 Copyright
fotostudio1.at Copyright Hinweis Galerie Tiere Models Länder Office@fotostudioat|fotostudio
348 Damen Friseur Sibel 983 85 Sibel
damenfriseur sibel Damen Friseur Sibel Friseur Sibel...
friseursibel.at Sibel Damen Friseur Preisliste Leistungen Damenfriseur Galerie Aktion Frieurwien Uns Z
349 Web Galerie wo die Kunst
kunstsammlung.at Kunst Galerie Begegnung Netscape Wo Dieser Web Browserstattfindet Anzeigerahmenerung Text
350 Malerei Ganglberger Sgraffito Dekorationen Sgraffito
sgraffito.at Sgraffito Malerei Ganglberger Dekorationen Fassaden Bilder Galerie Leistungen Informationenganglberger *unternehmen
351 Fam Pichler Häring Pichler
pichler-haering.at Pichler Häring Fam Harald Hochzeit Rechte Uns Familiez Galerie
352 Rupp Temper Temper
rupp-temper.at Temper Persönlich News Rupp Team Galerie Rennkalender Gehtssponsoren Z
353 crossfit innsbruck Wod
crossfit-innsbruck.at Wod Crossfitinnsbruck Found The Port Partner Galerie Apache Stundenplan Agbs Foundserver
354 VitaminB Booking Die gesunde Website
vitaminb-booking.at Website Vitaminb Booking Galerie Paradise Myspace Alternative Toursoon Relaunch Gehtsquotgoodbye
355 lebzelterei kerner Galerie
lebzelterei-kerner.at Galerie Lebkuchen Unser Torten Konditorei Sortiment Uns Cafeacutecaf Lebzelterei Kerner Z
356 Z
kitcar.at Z Fury Konfiguration Gebrauchte Faschi Inlineframes Besucher Daten Galerie Browserumbaustatus Forum
357 Willkommen in der Steyrdurchbruchhütte Galerie
steyrdurchbruch.at Galerie Speisekarte Steyrdurchbruchhtte Anfahrt Region Email Steyrduchbruchhttesteyrdurchbruchhütte Leonstein Z
358 fizidux Z
fizidux.at Z Grafik Fizidux Kunst Server Galerie Art Malerei Found Portfound The Apache
359 Willkommen bei Bioenergie Gtgtanfrage
energiepartner.at Gtgtanfrage Office@bioverdeat Galerie Heizwerke Leistungen Home Wasser Bioenergiewind Uns
360 coro siamo Z
corosiamo.at Z Presseinfo Coro Siamo Sponsoren Pressestimmen Chronik Mitsingen Sponsor Konzertekontaktinformation Galerie
361 Willkommen RC Hofmühlen Hofmühlen
reitstall-linz.at Hofmühlen Galerie Anlage Rc C Created Schmidinger Rights Designreserved Z
362 Eiscafefreezer Eiskarte Eiskarte
Eiscafefreezer Mattighofen Italienisches Eis Der Eissalon mit dem hausgemachten Eis google...
eiscafefreezer.at Eiskarte Eis Eiscafefreezer Galerie Italienisches Speisengetrnke Mattighofen Special Eiserzeugung So Gelattieiscafeffnungszeiten
363 index Magix
evis-handarbeiten.at Magix Made Fivolitocchitatting Arbeiten Jahre Galerie Handarbeiterin Handarbeit Stckhomepage Wissen
364 AMARTIS kunst + edition Kunst
AMARTIS kunst + edition in wien ......
amartis.at Kunst Amartis Edition Wien Verlag + Vermittlung Beschreibungliebe Gloriettegasse Partner Galerie Z
365 Kinderhaus Langenzersdorf Startseite News
kinderhaus-langenzersdorf.at News Galerie Philosophie Kinderhaus Navigation Langenzersdorf Fördereruns überspringen Z
366 Information Innenausbau | Omelan Information
innenausbau-omelan.at Information Innenausbau Pluck Css Admin Omelan Galerie Templates Nodethirtythreez Free |
367 Tischlerei Lechleitner Tischlerei Lechleitner Tischlerei
tischlerei-lechleitner.at Tischlerei Lechleitner Wohntrume Tischlerqualitttrumen Handwerk Galerie Produkte Arbeitgeben Unseinblick Erleben
368 StadtLandFluss Stadtlandfluss
stadtlandfluss StadtLandFluss...
stadtlandfluss.at Stadtlandfluss Chat Nachrichten Galerie Spiegelonline Email Bilder Login Wechsel Zbirgit
369 Residenz Zillertal Zillertal Joomla
Joomla the dynamic portal engine and content management system...
residenz-zillertal.at Joomla Zillertal Residenz Content Dynamic Anmeldung Managementsystem Engine Lifestyleportal Galerie
370 FORM L Interiors Innenarchitektur Architektur
FORM L Interiors Innenarchitektur Architektur und Möbeldesign aus Thalheim bei Wels...
form-l.at Architektur Möbeldesign Innenarchitektur Interiors Galerie Form Person Brands Thalheimreferenzwels
371 MYTHOREALISMUS Mythorealismus
Mythorealismus als Architektur...
mythorealismus.at Mythorealismus Architekturapache Archiv Mytho Architektziviltechnikermytho Realismus Port Realpermanently The Galerie Server
372 ICôNE DESIGN | Galerie Design
iconedesign.at Design Galerie Icône Lebenslauf Malerei Leistungen Grafikillustration|
373 GALERIE CHRISTIAN HOSP Galerie
galerie-christianhosp.at Galerie Hosp Exhibitions Gallery Artists Ausstellungen Christian Künstlerunless Galeriechristianknstler
374 sanja jelic Fotos
sanja.at Fotos Sanja News Galerie Collagenalles Prominier Cover Fotografien Jelicplakate Reiseberichte
375 Web Galerie wo die Begegnung
webgalerie.at Begegnung Kunst Galerie Textanzeige Dieser Browser Stattfindet Netscape Web Worahmenerung
376 Andrea Edler Home Edler
andreaedler.at Edler Andrea Natur Galerie Mensch Abstrakt Architektur Aktuell Biographie Contenthome Z
377 Klang Atelier Klang
Klang Atelier...
steinko.at Klang Atelier Serverpermanently The Wirkung Galerie Preise Apache Klangatelier@steinkoat Klangmassageport
378 Luftbildservice Redl Redl
luftbildservice.at Redl Luftbildservice Galerie Technik Produkte Leistungen Video Gebiet Animationen Dokumentation Luftbilddokumentationen
379 Klassik in den Alpen Tickets
nbsp...
klassikindenalpen.at Tickets Hausordnung Galerie Künstler Klassik Programm Presse Agbalpen Alpen * Nbsp Z
380 x33xat SPORT Sport
x33x.at Sport Natur Art Galerie Kontaktieren Uns Dirndl News Windsurfing Sailing Xxat Z
381 Allram Mobilheime und Gartenhäuser Tischlerei Meisterbetrieb Mobilheime
frewo-mobilheime.at Mobilheime Gartenhäuser Prospektpreisliste Galerie Waldviertel Tischlerei Langaumeisterbetrieb Allram Tischlerleistungen
382 MT Medien Home Anfrage
MT Medien Werbeagentur Filmproduktion Personaltraining...
mtmedien.at Anfrage Mt Medien Werbeagentur Filmproduktion Galerie Personaltrainingschenken Kreativitäthome Freude
383 Jolanda Thalhammer Thalhammer
jolandathalhammer.at Thalhammer Jolanda Künstlerische Galerie Entwicklung Adresse Kärnten Steindorfz Sallach
384 Ihr Hausbetreuer Home Joomla
Joomla the dynamic portal engine and content management system...
hausbetreuung-zoechling.at Joomla Login Jobs Hausbetreuer Hausbetreuung Galerie Engine Unternehmen Dienstleistungensystemihr Dynamic Angebote
385 Illustration und Comic Comic
heinzwolf.at Comic Wolf Illustration Heinz Publikationen Neues Galerie Jimdo Logoutbearbeiten Bio Druckversionlinks
386 Cabanova
club-excited.at Cabanova Sponsoren Galerie Club Disclaimer Gästebuch Treffen Adresse Markenoffenenclubmail Powered Z
387 Familie Schwaiger Schwaiger
Homepage der Familie Schwaiger...
at-schwaiger.at Schwaiger Familie Dcarter Galerie Mozilocms Apacheeriksalzburg Hans Homepage Port Marlene Server
388 Startseite provitalis Webseite Provitalis
provitalis.at Provitalis Unser Shop Angebot Galerie Publikationenpresse Reisen Webseite Tipps Jimdo Logoutprovitalisatedeltrud
389 Beart Homepage von Beate Ausstellungen
buntebilder.at Ausstellungen Kunst Lukas Wernhart Schmunzeln Pawek Beart Galerie Beate Homepage Michpressecodingkontakt
390 Stainless Design Welcome Pool
pool4you.at Pool | Design Welcome Edelstahl Stainless Galerie Unternehmen Technik Material Wasser Standortfilteranlage Abdeckung
391 Victor Schupfer Atelier Galerie K2 Victor
vic-art.at Victor Schupfer Atelier Galerie Lifestyle Tipps Uhr Insider Herzen Sierningvereinbarung Kunst Z
392 Keramikatelier Ne382ika Agnes Novak Novak
novakart.at Novak Keramikatelier Neika Slovensko Galerija Agnes English Gallery Deutsch Galerie Belaart Z
393 ASKö SV Linz Linz
Alle Infos über den ASKö Schiverein Linz...
askoe-schivereinlinz.at Linz Sekritariat Urlaubswochen Schibasar ] [ Verein Fitness Askö Galerie Events Sv Website Y
394 Home References
beautywerkstatt.at References Business Friends Charity Styling Theater Film Galerie Contactimpressum Menu Beratungworkshops Z
395 Alexander Kaimbacher Kaimbacher
alexanderkaimbacher.at Kaimbacher Alexander Login Medien Deutsch Galerie Biografie Repertoire English Kalender Downloadsy
396 Malerei Seiwald Seiwald
malerseiwald.at Seiwald Team Partnerbetriebe Galerie Malerei Leistungen Telefontirolwald Maler Mailinfo@malerseiwaldat Fax
397 Museumsheuriger Mallits Lackenbach Mallits
museumsheuriger-mallits.at Mallits Museumsheuriger Lackenbach Bauernhof Urlaub Galerie Reservierungen Faxpostgasse öffnungszeiten Uns
398 Goldway Home Goldway
goldway.at Goldway Uhren Schmuck Nominationcorner Sackstraepunkte Vitrine Fax+ Galerie Sonderaktion Anfahrt Homegraz
399 New Materia Startseite Materia
newmateria.at Materia Galerie Songs Band News Videos Newnewcomer Award Schlachthof Austriantourdaten Untersttzung
400 Lifestyle House Galerie
tabaluga-haus.at Galerie Grundrissebauen Partner Wegbeschreibung Peter Presseberichte Tafel Maffay Lifestyle Houseumweltbewusstes Disclaimer
401 wwwzypresseat Galerie
zypresse.at Galerie Speisekarte Zypresse Wwwzypresseatpartyservice Zypresseat Westbahnstrae Spezialitten Wien Geffnet Telefon Restaurant
402 Bikecenter Mulzet Mulzet
mulzet.at Mulzet Gebrauchtfahrz Team News Unser Bikecenter Galerie Bossttheneufahrzeugegästebuch Boss
403 Naschkatzerl Naschkatzerl
Naschkatzerl cafe Konditorei Catering 1210 Wien...
naschkatzerl.at Naschkatzerl Catering Wien Rechtliches Konditorei Lokal Karte Galerie Cafe Zwillkommen Mitterhofergasse
404 Zierkies der Blickfang für Zierkies
Zierkies der Blickfang für Blumenbeete Parkanlagen Zufahrten......
zierkies.at Zierkies Blickfang Zufahrten Blumenbeete Parkanlagen Garten Beschaffenheit Kontaktzierkiesgestaltungselementeschmckern Homepage Viel Galerie
405 Physio Fit Physio
Homepage of Physio Fit...
fithalten.at Physio Galerie Fit Kurse Team Leistungen Homekontakt Copyright Austria Gesundheitstrainingwels Leistungsdiagnostikhomepage
406 Ingrid Berger Berger
Ingrid Berger...
ingridberger.at Berger Ingrid Galerie Kontaktimpressum Ib@ingridbergerat Acryl Mich Illustration Acrylmalereiz Kunst
407 Zero Bock | Z
0-bock.at Z Galerie News Gemixtes Agb Bock Partner Events Fotos Produkt Zeroshop Freunde |
408 Basecaps Bedruckte oder bestickte Gtgt
classiccaps.at Gtgt Galerie Anfrage Caps Kandinsky Classic + Datenschutzhinweise [x] Bookmarken Leer Corporate Werbemittelpromo
409 Heribert Michl Heribert
Heribert Michl Vita Galerie Ausstellungen Kontakt...
heribertmichl.at Heribert Michl Kunst Ausstellungen Ausstelunggraz Museen Malerei Bildendegruppe Vita Galerie Museum
410 We Will Rock You Rock
We Will Rock You...
wewillrockyou.at Rock Will Galerie Band Cast Creative Ben Elton Shop Musical You Tpl_beez_jump_to_navdownloads Presse
411 Galerie Raum mit Licht Galerie
raum-mit-licht.at Galerie Kuenstlerinnen Vorschau Sommerpause Licht Text News Raum Rueckblickz English Ausstellungen
412 BIKE MAX | MARIA ALM Bike
BIKE MAX MARIA ALM...
bike-max.at Bike Max Maria Alm | Fahrrad Touren Schule Downhill Tour Cyclingmountain Galerie Z
413 Home Preise
studio-elegance.at Preise Anfahrt Nagelstudio Ausbildungs Gästebuch Galerie Ausbildungen Studioelegance Wwwdiehome Zachsdedesigned
414 sajowitz dachat Startseite Produktpartner
sajowitz-dach.at Produktpartner Jobs Galerie Gtgtdeckungsmaterialsajowitz Gtgtunternehmen Gtgtleistungen Dachat Box Drucken Wwwnetserviceatgtgtkontakt Website
415 Gästebuch
gabi-brauchl.at Gästebuch Galerie Information Standort News Port Grafrizz Designedserverapache Content Permanently The
416 Move and Dance Salzburg Salzburg
moveanddance.at Salzburg Team Galerie Dance Foto Kurse Move Glanfeldstrae Andreaz Tanz Stipkovits
417 irene dworak Dworak
irene dworak...
irene-dworak.at Dworak Irene Galerie Ausstellung Philosophie Biographiegeheimes Dorowin Links Geheimensprache Kandinsky Wassily
418 Michael Gindl Weinviertel | Galerie Buteo
mgsol.at Buteo Michael Gindl Galerie Weine Weingut Flora Sweet Aktuell Weinviertel Marktplatzhohenruppersdorf | Z
419 Sport Menzinger Fehring
sport-menzinger.at Fehring Sport Menzinger Galerie Verein Marken Link Angebote Ort Trends Jungsachenkinderbekleidung
420 horse balance Z
horse-balance.at Z Tiermasseur Itm Galerie Links Mich Horse Balance Leistungen Reichlnina Derzeit Bearbeitet
421 Our Adventures Adventures
Klemens und Denise unsere Reise Abenteuerwelt...
our-adventures.at Adventures Denise Klemens Galerie Abenteuer Gstebuch Reise Abenteuerwelt Copyright Gästebuchuns Z
422 Tennisklub Breitenfurt Breitenfurt
tkbreitenfurt.at Breitenfurt Tkbreitenfurt Tennisklubspielerinfos Meisterschaft Reservierung Neuigkeitenveranstaltungen Galerie Foto Hirschentanzstraße Adresse
423 Kultur im Dorf Grabern Dorf
kid-grabern.at Dorf News Kultur Galerie Grabern Veranstaltungen Grea Zaktuell Uns Köllagossn
424 Schellacks 78rpm Gt
schellacks.at Gt Lt Schellacks Galerie Kleinkunst Aufnahme Versand Herstellung Rpm Werbungberliner Schellackplatte Z
425 Home Unternehmen
auertransporte.at Unternehmen Fuhrpark Produkte Maschinen Anfahrt Galerie Informierenhandel Kiesgewinnung Erdarbeitenbagger Webseite Mietwagen
426 Von der Ehrenfeste Z
ehrenfeste.at Z Land Erfolge Geschichte Wildsteiger Ehrenfeste Bilder Galerie Paarungen Zucht Nachwuchs Verkauf
427 das Schnibblstudio Schnibblstudio
dasschnibblstudio.at Schnibblstudio Galerie Need Section Text Contained Produkte Note Loading Shows Welcome Update Withinbelow
428 Marktmusikkapelle Peilstein Home Galerie
mmk-peilstein.at Galerie Jugendorchester Geschichte Verein Marktmusikkapelle Peilstein Login Medien Backend Sitemapnbsptypo Javascript Z
429 Home Fyt
fyt-art.at Fyt Bilder English Airways Sunflight Jobs Galerie Styling Bewertung Margareta Home Z
430 hs fohnsdorfat Willkommen auf der Website Website
hs-fohnsdorf.at Website Schler Galerie Terminkalender Schule Aktivitten Lehrer Fohnsdorf Fohnsdorfat Hsbox Dernmshswwwnetserviceat
431 Homestyling Helena Startseite Homestyling
homestylinghelena.at Homestyling Helena Homestaging Galerie Maishofenhomestylinghelena@sbgat Tradlweg Gem Ecgpentz Collection Mich
432 schwarzundweissat Joomla
Joomla dynamische Portal Engine und Content Management System...
schwarzundweiss.at Joomla Schwarzundweissat Kontaktimpressum Dynamische Galerie Content Management Mich Portal Systemz Engine
433 Hexenmarkt Home Hex
hexenmarkt.at Hex Hexenmarkt Anfahrt Sponsoren Hexen Rat Programm Ausstellerservice Galerie Termin Hofunterkagererhof
434 Willkommen Lachwanderngeniesser
lachwandern.at Lachwanderngeniesser Angebot Familien Lachyoga Heiterkeit Sät Aktualisierung Lebensfreudeernten Firmen Letzte Galerie
435 Blumen Galerie Gršbming Blumen
Blumen Galerie DER Florist in Gršbming und Umgebung...
blumen-galerie.at Blumen Galerie Gršbming Mezhochzeit Umgebung Floristik Trauer GŠrten Deko Anita Poschflorist
436 Lifestyle House Grundrisse
lifestyle-house.at Grundrisse Galerie Umweltbewusstes Disclaimerlifestyle House Wegbeschreibung Partner Maffay Peterbauen Presseberichte Tafel
437 American Passages Passages
American Passages Ein Film von Ruth Beckermann...
americanpassages.at Passages American Beckermann Film Ruth Presse Kinofinder Gewinnspiel Inhalt Galerie Trailerdokufilmladen
438 MC Dagles Lembach Home Lembach
mc-dagles.at Lembach Dagles Mitglieder Galerie Clubgeschichte Clubdienste Beim Mchome Gästebuch Gstebuch Z
439 Willkommen bei der Auhirschpass Auhirschpass
Auhirschpass Krampusgruppe aus Donaustadt...
auhirschpass.at Auhirschpass Grafikfreelancersponsoren Web Galerie Mass Masken Mitglieder Apache Geschichtepfeffer Schnitzen Schnitzer
440 Volksschule Naas Volksschule
vs-naas.at Volksschule Naas Aktuell Seitenanfang Galerie Schlemmer Mag Geraldschuleunserer Wo Herz Rojekt+
441 Blumen Inge Inge
put a good description in here...
blumen-inge.at Inge Blumenheidi Galerie Uns Good Fürndraht Fuchs Descriptionkg Sortiment Here Engerlwerkstatt
442 W E Bullshop
wexx.at Bullshop Itunes Mp Tube Presse Texte Veranstalter Bullneuesvideo Band Videos Galerie
443 Vem Camara Home Z
vemcamara.at Z Preise Veranstaltungen Error Vem Galerie Training Request Uns Puresoftatpowered Ber Camara
444 Restaurant Galerie Tanglberg Willkommen Restaurant
tanglberg.at Restaurant Tanglberg Galerie Admin Lageplan Willkommen Acp Presse Speisekarte Fotogaleriegästehaus Z
445 Home Httpvuadminvservmenkisysdeimagesfahrradmessedscjpg
sportundservice4you.at Httpvuadminvservmenkisysdeimagesfahrradmessedscjpg Link Orange Blue Sportserviceyou Green Galerie Pichelbauer Langlauf Uns Verleih Gaverngavernframework
446 Lipstixx Individuelle Lippenstifte als Gtgt
lipstix.at Gtgt Lipstixx Galerie Anfrage Kandinsky + Classic Leer Werbeartikelenglish Produkte Faq Lippenstifte Empfehlen
447 Steinmötzger KEG Profil
steinmoetzger.at Profil Steinmtzger Galerie Steinmötzger Produkte Angebot Keg Vergngen Internetseitefragen Beratung Z
448 Atelier im Tal Reinhard Projekte
ateliersandhofer.at Projekte Reinhard Sandhofer Atelier Biografie Galerie Kunstmeile Maiersdorfkunsthandwerk | Ausstellung Installationtal Natur Collagierte
449 traude kling | malen Wien
traude kling malen aquarell acryl wien bali galerie ausstellung kunst wien...
kling.at Wien Kling Malen Traude Aquarell Galerie Acryl Bali Ausstellung Kunst Meine Sehnsucht| Z
450 Alexander Technik Studio für Technik
leichtes-leben.at Technik Alexander Hypnagoge Studio Lichterfahrung Hypnagogelichterfahrung Galerie Stunde Druckversion Ablauf Preise Loginerfahrung Z
451 lumpererhofat | Biologischer Betrieb mit Direktvermarktung Allgemein
lumpererhof.at Allgemein Vogerlsalat Tomaten Beginnt Himbeeren Knoblauchernte Paprika Saison Produkte | Biologischer Galerie Poweredbetrieb
452 Leitnerhof Familie
leitnerhof.at Familie Sortiment Leitnerhof Betrieb Galerie Verkauf Events Video Land Kontakt Zwein Liebe
453 Willkommen auf der Startseite Spg
SPG WeitersfeldenKaltenbergLiebenau Ein Team...
spgwkl.at Spg Sfeldenkaltenbergliebenau Galerie Leitbild Gästebuch U Joomla Cssreserve Ende Team Liebenau Sfelden
454 Galerie Leitner Hofherr Kunst Hofherr
Galerie Leitner Hofherr in Lermoos Tiroler Zugspitz Arena. Künstler Publikationen Ausstellungen auf Galerie Leitner Hofherr....
leitner-hofherr.at Hofherr Galerie Leitner Ausstellungen Lermoos Tirol Kunst Arena Künstler Zugspitztirolerzugspitze Bilder
455 Sportfotos Andreat Sportfotos
sportfotos-andre.at Sportfotos Fotos Andreat Galerie Andre Foto Sport Urheberrechtinformationen Sportfoto Walter Innsbruck Verwendung
456 bibern31 | Neue Galerie + Studio Galerie
bibern31.at Galerie Bibern Seitenanfang Studio Fotostudio Hide Direkt Weihergut Christineschnoellartworkscom Contentweihergut + Hauptmenü
457 BastArt Galerie Rahmungen Galerie
bastart.at Galerie Dekoratives Rahmungen Bastart Konzept Team Fr Mo Uns Strozzigasseagb Josefstdter Contact
458 Start tibetan terriers jimdo Z
tibetan-terrier.at Z Tibetan Terriers Memoriam Offspring Galerie Pups Welpen Page Dogs Newszuchtgedanken Hunde Jimdo
459 Liedertafel Straßwalchen Liedertafel
liedertafel-strasswalchen.at Liedertafel Impressumkornprobst Browser Lukas Simon Veranstaltungen Galerie Straßwalchen Strawalchenmitglieder Verein
460 Official Stylo Site Band
stylo.at Band History Benutzername Stylo Passwort Official Galerie Heimarbeit Blog Mich Administrationangemeldet Amazon Z
461 Willkommen auf der Startseite None
None...
ballett-tanz.at None Wwwballettschulenat Location Faq Port Hop Uns Apache Ballett Dance Server Galerie Founddownload
462 Fun Drachen Kitesportat Fun
fun-drachen-kitesport.at Fun Drachen Kitesportat Sport Thayaprogramm Schutzbekleidung Galerie Agbs Habison Klaus Niederedlitzklaushabison@hotmailcom
463 techfloorat Home Unternehmen
techfloor.at Unternehmen Leistungen Galerie Techfloor Techfloorat Mischpumpe Arbeit Betonsanierung Estrich Gewerbe Schnelligkeitmenu * Industrie
464 Klaus Frost Klaus
frost.at Klaus Request Frost Hostserver Client Galerie Wien Maler Ausstellungkärnten Kunst
465 News springrock racings Webseite News
springrock-racing.at News Presse Partner Permanently The Springrock Webseite Racings Server Team Apachevereinsinfo Port Galerie
466 Fotoklub Hartkirchen fotoklub hartkirchens Hartkirchen
Fotoklub Hartkirchen...
fotoklub-hartkirchen.at Hartkirchen Fotoklub Fotoclub Gästebuchklubprogramm Webseite Raika Galerie Server Wettbewerb Portpermanently The Klub
467 Startseite Preise
kindernest-waidring.at Preise Sicherheit Team Kleinkinderzwischen Kindernestgibt Jahren Galerie Kinder Kind Tagesablauf Rituale Orientierunganmeldung
468 fotoheldenat Foto
fotohelden.at Foto Galerie Klub Unser Woche Bild Wwwnetserviceat Neu Gerhardfotostory Box Apaunik Website
469 Home Projekte
ehem. Baumeister Karl Freiberger...
freiberger.at Projekte Freiberger Karl Ehem Baumeister Anliegen Projekten Kontaktformular Programmierung Galerie Cms Unsgeht
470 Stranig Reaktiv Sporttherapie Rehabilitation
stranig-reaktiv.at Rehabilitation Reaktiv Stranig Praxis Galerie Sporttherapie News Mitarbeiter Prophylaxe Leistungen Diagnostik Koordinationz
471 Bechter Installationen Bechter
bechter-installationen.at Bechter Team Javascript Leistungen Galerie Partner Geschichte Installationen Gesellschaft Websitekontaktaufnahme Solar Bregenz
472 the making of consulting eventmanagement Birkner
eventagentur und eventconsulting...
themakingof.at Birkner Eventagentur Gerald Eventconsultingenergie Office@themakingofat Making Consulting Eventberatungraum Galerie Farbe Eventmanagement
473 Klassik unter Sternen Nbsp
nbsp nbsp nbsp...
klassikuntersternen.at Nbsp Galerie Klassik Hausordnung Programm Künstler Tickets Sternen * Unter Pressesternen Agb Z
474 BastArt Galerie Rahmungen Rahmungen
bast-art.at Rahmungen Galerie Dekoratives Bastart Konzept Team Strasse Josefstdtermo Contact Frstrozzigasse Uns Wien
475 Stainless Design Welcome Pool
stainlessdesign.at Pool Design | Edelstahl Galerie Unternehmen Stainless Welcome Standort Visionen Filteranlage Wertpool überlaufgewerblich
476 Galerie
Willkommen in der Galerie Ihr Name...
schuette.at Galerie Name Ihr Kunst Ausstellen Kunstausstellung Modern Galerien Surrealistischbildergalerie Oel Gemaeldeausstellung Gemaelde Klassich
477 home dz photo Galerie
dz-photo.at Galerie Hochzeiten Dz Making Personen Diverses Akt Mich Dessous Photo Of Foundbilder Video
478 ==== eBosco Blumen
ebosco.at Blumen Sinne Privatkunden ==== Galerie Produkte Firmen Dauerauftrag Servitengasse Handels Naturdarauf Freuen Uns
479 Startseite Installateur Erwin Hafner Neuigkeiten
Startseite von inst hafner.at Home...
inst-hafner.at Neuigkeiten Jobs Galerie Leistungsspektrum Partner Installateur Hafner Error Erwin Besucher Bisherinst Cmsday Z
480 Home Galerie
winter-garten.at Galerie Firma Zirbenbetten Hörmansdorfer Neu Auberg Stiegenbau Sabine Rtischlereisfeld Tischlereihome Email
481 Gem Chor St JakobKolbnitz Chor
Gemischter Chor St. JakobKolbnitz...
chor-kolbnitz.at Chor Jakobkolbnitz St Gem Gemischter Sponsoren Galerie Chronikbeim Gemischtenjakob Copy Hauptmenü
482 Am Ende des Tages | Ab Ende
Am Ende des Tages Ab 26. August im Kino...
amendedestages.at Ende Kino Tages Ab | Galerie Besetzung Kinofinder Inhalt Presse Musikvideo Unterberger Filmschwarz
483 offline film editing Offlineenglish
evinnia.at Offlineenglish Film Online@offlinecoat Partner Uns Deutsch Schliemanngasse Hudecek Editing Wien Galerie
484 Dietmar Grundmanns Homepage Grundmanns
Dietmar Grundmanns Homepage. Jetzt ganz toll mit neuen Layout also vorbeischauen...
grundmann.at Grundmanns Homepage Dietmar Toll Galerie Internet Explorer Browser Leider Neuen Vorbeischauenkauf Also Ganz
485 wwweventeat Joomla
Joomla dynamische Portal Engine und Content Management System...
evente.at Joomla Galerie Veranstaltungen Gästebuch Admin Fischen Epeer Content Erlebnisagentur Wwwepeerat Systemmanagementhome
486 Ordination Dr Hoheneder Home Hoheneder
Dr. Franz Hoheneder Hausarzt am Wallhof...
hoheneder.at Hoheneder Dr Ordination Joomlaleistungen Praxisteam Mich Franz News Anfahrtsplan Hausarztphilosophie Galerie Wallhof
487 Atelier MORI ART Kunst
MORI ART Die Kunst ist eine Vermittlerin des Unaussprechlichen Johann Wolfgang von Goethe atelier@mori art.at...
mori-art.at Kunst Mori Art Atelier Galerie Presse Projekte Enter | Ausstellungen Portrait Unaussprechlichen Johann
488 index Art
quotAktkunst und Skulpturen zu kaufen und zu mieten von Gerold Ziegler 21 art.atquot...
21-art.at Art Wwwzmlsat Skulpturen Ziegler Gerold Akt Quotaktkunst Aufihrendoch Freue Galerie Schauen Mich
489 MV Heimatklang Puch Puch
musikverein-puch.at Puch Heimatklang Kontakte Galerie Musiker Chronik Mv Design Floadschwarzesbrett Administration Gästebuch
490 Home Joomla
Joomla dynamische Portal Engine und Content Management System...
drschmatz.at Joomla Team Epeer Home Ordinationszeiten Bereitschaftsdienst Login Galerie System Managementengine Portaldynamische Wwwepeerat
491 miro LOGISTIKSYSTEME GmbH Gmbh
miro-mobil.at Gmbh Galerie Produkte Logistiksysteme Ihrebedrfnisse Bord Hotline Jahren Einrichtungskonzeptbesuchihr Bereichfahrzeugeinrichtung Veinbarung Miro
492 Hia Do Brass AKTUELLES Brass
hiaunddobrass.at Brass News Hia Performances Do Kirchenkonzert Aktuelles Galerie Golling Abend Stadtpfarrkirche Hallein Archivrepertoire
493 Home News
Carpers and Friends...
carpersandfriends.at News Galerie Berichte Weblinks Tackletests Team Carpers Unserer Homepage Unspetri Maxe Friends Z
494 angel of music Ines Ines
angel-of-music.at Ines Kastenhubermusic Verena Galerie Mich Design Meacuteldesign Repertoire Gäste Partnerangel Audio
495 Galerie Hilger modern contemporary Hilger
hilger.at Hilger Galerie Brotkunsthalle Dorotheergassewien Ausstellungen Fairs Ernst Künstler Editionennews Modern Contemporary
496 ShowIt V2200 Fotos
PHP Bildergalerie zur Anzeige und Verwaltung von Fotos Bildern und anderen Imagedateien...
cc2.at Fotos Showit Gif Found Verwaltung Bildern Imagedateien Bildergalerievorschau Image Anderen Php Galerie
497 WILDENSTOANA PERCHTEN Perchten
wildenstoana.at Perchten Wildenstoana Sponsoren Befrgruppen Historie Galerie Supportware Verein Ausstatter Ausbadcopyright Ischl Webseite Z
498 Home Cindys MaineCoon Homepage
nbsp...
cindys-mainecoon.at Homepage Cindys Do Yourself Mainecoon Druckversion Login Galerie Cindy Gästebuch Uns Offspringshome Logout
499 Lebenshilfe Steiermark Nahtloskunst Nahtloskunst
nahtloskunst.at Nahtloskunst Lebenshilfe Mürzzuschlagport Server Steiermark Permanently The Chronologie Apache Kunstmarken Archivliteraturwerkstatt Galerie
500 wwwOfenSchmidat coming soon Uns
ofenschmid.at Uns Galerie Faq Leistungen Coming Krze Ffnungszeiten Systeme Soon Dauerbrandfen Wien Beratungverfgbar Reparaturen
501 Home Leistungen
compactgardenliving.at Leistungen Team Innovation Agbs Galerie Wohn Nutz Compactgardenliving Wirgarten Konzepteinterdisziplinär Entwurf Z
502 Aichinger Tischlerei wwwaichingerat Aichinger |
Idee Team Massive Vorteile Individuell Unsere Partner Galerie Kontakt   Normal...
aichinger-tischlerei.at | Tischlerei Aichinger False Etiketten Partner Vorteile Meine Idee Massive None Galerie Individuell Team Y
503 Grafik Linz Linz
grafik-linz.at Linz Grafik Galerie Steingasse Künstler Admin Bildern Poweredmianara Kunstmianarawebdesign Webdesign Peter
504 Eibenhof Weingut
Weingut...
weinguteibenhof.at Weingut Eibenhof Galerie Trauungen Webcam Familie Weinesteiermark Gästebuch Glanzöstereich
505 Eisrausch die Life Radio Linz
EISBOX Der Liferadio Eislaufplatz am OK Platz in Linz...
eisbox.at Linz Ok Eisbox Platz Liferadio Eislaufplatz Eisrausch Bilder Dächern Radiolife | Galerie Video
506 Home Z
weinstoppl.at Z Port Weine Galerie Anfahrt Apache Speisenpizza Server Gästebuch Permanently Thelunch Menu
507 RICHARD CONRAD Richard
richardconrad.at Richard Conrad Musik Galerie Gedichte Fotos Kontakt Intro überspringen Poweredhomepage Home Z
508 Golden Hours | Golden Retriever Zucht Golden
goldenhours.at Golden Hours Retriever Galerie Blog Zucht Mittelburgenland Hallo Nadine Zhoritschon Hoursgolden | Buzanich
509 Home | Die Almhütte auf der Uns
Hier können Sie schnell und einfach einsehen wann unsere Hütten verfügbar sind und buchen. Oder Sie rufen uns...
almhuette-kaernten.at Uns Sommer Found + Einfach Schnell Server Anzeigen Galerie Almdorfeinsehen | Hütten Apache
510 Regine Dapra Regine
Regine Dapra Salzburg Landschaften Bilder öl auf Leinwand...
dapra.at Regine Dapra Galerie Ausstellung Bilder Biographieöl Büchersalzburg Leinwand Landschaften Bcher
511 etainment etainment Musik
etainment.at Musik Galerie Eventplanung Etainment Ganz Tainment Frageneinfach Webproficc Unseventargentur Willkommen Fragen Antwort
512 Start Erlebnisbauernhof Redlberger Request
erlebnisbauernhof-redlberger.at Request Nginx Login Enter Uns Infotage Panoramen Erlebnis Tiere Galerie Erlebnisbauernhof Naschgartenerlebnisspielplatz
513 Home Home Interior Inspiration
home-interior.at Inspiration Interior Produkte Aktuell Shopping Store Hause Diskret Igewerbepark Unsflagship Galerie Sache
514 Acrylbilder | Ilse Schill Acrylbilder
ilseschill.at Acrylbilder Ilse Schnering Schill Galerie Cafe Regina Traun Ausstellung | Lge Savedriveadorno Moser
515 Start ESSbar essen trinken mitnehmen Essbar
None...
essbar-traun.at Essbar Trinken Essen Team News Galerie Login Traun Mitnehmen Downloads Mittagsteller Panoramen | None Y
516 Clowntown Clowntown
clowntown.at Clowntown Galerie Arbeit Philosophie+methodetrumen Flexibilitt Sensibilitt Uns Einfachheit Kindernaktiv Zuhren Spielen
517 We Will Rock You Rock
We Will Rock You...
we-will-rock-you.at Rock Ben Galerie We Bb Downloads Original Shop Musical Queen Team Tpl_beez_jump_to_nav Eltonpresse
518 Hotel Alpenland Alpenland
Hotel Alpenland...
alp1.at Alpenland Hotel Unspreisliste Angebot › Galerie False Swfobjectembedswfflashintroswf {wmodereservierungsformular Corsariopl Flashexpressinstallswf
519 Weingut Josef Fischer Huchenzucht Weingut
Weingut Josef Fischer Huchenzucht...
huchenfischer.at Weingut Huchenzucht Fischer Josef Neuheiten Sortiment Presse Weinbau Salonsieger Galerie Rossatz+auszeichnungen Z
520 Ralfs Homepage Homepage
Homepage Ralf Vamosi Austria Information IT Technology Photography gallery Galerie Photo Foto...
vamosi.at Homepage Photography Foto Photo Ralf Gallery Galerie Information Austria Vamosi Technology Ralfsz
521 Evangelische Volksschule am Karlsplatz 14 Uns
karlsplatz14.at Uns Volksschuleevangelische Klassen Galerie Port Apache Karlsplatz Server Permanently The über Tagesheim
522 Mag Nicolae Marinica Home Nicolae
Mag. Nicolae Marinica...
marinica.at Nicolae Mag Marinica Galerie Lebenslauf Intro Skulptur Gedchnis Bildhauer Marinicabildhauer Memoriammagkant Lieben Z
523 Zapeterat Galerie Kunst Malerei Person
Willkommen auf der Website von Peter Zacek....
zapeter.at Person Ausstellung Kunst Daleeartz Zapeter Austellungen Featured Galerie Malerei Zapeterat Zacek Peterwebsite Z
524 Keychains Individuelle Schlüsselanhänger als Gtgt
xn--schluesselanhnger-2qb.at Gtgt Anfrage Galerie Straps Metall + Kunststoff Keychains Kandinsky Datenschutzhinweiseanfragenkorb Agb Version Website
525 ju Q lu party Juli
juqlu.at Juli Galerie Sponsoren Juweissenkirchen Lu Aufgepasst Clubbing Wachauhalle Feuerwehr Flashoverclubbingteam Party Flashover
526 Weinbau Posch Posch
Weinbau Posch...
posch-weine.at Posch Weinbau Buschenschank Wein Uns Produktefamilie Weinkeller Eingang Flaschenweinverkauf Bildern Galerie Informationpresse
527 Justizcafe Home Galerie
justizcafe.at Galerie Agbfound Found The Server Apache Angebote Justizcafe Vorschau Bilder Jobs Partner Filmport
528 Hebamme | Ema Golob Dkweb
hebamme-golob.at Dkweb Golob + Medien Agentur Hebamme Blog Ema Person Email Page Internet| Galerie
529 Home Galerie
signet.at Galerie Home Signet Güngörjoomla Hurricanemedi Joomlatemplates Impressum Templatesceyda Uns
530 K12 GALERIE |
Galerie für Gegenwartskunst K12 Bodensee Artclub Galerie für internationale und österreichische Kunst des 20. und 21....
k12galerie.at | Galerie Gegenwartskunst Marxx Artclub Bosch Kunst Bodensee Internationale Kunstgalerie Bregenzwerner Artcomk_indexhtm Bildende
531 Pferdeflüsterer Harry Kaldasch +
pferdefluesterer.at + Kaldasch Harry Galerie Kontaktimpressum Pferdeflsterer Preise Kurseausbildung @ Documentwritewersfelden Pferdeflüsterer Uns Z
532 Startseite Kleingartenverein Gartenfreunde 12 Gartenfreunde
gartenfreunde12.at Gartenfreunde Vereinsgeschichte Linktipps Kleingartenverein Statuten Vereins Vereinsleitung Galerie Logout Sommerfest Jimdohomepage Bearbeiten Y
533 Dolly Buster | Meine Welt Welt
dolly-buster.at Welt Meine Kunst Dolly Vip Tv Autogrammkarten | Play Rezepte Kulturgames Galerie Biografie
534 traude kling | malen Wien
traude kling malen aquarell acryl wien bali galerie ausstellung kunst wien...
malen.at Wien Malen Traude Kling Kunst Ausstellung Galerie Bali Acryl Aquarell Meine| Sehnsucht Z
535 Startseite mit laufendem Fototaustausch Fotos
sindbad137.at Fotos Fototaustausch Lieblingsfotosfrühere Sindbad Gedanken Geschichten Foto Geschriebene Galerie Laufendemcopyright Startseiten
536 Geometer SchartnerZopp Schartnerzopp
zopp.at Schartnerzopp Geometer Disclaimer Büro Mail Galerie Referenzenhome Nonntalerhauptstr Website Faq Salzburg
537 Griasenk auf der Gamsalm Gamsalm
Griasenk auf der Gamsalm in Ehrwald...
gamsalm-ehrwald.at Gamsalm Ehrwald Hütte Griasenk Wegnews Wetterstein Alm Winter Sommer Galerie Zugspitzefeiern
538 mahrenbrandat Lucas
mahrenbrand.at Lucas Michael Galerie Kopecky Informationen Andrea Andreasturm Dr Website Inhalt Mahrenbrandatz Sturm
539 httpwwwmario ederat Galerie
Homepage von Mario Eder...
mario-eder.at Galerie Eder Mario Design Level Welcome Wiest Dennis Paragliding Parameter Ederat Homepage Templategleitschirm
540 Startseite jennystifterat Malerei
jennystifter.at Malerei Galerie Biographie Servicesjenny Jennystifterat Acrylmalerei Internet Virtualweb Stifterhaftungsausschluss Gästebuch Urlaub
541 Startseite Work
gamsriegl.at Work Zucht Galerie Newssimone@gamsrieglat Hunde Welpen Labradorzucht Simone Oberberguns Schmiedtbauer Link
542 Budocenter Featured
budocenter.at Featured Galerie Eventanfrage Allgemein Location League European Cev Volleyball Datenbudocenter Technische Events Z
543 Die Curt Goetz Seite Goetz
In Memoriam Curt Goetz und Valerie von Martens. Die Informationsseite über den bekannten Schauspieler Curt Goetz und dessen...
curt-goetz.at Goetz Curt Martens Valerie Copyright Memoriam Information Galerie Schauspieler Dimufidrainformationen Schauspielerleftpx Bekannten Informationsseite
544 Kunsttherapie Gerstenmayer Kunsttherapie
Kunst als Therapie Claudia Gerstenmayer klinische und phronetische® Kunsttherapeutin in Graz Steiermark. Maltherapie Gestaltungstherapie und Kunsttherapie. Therapie mit...
kunst-als-therapie.at Kunsttherapie Graz Angebote Gerstenmayer Mich Praxis Therapie Kunst Galerie Kunsttherapeutin Claudia Steiermarkfarben Formen
545 p4uAgency Home Promotoren
promotoren.at Promotoren Agentur Unser Leistungen Galerie Jobs Team Puagency Arbeit Eventsangebote Erfahrung Wien Josef
546 Elterninitiative Lavida | Home Unser
Startseite...
lavida.at Unser Permanently The Powered Login Vida Uns Angebot Hacktech Galerie Lavida Elterninitiative Apache Laport
547 freudeamlebenat Kurzbungen
freudeamleben.at Kurzbungen Energiearbeit Galerie Personen Resonanz Nlp Fhigkeit Freudeamlebenat Zeit Jedes Ortreiki Problem Coaching
548 Pix Vibes OT Vibes
pixandvibes.at Vibes Lienz Oc Tirol Kunst Schick Gerhard Pix Galerie Inhalte Ot Freifood Tage
549 photopassionat Manfred Kubanik Manfred
Fotografie Homepage eines ambitionierten Hobbyfotografen...
photopassion.at Manfred Tfp Fotografie Kubanik Shooting Portrait Fotomodel Photopassionat Location Galerie Fantasie Peoplefotografiehomepage Ambitionierten
550 KFZ Meisterbetrieb Dolinar Leistungen
dolinar.at Leistungen Gebrauchtwagen Galerie Kfz Meisterbetrieb Gallerie Dolinar Vielen Copyright Fax Mobil Dankanschrift Nachricht
551 Prinz Neptun Ore LV Thomas II Ore
prinz-ore55.at Ore Thomas Galerie Ii Bregenzer Archiv Gefolge Christianezugmaschine Blog Faschingsprinz Hackspiel Neptun Prinzen
552 Moderne Acrylbilder Modern Painting Painting
egger-kramer.at Painting Acrylbilder Galerie Modern Moderne Ausstellungen Presse Christianmoderneoptik Egger Elisabeth Tauber Bilderkaufpicture Bilder
553 Home | EFS | Elementary Fighting System
Home EFS Elementary Fighting System ist ein Hybridsystem jahrhundertealter Kampfkünste und Kriegskünste aus Asien und...
efs-fightingsystem.at System Fighting Elementary Instructors | Schulen Ausbildung Efs Waffen Galerie Liste Unterricht Graduierung Downloads
554 Sunsara Farbenwelt Design
Sunsaras Website...
sunsara.at Design Sunsara Gallery Textilien Farbenwelt Projekt Sonne Website Homepage Bilderkunst Farben Kraftbilder Galerie
555 Rebensthein Rebensthein
rebensthein.at Rebensthein Wordpresscom Ten Port Server Galerie Apache Angebote Found Anfahrt Bild Hinterlasse Inhaltfound The
556 freizeit bewegt Home Partner
pix4you.at Partner Freizeit Bewegt Aktiv Plan Programmangebot Galerie Veranstaltungen Bewegung Freude Informationsmaterial Michloading Lebenich
557 Rotary Club Telfs Seefeld Seefeld
rc-telfs-seefeld.at Seefeld Stadlfest Advent Xgolftrophy Telfs Seefelder Rc Galerie Rotary Club Wildmoos Partnerbetriebesponsors Gallery
558 wwwbergrettung lechat Startseite Bhutan
Bergrettung Lech...
bergrettung-lech.at Bhutan Lech Projekt Mediabase Englisch Bergrettung Lt Wanneinsatzstatistik Gt Menu Hilfe Bergen Galerie
559 Online Galerie Franz Haas Haas
Online Galerie des bekannten Weinviertler Künstlers Franz Haas...
franz-haas.at Haas Franz Galerie Grafik Abstrakt Kultur Kunst Pastell Weinviertler Malerei Bilder Radierung Knstlersfranzacryl
560 Home Veranstaltungen
residenz-cafe.at Veranstaltungen Login Unser Angebot Jump Archiv Galerie Datum Zeit Searchnavigationsearch Mainjoomlar Schlunet Navigation
561 Herzlich Willkommen Sternwarte
sternwarte-stattegg.at Sternwarte Astrofotografie Galerie Rosettennebels Rosettennebel Stattegg Kuppel Sternwartenbau Eqascom Astronomie Garradd Bildeqmod Nordamerikanebels
562 wwwpiscesat Startseite Galerie
pisces.at Galerie Artenliste Anmeldung Joomla Publikationen Mich Direkt Wwwpiscesat Cichliden Wechselnpermanently The Moved Buntbarsche Hauptnavigation
563 Eisrausch die Life Radio Radio
EISBOX Der Liferadio Eislaufplatz am OK Platz in Linz...
eisrausch.at Radio Life Linz Bilder Eisbox Ok Video Galerie Eisrausch Liferadio Platz Eislaufplatz Kunstwald Wettermelder Y
564 Index Sanierung
suschnig-parkett.at Sanierung Verlegung Parkett Bautrockung Galerie Profi Bautrocknung Boden Professionell Uns Parkettprofi Servicezu Zielschonende
565 Gottfried Kumpf Gottfried
Gottfried Kumpf...
kumpf.at Gottfried Kumpfdeutsch Tiergarten Inhalt Asoziale Galerie Schönbrunn Dorotheum Biographieausstellungen Navigation Galerien
566 Willkommen bei Promotool Promotool
promotool Formenbau Ges.m.b.H...
promotool.at Promotool Werkzeugbau Konstruktion Leistungen Stellenangebote Galerie Partner Fertigung Formenbauuns Qs Din En Formen
567 Promocams Bedruckte Einwegkameras als Gtgt
einwegkameras.at Gtgt Galerie Anfrage Cams + Kandinsky Promocams [x] Leer Bookmarken Paperboxltzurück Anfragenkorb Corporate
568 dessl hat Dessl
Dessl Homepage...
dessl-h.at Dessl Prager Fotoschule Homepage Photo Urheberrecht Zitate Bild Foto Fotobcher Galerie Letzte Haraldklick
569 Lazarusware just use it Lazarusware
homepage of lazarusware a little developer label owned by xlazarus promoting Linux systems and OpenSoure programming all cases...
lazarusware.at Lazarusware Linux Programming Programme Use Adminscripte Scripting Cases Opensource Shell News Galerie Neues Just Xlazarus
570 STEWA Holzfachmarkt Stewa
stewa-holz.at Stewa Holzfachmarkt Galerie Downloads Dienstleistungen News Produkte Holzprofi Weltder Heusswort Uns Mrchen Gehen
571 Nagelstudio Picasso Nails Galerie
picasso-nails.at Galerie Blicke Nagelstudio Nails Picasso Ngel Bildung Lust Preise Besonderestudio Euromchten Nailart Designgehren
572 Dance Connection Dance
danceconnection.at Dance Connection Websiteihr Jahren Termineviel Gruppeund Seiten Galerie Partner Auftritte Amateurinformationen Team Programm
573 Oppitz So will ich Planung
oppitz-wohndesign.at Planung Oppitz Galerie Wilde Geschmack Kundengesprch Anliegen Einrichten Terminen Gewinnergesprch Kundenbertholdverarbeitung Beste Oase
574 Aktuell Joomla
Joomla dynamische Portal Engine und Content Management System...
die43er.at Joomla Musik Forum Content Jump Weblinks Dynamische Login Information Galerie Permanently The Endemitglieder Apache
575 Die Besondere Bibliothek Bibliothek
diebesonderebibliothek.at Bibliothek Besondere Intro Galerie Büchern Derbesonderen Jede Allerdings Bibliotheksgalerie Wurde * Ihres Genommeneinzigartigerbestand
576 home paparazzipezi Jimdo
peterorlik.at Jimdo Logout News Orlik Galerie Bild Members Gelangen Einfach Bearbeiten Druckversion Home Contact Y
577 PUKL FILM private media Film
pukl.at Film Pukl Private Media Galerie Projekte Entertainment Zukunft Mittelnauslotung Grenzen Aufwand Infotainmentbereich Rahmensfrei
578 Startseite radsport steixners Jimdo Steixner
radsport-steixner.at Steixner Jimdo Assos Hubert Galerie Page Radsport Partner Brands Jahren Highlight Radsportbrille Kundendruckversion
579 Panorama Restaurant Gmunden Restaurant
panorama-restaurant.at Restaurant Panorama Gmunden Galerie Lageplan Speisen Kche Tagesangebote Gmundenvon Familienfeiern Herzen Frhstcksbuffet Taufenundesplanade
580 Autohaus Radauer | A 8820 Neumarkt Autohaus
radauer.at Autohaus Neumarkt Radauer Galerie Tankstelle Veit Team Peugeot Feiertage Suzuki News |mail Wirtschaftspark
581 DuoNuevo_Text Astor
duonuevo.at Astor Monica Piazzolla Tschallener Clemens Tarcsay Musik Tangonuevo Duonuevo Duonuevo_text Galerie Tangoduonuevomit Akkordeon
582 Joomla
Joomla dynamische Portal Engine und Content Management System...
pranam.at Joomla Philosophie Imageslideshow Meditation Feuerpujas Galerie Wissen Healing Energiearbeitvedisches Kinderjugendliche Wann Praxis Leistungen
583 Home Pansilva Galerie
Homepage von Silvia Edinger Malschule und Atelier Pansilva dipl. Panart Lehrerin seit 2009...
pansilva.at Galerie Pansilva Atelier Edinger Silvia Malschule Homepage Panart Lehrerin Masu Lehrer Matthias Diplseit
584 We Will Rock You Rock
We Will Rock You...
queen-musical.at Rock Team Downloads Queen Videos Band Shop Galerie Creative Musical Tpl_beez_jump_to_nav Show Bboriginal
585 Pulsschlag Philipp Kerschbaumer Startseite Schlag
Schlag auf Schlag dem Ziel entgegen......
pulsschlag-wenigzell.at Schlag Pulsschlag Galerie Touren Mathematik Inline Skating Koordination Mountainbike Kerschbaumerdeutsch Bike Presse Port
586 Pension Königs Cafe Pension Königs Cafe Cafe
pensionkoenigscafe.at Cafe Königs Pension Plan Karte Galerie Zimmer Straße Wien Copyright Telfaxkaiserebersdorfer
587 Home Galerie
studiofoto.at Galerie Gesetzen Ihres Bilder Galerien Fotos Seiten Albumseite Besuchersollten Studiofotoat Inhalten Wichtiger Hinweisin
588 == Prehm Reisen == Reisen
prehm-reisen.at Reisen Anfahrt Fuhrpark Reiseangebote == Unternehmen Partner Galerie Prehm Wellnessreisen Musikreisen Grenzen Gruppen Sonderfahrtenteam
589 Primal Legion heißt euch Willkommen Forum
primallegion.at Forum Chrome Internetlegion Downloads Galerie Mozilla Videos Gildenrat Primal Bewerbung Server Goodwin Gpl
590 GOLDEN RETRIEVER AUS LEIDENSCHAFT Retriever
passioningold.at Retriever Leidenschaft Golden Fotos Galerie Trainingsbilder Daumendrcker Sausal Kameraleute Workingtest Spirk Kflach+ Informationen Y
591 PEMANU ModeART Nussbaum
pemanu.at Nussbaum Petra Pemanu Maria Modeart Person Design Galerie Benjamin Events Designedz Diashow Copyright
592 Fotostudio Stummer Stummer
Inge Mandlr...
fotostudio-stummer.at Stummer Fotostudio Login Inge Galerie Mandl Team Besuch Sofort Galerieseiten Sofortgutschein Copygutschein Home|
593 Pongauer Sonntagsmusi Pongauer
pongauer-sonntagsmusi.at Pongauer Sonntagsmusi Wochenende Almabtrieb Besetzungen Gruppe Galerie Neuss Waren Reiseberichtgehtswebsite Beim Reisebericht Gehts
594 willy rast Rast
rastart.at Rast Willy Figural Kunst Werke Austria Galerie Atelierlandschaften Bild Steiermark Kuenstler Painter Ankaeufe
595 Tanzfreunde Weiz Home Tanzfreunde
Club Tanzfreunde Weiz...
tanzfreunde-weiz.at Tanzfreunde Weiz Club Galerie Tanzen Siewillkommenimclub Vorstand Bildungsmglichkeiten Bungsdann Gute Clubkalender News Gerne
596 stornig artat NEWSNEWSNEWSNEWSNEWSNEWSNEWSNEWSNEWSNEWSNEWSNEWS Stornig
stornig-art.at Stornig Inge Artat Newsnewsnewsnewsnewsnewsnewsnewsnewsnewsnewsnews Gemeinschaftsausstellung Ausstellungen Galerie Homepage Graz Knittelfeld Nov Acrylarbeitenernst Schnecker
597 Dr Edmund Pabst Facharzt für Innere Facharzt
drpabst.at Facharzt Angiologie Innere Medizin Pabst Edmund Informationen Leistungen Intensivmedizin Krampfadern Galerie Lageplanarterien Venen
598 Bruckhaufen
primiz.at Bruckhaufen Breitensee Bilder Primiz Download Priesterweihe Gumpendorf Galerie Pfarre Letzte Beitrag Bewertenklauninger Druckbareversion
599 Meine Website Stixenstein
labanda.at Stixenstein Fest Keller Halloween Galerie L Gruppe Meine Banda Lobo Hochzeit Ernesto Website Fabiola
600 die betriebiclowns Clowns
betriebiclowns.at Clowns Nochwas Galerie Betriebiclowns Frderungspenunter Peppiunermdlich Wann Landobersterreich Winter Braucht Weil Trost Arbeitnehmern
601 Edelstahlauspuff Edelstahlauspuff
Edelstahlauspuffanlagen in höchster Qualität und bestem Klang....
edelstahlauspuff.at Edelstahlauspuff Wechseln Kfz Auspuffanlagen Galerie Arbeiten Rally Auto Spengel Lieferwagen Erforderlich Kompetentereparaturen Dellen
602 RAK ALEXANDER wwwrak1at Gtgt
rak1.at Gtgt Dokument Alexander Unbenanntes Gstebuch Sponsoren Galerie Rak Biografiewwwrakat Zeige Stepweb Mich Berichte
603 beislfest Beislfest
beislfest.at Beislfest Cafeacute Paradiso Galerie Gewinnspiel Barrock Lt Eder Gt Underground Vita Egon Romaemmi
604 Traditionelles Taekwondo Graz Taekwondo
taekwondo-graz.at Taekwondo Graz Traditionelles Kampfkunst Galerie Energie Classic Entwickle Traditionell Wwwtaekwondo Grazattraining Selbstverteidigung Traditionellem
605 Startseite kranebitterklammlabradorss jimdo page Diego
labradorzucht.at Diego Jimdopro Dieses Last Jimdo Gästebuch Ausbildung Direct Meine Labradors+++ Inhalte Angebotaugenblicken Galerie
606 Gravur Manufaktur Alfred Woschitz Alfred
schilder.at Alfred Gravur Manufaktur Gravuren Schilder Woschitz Galerie Original Design Eindruck Alfredwoschitz Mozilocmsarbeit Schauen
607 ApfelLand Konditorei Cafe Melounge Stubenbergsee Konditorei
Motivtorten der besonderen Art Lounge Kaffeehaus Galerie ein Haus mit Stiel am Hauptplatz in Stubenberg Konditorei mit Eisdiele...
me-lounge.at Konditorei Apfelland Melounge Cafe Motivtorten Stubenbergsee Hauptplatz Kaffeehaus Galerie Stubenberg Lounge Essbareburger Apfellandtorte
608 Loamkuchl Stefanie Modritz Tonkunst Loamkuchl
loamkuchl.at Loamkuchl Modritz Tonkunst Stefanie Galerie Schloss Erde Tribuswinkel Tpferei Ostermarkt Post Fridau Mich Y
609 Homepage Schelch
lob-schelch.at Schelch Homepage Foto Galerie Karl Verantwortlichkundenliste Trofaiach Kinderlifte Sommerrodelbahnen Inhalt Sportsande Gerichtssachverstaendiger Mieteislaufplaetze
610 WWWMARKUS PRANDSTAETTERAT FOTORAFIEGALERIEEVENTSDOWNLOAD Events
Die Seite für Fotografie Mit Galerie Events Downloads und vielem mehr. Werde Zeuge von Schlagenfütterungen in gestochen scharfer...
markus-prandstaetter.at Events Downloads Wwwmarkus Galerie Diabolisch Tutorials Vielem Gestochen Astrobilder Scharfer Zeuge Prandstaetterat Prandstaetteratfotorafiegalerieeventsdownloadfacetten
611 SPEZIALSERVICE Spezialservice
spezialservice.at Spezialservice Transportbegleitungteam Galerie Kundenbereich Meldung Dabei Intrastat Shop News Begleitfahrzeug Durchfhrung Webseite Spezialservicewir
612 bm bodendesignat Produkte
bm Bodendesign Mittermayr...
bm-bodendesign.at Produkte Kautschuk Parkett Unternehmen Laminat Mittermayr Linoleum Bodendesign Galerie Gummi Bm Teppich Teambodendesignat
613 Margit Feyerer Fleischanderl Z
fey-flei.at Z Projekte Künstlerin Bilder Illustrationen Galerie Zeichnungen Satire Figuren Fleischanderl Grafikerinkunst Feyerer Margit
614 wwwff getzersdorfat Joomla
Joomla dynamische Portal Engine und Content Management System...
ff-getzersdorf.at Joomla Wwwff Getzersdorfat Portal Management System Content Galerie Mannschaft Getzersdorf Ff Feuerwehrjugendweb Wasserdienst
615 The Ferry Brothers Color
ferry-brothers.at Color Stadtfest Ferry Musik Ii Band Iii Videos Galerie Buchen Biographieferrybrothers Presse Rockhochzeit
616 buymanat photography by andreas Galerie
buyman.at Galerie Sport Infrarot Makros Ovh Natur Tiere Technik Fotografien Menschen Kaufmannandreas Galerien Panoramen
617 Megahockey Megahockey
Megahockey...
megahockey.at Megahockey Uber Galerie Onofflinesro Produkte Fanartkel Lieferung Jersey Webseite Entwerfen Verarbeitung Unsteamdressen Hilfe
618 Skischule Walchsee Skischule
schischulewalchsee.at Skischule Langlaufschule Skigebiet Alpin Standort Privatunterricht Snowboardschule Galerie Miniclub Walchsee Events Anmeldung Kinderz
619 Sportplatz Sportplatz
Sportplatz...
sportplatzwien.at Sportplatz Bilder Galerie Kick Sign Galerien Inhalt Hauptnavigation Bezirksauswahl Finaletrainerinnen Sportprogramm Presse Idee
620 Galerie
camping-ferienhaus.at Galerie Appartements Gäste Campingplatz Preisecamping Freizeitangebot Anfahrt Allgemein Campinganlage Debt Anlage Field
621 Index Wein
cafegalerie.at Wein Weutz Neumeister Umgebung Ernst Weninger Sekt Galerie Lieboch Umathum Paul Achsrosenberg Strablegg
622 Willkommen auf blende17 | Blende 17 Galerie
blende17.at Galerie Blende Styleshouts Colourise Menu Content Primary Main Gästebuch Webzernet Designblende | Website
623 wwwferienhaus zubrunnat Willkommen Joomla
Joomla das dynamische Portal Engine und Content Management System...
ferienhaus-zubrunn.at Joomla Port Anreise Preise Content Server Permanently The Engine Galerie Portal Wwwferienhaus Zubrunnatlage Management
624 melmalt Kunststation
Melitta Schischma und ihre künstlerischen Tätigkeiten...
melmalt.at Kunststation Melmalt Schischma Melitta Aktuell Werkzeugbilder Mel Galerie Fruchtfleisch Angern Pianospielerin Rochusbergmalt Ka
625 Cafe Frauenhuber Startseite Galerie
cafe-frauenhuber.at Galerie Chrome Found The Frauenhuber Chronik Different Tischreservierung Install De Portapache Reservieren Browser Office@cafefrauenhuberat
626 Home Bilder
Website der Bundesmusikkapelle Terfens News Bilder Berichte...
bmk-terfens.at Bilder Permanently The Einloggen Berichte Galerie Geschichte Passwort Vergessen Bundesmusikkapelle Website Server Registrieren Mitgliednews
627 Home | Los Mariachis Mariachis
mariachi-wien.at Mariachis Musiker Foto Galerie Mariachimusik Media Instrumente Angebot Einziger Losnegros Mariachigruppelos Impressum Sterreichs
628 Brunnhofer Galerie Galerie
brunnhofer.at Galerie Sommerpause Brunnhofer Linz Kunstmessen Vergangen Aktuell Timptner Irene Kommend Deutsch Lucasedition English
629 Weinbau Lozka Weinbau
Lozka Weinbau Weinbau Hannersdorf Werderits...
lozka-weinbau.at Weinbau Lozka Werderits Hannersdorf Anni Erich Winzerfamilie Auszeichnungen Weingut Weine Galerie Sonstiges Burgenlandwissenswertes
630 Maler Toth Startseite Toth
maler-toth.at Toth Maler Anfrage Leistungen Unternehmen Galerie Qualitt Stuck Einblick Kontakt Angebot Tapetenzgern Leistung_
631 Fredo Fredo
maler-fredo.at Fredo Galerie Bilder Formen Neuen Ausstellungen Gewohnheiten Netz Lange Bilderbei Pixelreduziert Meiner Farbenkontakt
632 in Neusiedl am See Neusiedl
boots-einstellplaetze.at Neusiedl Galerie Kroatien News Einstellpreise Winterlager Seewillkommen Hompagewir Preisenhallenpltzeabstellpltze Freigelnde See Sommer Halleund Boote Y
633 Reinhard Breitner Homepage Reinhard
Homepage von Reinhard Breitner...
breitner.at Reinhard Breitner Homepage Galerie Login Texte Schule Gedichte Start Malererei Grafikbilder Hauptschule Songs
634 Galerie
Maja Jahn freischaffende Künstlerin Kreativtrainerin Maltherapeutin...
maja-art.at Galerie Jahn Maja Wirken Bilder Freischaffende Galerien Maltherapeutin Mich Margit Maltherapieauftragsarbeiten Kreativtrainerin Termineseminare
635 Brauchtumsgruppe Lind Rajach STARTSEITE Brauchtumsgruppe
Aktivitäten einer Brauchtumsgruppe speziell der Brauch des Perchtenlaufen und Nikolo...
brauchtumsgruppe-lind-rajach.at Brauchtumsgruppe Lind Rajach Copy Mitglieder Galerie Geschichte Velden Krampusperchtenlaufen Nikolaus Perchten Devils Black
636 Hannes Lumpelegger Lumpelegger
lumpelegger.at Lumpelegger Hannes Werken Mail Texte Ausstellungen Akte Galerie Aktstudien Bewegung Wipplinger Clemenswipplingerinteresse Copyright
637 A B A Home Joomla
Joomla the dynamic portal engine and content management system...
bonsai-austria.at Joomla Newsevents Contact Aba Gallery Clubs Ebaesa Downloads Organisation Convention Galerie System Neuestelastportal
638 indexhtml Bretthauer
Benno Bretthauer...
bretthauer.at Bretthauer Zeichnungen Benno Comics Nachdrucke Veranwortlich Portraits News Tour Bilderinhalt Lebenslauf Individuellen Galerie
639 Simmeringer Haidechor Veranstaltungen
simmeringer-haidechor.at Veranstaltungen Pressebilder Galerie Verein Haidechor Simmeringer Mach Geschichte Hörproben Bildtonträger
640 Werkstatt für systemische Tun | Startseite Literatur
mantaja.at Literatur Werkstatt Systemisches Arbeit Systemische Outdoor Team | Menschen Galerie Alters Idiolektischen Plattform Systemischen Y
641 FIT HERMAGORAT Preisliste
fit-hermagor.at Preisliste Fit Hermagorat Foto Galerie Gymnastikplan Arcsin Khne Brigitte Mozilocms Designterminvereinbarung Fitdauerhaft Ernhrungstraining
642 Futus Futus
FUTUS Energiesysteme GmbH...
soplex.at Futus Energiesysteme Regelung Regelungs Team Galerie Request Produkte Steuerung News Anfahrterror Steuerungssysteme Rss
643 Home Malschule Pigneter Pigneter
malschule.at Pigneter Tirol Johann Malschule Kurs Fotos Reservierung Kurstermine Rudolph Email Bilderuns St Galerie
644 Sonntagalm Trattenbach Sonntagalm
sonntagalm.at Sonntagalm Anreise Galerie Trattenbach Alm übernachtenösterreich Mob Bruer Hansvenedigerstrae Neukirchen
645 Freiwillige Feuerwehr Obertiefenbach Freiwillige Feuerwehr Obertiefenbach Feuerwehr
ff-obertiefenbach.at Feuerwehr Freiwillige Obertiefenbach Jahrfeier Dazu Ausflug Hans Tipps Feuerwehrobertiefenbach Kirchengast Stubenberg Galerie Websitehomepage
646 Willkommen bei Sigrid Sobotka Sigrid
offizielle Homepage von Sigrid Sobotka...
sigrid-sobotka.at Sigrid Sobotka Ausstellungen Galerie Kunst Homepage Wassermann Wiener Sternzeichen Homeneustadt Copyright Rights Offizielle
647 Malerei Fina GmbH Standort
malerei-fina.at Standort Malerei Galerie Fina Leistungen Partner Team Agb Wissenswert News Meisterbetriebbildergalerie Uns Homeimpressum
648 Home Joomla
Joomla the dynamic portal engine and content management system...
fh-transporte.at Joomla Team Unternehmen Galerie Jobs System Fuhrpark Content Fh Transporteengine Dynamic Management Wwwjumiat
649 Culture Club Club
culture-club.at Club Culture Geschichte Anfahrt Feste Galerie Programm Knstler Theaterevents Entstehung Cluban Rahmenprsentationen Feiern
650 wwwmyrottiat Wwwmyrottiat
homepagezeushundrottweilerdogrottitierewelpewww.myrotti.at...
myrotti.at Wwwmyrottiat Galerie Rottweiler Zeus Homepage Mich Welpe Hund Tiere Rotti Dog Trotzdem Homeengerl Z
651 91EsV93 Clan News News
esv-clanpage.at News Team Clan Esv Fightus Userliste Newsarchiv Forum Galerie Sponsoren Joinus Einsenden Archivlinkus
652 ESV Krottendorf Esv
esv-krottendorf.at Esv Krottendorf Chronik Vorstand Mannschaften Ergebnisse Galerie Mariostefan Weingartmannund Patrick Besonderen Herzlichste Schwarzl
653 Willkommen Musikschule
musikschule-gnas.at Musikschule Musik Gnas Kinder Galerie Team Voranmeldung Homepage Smole_itdingen Gehirn Musikalisch Bildung Punkt
654 Herzlich Willkommen Ebensee
musikschule-ebensee.at Ebensee Seitenanfang Landesmusikschule Aktuell Schulgeld Verwaltung Galerie Unterrichtz Sommerferienzum Zeit Organisation Anmeldung Ferien Y
655 City Poker Poker
City Poker Die Alternative in Wien...
citypoker.at Poker City Citypoker Wien Galerie Spalte Fan Zweiten Wechseln Lugnerport Alternative Ersten Permanently The
656 Willkommen auf der Startseite Gossam
Offizielle Homepage vom Florianifest der Freiwilligen Feuerwehr Gossam...
florianifest.at Gossam Florianifest Feuerwehr Freiwillige Fest Ff Programm Grimsing Video Galerie Anfahrt Sponsorentemplde Template
657 City Dach City
citydach.at City Stellenangebote News Galerie Unternehmen Fassade Partner Dach Steildach Spenglerei Team Flachdachfr Kontakt
658 Home Model
Romy Epikureer Model Pictures...
romyepikureer.at Model Sedcard Pictures Romy Gästebuch Shootingbereiche Steckbrief Vertrag Epikureer Galerie Besucher Heuteinternet =
659 judith roither schachl artpage Galerie
roither-schachl.at Galerie Gästebuch Judith Aktuell Roither Virtuelle Schachl Sponsoren Presse Personartpage Webmaster Spezial
660 Naturstammhaus Kalkalpen Home Naturstammhaus
naturstammhaus-kalkalpen.at Naturstammhaus Kalkalpen Aufbau Galerie Haus Schmidthaler Wald Linkshtml Kontakt Natur Garnweid Franztrinker@speedatmobil
661 Lebensschmiede k u n s Lebensschmiede
die lebensschmiede besteht nun seit oktober 2000 und bietet verschiedenste kunsthandwerke von heinrich pansi vorwiegend in...
lebensschmiede.at Lebensschmiede Pansi Galerie Heinrichunserer Meinen Neben Bietet Veranstaltungen_ Veranstaltung Zeit Gartenplanung Hand Projekte
662 Galerie von Alois E Akt
endl-foto.at Akt Request Nginx Alois Kärnten Bodypainting Sport Abstrakt Galerie Portraitreisen Architektur Natur
663 Ricos World Ricos
ricko.at Ricos Download World Galerie Ricko Aktualisierung News Gstebuch Wolfgang Coming Bisher Wwwmatrixdesignat Umbaulatest
664 rifftaucherat Galerie
rifftaucher.at Galerie Philippinen Laune Sammlung Gestern Philippinenreise Dropdownfeld Aufbau Dorthomepage Lust Statistik Wasser User
665 Conspiracy Startseite Galerie
conspiracynet.at Galerie Conspiracy Uns Bitteunserer Austria Httpconspiracyaustriabandcampcom Bearbeitung Kürze Startseite *webseite Die Please Thrashdeathmetal
666 Willkommen im Gasthof Neupradl Gasthof
Gasthof Neupradl Essen und Zimmer Vermietung in Innsbruck im rustikalen tirolerischen Stil...
neupradl.at Gasthof Neupradl Zimmer Innsbruck Vermietung Nidy Design Essen Österreich Zentrumherzen Galerie Janesch
667 Robert Ganisl Robert
robertganisl.at Robert Mail Eyedea Werbeagentur Ganisl Galerie Unternehmen Handwerk Showroom Mondseeshowroom Schlosshof Gaisbergstrmondsee Rufen
668 Galerie | Bild Bank Wien | Klaus
bildbank.at Klaus Pichler Marketing Kunst Forum Bild Galerie Homepage Wien Website Kommunikation | Bank Coach
669 Herzlich Willkommen Fitness
starlife-gleisdorf.at Fitness Galerie Suspensiontraining Plate Belt Video Zumba Power Anmelden Jobs Leistungsspektrum Simply Teamfrenetic
670 christophknappat | Radio TV Moderator
christophknapp.at Moderator Christophknappat Radio Tv Proudly Tirol Wordpress Mediathek Unterwegs Inhalt Galerie Life |stadionsprecher
671 Christine Eichinger Fotografie Fotografie
christine-eichinger.at Fotografie Christine Eichinger Zitate Galerie Tauche Fotowelt Vergleich Begeisterung Objekten Handy Christinesblick Strahlen
672 Biohof Edibichl Biohof
bisonfleisch.at Biohof Edibichl Galerie Gästebuch Rezepte Lukas Altenmarkt Office@bisonfleischat Aktualisierung Letzte Kocherthenneberg Z
673 Made by you Linz Linz
Keramik selbst bemalen....
linz-madebyyou.at Linz Made Besuchen Keramik Voranmeldung Feiern Neuenwebshop Hufige Selbst Gemachtkeine Galerie Webshop Gruppen
674 Farben Helfer Lacke Dispersionen Anstrich Fassadenbeschichtung Farben
farben-helfer.at Farben Anstrich Produkte Galerie Port Lacke Fassadenbeschichtung Dispersionen Wandgestaltung Unternehmen Helfer Server Indivisualatfound The
675 schafellnerArt Schafellner
Diese Website zeigt alle Bilder und Daten von Guenther Schafellner in mehreren Galerien kann man sich diese genauer...
schafellnerart.at Schafellner Guenther Schafellnerart Günther Ansehen Galerien Bilderwebsite Zeigt Daten Menu Genauereren Galerie
676 Home Musikkapelle Neustift im Stubaital Neustift
Musikkapelle Neustift im Stubaital. meine Beschreibung...
mk-neustift.at Neustift Stubaital Musikkapelle Galerie Sponsoren Fest Foto Meine [] Chronik Mitglieder Tolles News Jugend
677 Startseite blackmoonranchs Webseite Moon
blackmoonranch.at Moon Ranch Black Uns Webseite Pferde Horsemanship Philosophie Seele Galerie Sponsorenprojekt Click Partner
678 MK Franking Startseite Franking
Willkommen auf der Homepage der Musikkapelle Franking...
mk-franking.at Franking Mk Musikkapelle Foto Galerie Chronik Vorstand Found The Foundlaquo Musik Server Dirigierworkshop Apache
679 Car Motion Motion
Joomla dynamische Portal Engine und Content Management System...
car-motion.at Motion Car Joomla Galerie News Leistungen Produkte Shop Engine Einbauten Mhlgasse Kundenfahrzeugeemail Diverse
680 Monika Dorninger Dorninger
monika dorninger malerei...
monika-dorninger.at Dorninger Malerei Monika Maler Venedig Acryl Ausstellungen Akt Zeichnung Galerie Homepage Toskanaburgenland Landschaft
681 Sandor Csok Sandor
Skulpturen von Sandor Csok...
sandor-csok.at Sandor Csok Skulpturen Steinskulptur Holzskulptur Impressum Zeichnung Bsten Galerie Steiermarkallg Skulpturallg Graz Grafik
682 Salzburgring
IGM Salzburgring 5325 Plainfeld...
salzburgring.at Salzburgring Reiner Plnefahrtraining Igm Streckeninfos Vip Galerie Karten Ansprechpartner Motorrad Rennen Automobil Version
683 Christine Cisarat Christine
Christine Cisar das etwas andere Portrait....
christine-cisar.at Christine Cisar Cisarat Photographie Galerie Etwas Sites Google Portrait Abuse Aktuell Herz__aufgooglesites Access
684 Herzlich Willkommen beim Motor Presse Klub Presse
Motor Presse Klub Austria...
mpka.at Presse Motor Klub Austria Spalte Zweiten Galerie Beimpixelweb Apache Server Permanently The Hauptnavigation Inhalt
685 Mozartgemeinde Wien
mozartgemeinde-wien.at Wien Mozartgemeinde Geschichte Auszeichnungen Wiener Mozart Figaro Mitgliedschaft Preise Vorstand Veranstaltungen Galerie Mozartsupdate
686 Home Joomla
chorneubau.at Joomla Module Icons Chor Repertoire Templates Social Galerie Themeglobe Joomlacomsponsored Wien Informationenhochwasserhilfesofort Neubau
687 Start expert_at Galerie
expert-foto.at Galerie Meine Cewe Entdecken Fotobuch Preisliste Mein Konto Wanddeko Lieferung Fotogeschenken Postkarte Fotosauftragssuche
688 Salsastudio Home Salsa
Salsa Studio...
salsastudio.at Salsa Salzburg Sbg Events Workshops Salsastudio Galerie Salsasbg Salsaclub Gt Schatzkammer Club Seitgrnder
689 Willkommen auf der Seite der Mortantscher Mortantscher
Mortantscher Plattler...
mortantscherplattler.at Mortantscher Plattler Spalte Tradition Videos Port Showprogramm Inhalt Ersten Portrait Galerie Hauptnavigationabmelden Server
690 Morrigain Auftritte
morrigain.at Auftritte Galerie Tanz Archiv Morrigain Unterricht Biografie Workshops Sagya Restaurant Liechtensteinstrasseauftritt Uhr Wien
691 Mike Ranz Photograph Mike
Mike Ranz Photograph Fotograf...
mikeranz.at Mike Photograph Ranz Fotografie Photography Oesterreich Medienkunst Austria Collections Galerie Fotografgallery Kunst Sammlung
692 Startseite Siebdruck
goldstein.at Siebdruck Serverport Apache Print Webdesign Found Design Textilveredelung Downloads Galerie Agb Displays Vorteile
693 Kesselreinigung Krassnig CALCIDEX Krassnig
kesselreinigung-krassnig.at Krassnig Kesselreinigung Calcidex Website Free Templates Hallegger Javascript Krassnigat Galerie Designedfax Copyright Bankdatenkontaktdaten
694 humtata Archives
__DESCRIPTION__...
humtata.at Archives Humtata Notizen Galerie __description__ Permanently The Jahres Words Article Meisterwerk Textpattern Talkpressdieses Cms
695 STEIERMÄRKISCHER KUNSTVEREIN WERKBUND Werkbund
werkbund.at Werkbund Steiermärkischer Kunstverein Galerie Mitglieder Vorstand Graz Email Telefonstmkkunstverein@utanetatheinrichstraße
696 Werner Oskar Jilge Werner
woj werner oskar jilge selbstdarsteller wien langenzersdorf...
werner-oskar-jilge.at Werner Jilge Galerie Oskar Mail Lebenslauf Woj Langenzersdorf Club Wien Selbstdarsteller Fan Pauseansonsten
697 Atelier Monika Schwinner Kunst
ölbilder Gemälde Galerie abstrakt...
atelier-schwinner.at Kunst Schwinner Monika Galerie Bilder Kaufen ölbilder Atelier Abstrakte Steckbriefmalerei Art Abstrakt Z
698 IngHans Huber Huber
Website von Ing. Hans Huber und Elisabeth Huber...
huinfo.at Huber Elisabeth Galerie News Inghans Klampfer Foto Hans Grabtuch Video Website Grillparzer Last Vw Y
699 HOME Spirit
western-spirit.at Spirit Band Songs Westensundinterpreten Fotos Fotogalerie Veranstaltungen Interesse Gren Zeltfesten Club Galerie Gospelsongs
700 Heeressportverein WELS Permanently the
hsv-wels.at Permanently The Wandern Sites Wels Zweigvereine Uns Jahresprogramm Heeressportverein Wintersport Apache Serverport Vereinsvorstand Galerie
701 Home Hirschwell
discogig.at Hirschwell Gig Event Location Pizzeria Hit Roma Shuttle Galerie Rapper Cubes Amstetten Oktoberfestbier
702 tomgadnerat Startseite Galerie
Schnell Unkpmpliziert Bezahlbar...
tomgadner.at Galerie Leistungen Mich Fotodesign Hastbis Bilder Paar Schnell Tomgadnerat Entsteht Fotodesigner Unkpmpliziert Einfachstartseite *
703 Atelier Katharina Lindinger Atelier
Atelier Katharina Lindinger...
atelier-lindinger.at Atelier Katharina Lindinger Galerie Lebenskunst Karten Kunsttherapie Kurse Mich Partner Dominxcm Puppenkleider Stadtgeheimnis
704 Weinhof Prettner Buschenschank
Weine Buschenschank Glanz Steiermark...
weinhofprettner.at Buschenschank Produkte Prettner Weinhof Ferienhaus Familie Veranstaltungen Brennerei Glanz Weine Galerie Weinstrasse Steiermarkwein
705 Weinbau Wittmann Heuriger
weinbau-wittmann.at Heuriger Weinbau Weine Betrieb Verkauf Wittmann Galerie Webshop Anfahrt Poysbrunnweinejwittmann Märchendorf Gut Z
706 Aktuelle Angebote Angebote
traumankerstrategie.at Angebote Galerie Strom Mein Akttion Agb Cashback Rolle Autortraumankerstrategieeine Weg Version Bildern Gelangen
707 Startseite Galerie
traum-bilder.at Galerie Maltechniken Webdesign Wien Ausstellungen Besuch Webseite Machen Bildern Rath Galeriennachricht Mich Erfahren
708 ALIVE | Ab 1 Juli im Alive
ALIVE Ab 1. Juli im Kino...
alive-derfilm.at Alive Kino | Ab Inhalt Presse Kinofinder Galerie Juli Trailer Thimfilm Nikz Minarolli Film
709 Galerie Feurstein Raum aktueller Galerie
galeriefeurstein.at Galerie Feurstein Mob Kunst Feldkirch Raum Vereinbarung Aktueller Juliaugust Rauminstallation Copythierry Strhle Kreuzgasse
710 Donabaum Donabaum
weingaertnerei.at Donabaum Weine Galerie Wachau Heuriger Anfahrt Lebensfreude_ _ Heurigentermine Willkommenwinzer Bedeutet Berufunglinksberuf
711 stadtgalerie schwaz Schwaz
galeriederstadtschwaz.at Schwaz Editionen Stadt Server Archiv Found The Galerie Oswald Programm English Oberhuber Stadtgalerie Apacheversion
712 Alfred Löscher Alfred
Website Alfred Löscher Freischaffender Künstler...
alfredloescher.at Alfred Löscher Lscher Galerie Malerei Künstlergraz Websitefreischaffender Abstrakt Großformat
713 Herzlich Willkommen in der Galerie Weber Weber
Atelier und Galerie für Malerei und Keramik Ulla und Helmut Weber Zwettl an der Rodl Mühlviertel Oberösterreich...
atelier-galerie-weber.at Weber Galerie Atelier Helmut Ulla Malerei Zwettl Keramik Mühlviertel Rodl Bild Linzbilder Z
714 Weinbauverein Brunn Familie Niegl Familie
weingut-niegl.at Familie Webshop Niegl Brunnatport Pfeaschawein Geschichte Galerie Wein Weinwanderweg Apache Kartendarstellung Fenness Brunn
715 Trachtenmusikkapelle Schleedorf Schleedorf
tmk-schleedorf.at Schleedorf Pfarrkirche Trachtenmusikkapelle Feldkirchen Unser Turmblasen Datum Konzertwertung Salzburg Mitglieder Galerie Beginnmesse Veranstaltung
716 Internes
kgvsuezbreitenlee.at Internes Kalender Homepage News Vereinsleitung Tipp Galerie Cabanova Geschichte Gaestebuch Letzte Kleingartenvereinsport Breitenlee
717 whitecubeat Home Lukas
whitecube gallery from lukas eggerstorfer...
whitecube.at Lukas Galerie Fotoseite Homepage Whitecube Viel Whitecubeat Endlich Eggerstofer Betrachteneggerstorfer Webseite Bilder Kunst
718 Kurt Graf Kurt
Kurt Graf aus Langschlag beschäftigt sich schon seit Jahren mit der Disziplin Holzsport...
holzsport.at Kurt Graf Holzsport Langschlag Eurojack Timbersport Bhak News Jahren Seit Waldviertelzwettl Galerie Disziplin
719 Galerie IMPACT Galerie
Galerie IMPACT Jutta Hutterer Austrian Art...
galerie-impact.at Galerie Impact Click Austrian_art Gallery Aquarell Wien Paintings Kunstwiener_neustadt Art österreichische_kunst Here Water_painting
720 Austrian Fine Art Galerie
austrianfineart.at Galerie English Aktueller Katalog Werke Künstlerindex Austrian Ankauf Fine Uns Knstlerindexpresse Art
721 Startseite Damwild
Joomla dynamische Portal Engine und Content Management System...
wildgehege-schober.at Damwild Rotwild Joomla Galerie Muffelwild Portal Wildgehege Franz Teilen System Enginecontent Management Mufflon
722 Startseite Haus
gruber-central.at Haus Mayrhofen Appartements Ferienregion Unser Galerie Ski Zillertals Eislaufplatz Ahornbahn Sportartikel Schwimmbad Einkaufsstrasseinhalt
723 Auto Frohn Frohn
auto-frohn.at Frohn Team Galerie Firmengeschichte Autohaus Lageplan Gebrauchtwagen Partner Auto Tuning Gebrauchtwagenankauf Ffnungszeiten Verkauffinanzierungsservice
724 Andreas Kogler Andreas
ae100.at Andreas Kogler Presseartikel Galerie Angebote Interpretationen Kogleroldo Lubicholdo Tonträgertontrger Lubichfrank Sinatra
725 Galerie Zimmermann Kratochwill Home Zimmermann
galerie-graz.at Zimmermann Galerie Kratochwill Deutsch Without Goscinski Cooperations Represented Home Program Sofia Works Contacthead Past
726 Home Galerie
timmy.at Galerie Eindrücketripple Besuch Timmy Welgersdorfer Neo Welgersdorf Angefangen Ostern Kontaktdaten Gebenwwwbundeslandat
727 Holzbau Gobauer Home Holzbau
holzbau-gobauer.at Holzbau Paletten Gobauer Philosophie Galerie Zufriedenheit Von Terassenbden Holzrahmen Preis Bis Home * Pergolaeinreichplanung
728 Willkommen auf der Startseite Malerei
Malerei Andrea Fuchsberger...
afuchsberger.at Malerei Gestaltherapie Galerie Mal Ausstellungen Vergangene Events Rights Mich Formgewordene Malen Sehnsuchtfuchsberger Dorothea
729 Startseite Gtgtgt
filmbau.at Gtgtgt Anfrage Dekoteile Filmographie Galerie Requisiten Unser Team Textversion Kommenden Tage Geisterflotterechte Trailer
730 Hotel Vienna Vienna
hotelvienna.at Vienna Hotel Buchen Zimmer Direkt Specials Inhalt Galerie Hotelbar Buchungsplatt Vergleich Internetaustria Stadtgutgasse
731 Green Apple 1030 Wien Apple
Green Apple ist ein asiatisches Restaurant in 1030 Wien mit Lieferservice. Einfach online Essen bestellen und vomZustellservice Green...
greenapple-asia.at Apple Green Wien Greenapple Lieferservice Speisen Asiatisches Restaurant Lokal Essen Galerie Asiarestaurant Asiaatwwwmjamat
732 Der Schnee am Kilimandscharo | Ab Schnee
Der Schnee am Kilimandscharo Ab 16. März im Kino...
kilimandscharo-derfilm.at Schnee Kino Kilimandscharo Trailer | Ab Presse Inhalt Galerie Kinofinder Thimfilm Im Deutscher Arsenal Y
733 Tischlerei Wieland Herzlich Willkommen Wieland
Startseite Willkommen in der Tischlerei Wieland Ihr Spezialist für Altbausanierung Kastenfenster amp Individuellen...
tischlerei-wieland.at Wieland Tischlerei Kastenfenster Produkt Galerie Individuellen Altbausanierung Neuer Spezialist Ruhekissen Markt Willkommen * Ihrfachbetrieb
734 Galerie Krinzinger Chan
galerie-krinzinger.at Chan Galerie Chie Residency Krinzinger Hungaryadi Vasileva Austriawilliam Eisenbergerthean Bernd Mekasi Stela Oppl
735 Grillenberger Eventat Home Grillenberger
Die Grillenberger Event GmbH ist Ihr vielseitiger Ansprechpartner für Gastronomie und Eventorganisation....
grillenberger-event.at Grillenberger Event Ansprechpartnerkoch Gastronomie Ihr Sommernachtsball Eventat Galerie Basilikum News Balance Vielseitiger Leistungen
736 Grillhorns Grillmeisterschaft
grillhorns.at Grillmeisterschaft Grillkurs Rarr Fortgeschrittene Apache Aba Grillworkshop Galerie Beschreibung Grillteam Grillhorns Schmankerlfass Grillerport
737 Kindergarten Marianne Home Marianne
kindergartenmarianne.at Marianne Kindergarten Bergmann Christoph Homepage Gruppen Galerie News Philosophie Murauer Kinder Eindruck Kindergartenplatzsuchencopyright
738 Moden
ag-moden.at Moden Ag Firmen Markt Deutschland Rabatte Angebot Wirsind Mglichkeitvon Firmapreisverhandlungen Galerie Mengen Interesse
739 Willkommen Organisation
kinderwinkel.at Organisation Partner Galerie Team Sponsoren Paumldagogik Montessori Grätschenwinkelkinderwinkel Wild Kinderwerkstatt Pikler Z
740 Galerie Home Galerie
Galerie...
galerie-aw.at Galerie Winnicki Kunst Geschmack Meinen Besttigen_ Maler Groteskes Bilder Armin Gezwungen Gedankenbigbenst Widersprechen
741 Katrin Koch hairdesign Koch
katrinkoch.at Koch Katrin Partner Anfahrt Uns Galerie Designed Stylisten Nehmen Seiten Kontakt Rightszeit Einblick
742 GtVSJagdgasseat Gtvsjagdgasseat
jagdgasse.at Gtvsjagdgasseat Aktuell Fotos Gstebuch Ganztagsvolksschule Jagdgasse Galerie Angebote Tragen Empfohlene Team Klassenkurzinformation Sportfest
743 Willkommen bei Panorama Telfs Topfield
Besuchen Sie Telfs und Umgebung als virtueller Tourist...
virtualtourist.at Topfield Telfs Panorama Virtueller Tourist Galerie Mode Httpwwwapplecomquicktimegallerycubicvr Coltd Mail Deutschsprachige English Hilfe
744 GALERIE JÜTTNER Jüttner
Millergasse 25 1060 Vienna...
juettner.at Jüttner Galerie Cssjockey Wordpress Login Powered Vienna Connectprogress Stay Work Millergasse Backend
745 BFG Login
gildenball.at Login Name Partner Faschingsgesellschaftschillerstraße Gildenball Bregenzer Mail Pehr Bfg Oberstleutnantbregenzwebmaster Alexander Galerie Verein
746 Julia Svoboda Photography Julia
Julia Svoboda Photography Fotografie Web Design...
julia-svoboda.at Julia Svoboda Design Web Galerie Photography Retusche Henri Seele Photographyfotografie Photographie Schibratauge Bresson
747 ARS NOVA Home Nova
Ars Nova die Kunstagentur...
arsnova.at Nova Ars Kunstagentur Claudiana Kunstverein Galerie Hackl Kompetenzportrt Kunstgalerie Skulpturen Herbert Mensch Kunsthandel
748 Hundesalon HUND HAAR Hund
Hundesalon Hund Haar immer für Sie da...
julias-hundesalon.at Hund Hundesalon Haar Salon Hundehaare Entwollen Galerie Da Haare Schillab Trimmen Julias Immerpreise
749 Antonia Wöhrer Art Galerie Galerie
Antonia Wöhrer Art Galerie...
art-antonia.at Galerie Wöhrer Antonia Art Kreativtraining Antoniaat Namaste Zantonias Rose Graz Wwwart Kunst
750 VIT DRIVE Drive
Vit Drive...
vit-drive.at Drive Vit Bildung Berufskraftfahrer Design Auszahlt Internet Free Fahrtechniksicheres Geld Galerie Training Verdienen
751 Home Praxis
Praxis für Hundephysiotherapie und Rehabilitation für Hunde in Innsbruck...
vitality4dogs.at Praxis Innsbruck Hundephysiotherapie Leistungen Vierbeiner Workshops Anfahrt Therapieablauf Unterwassertherapie Tierphysiotherapie Rehabilitation Galerie Kostenerfahrungsberichte
752 Art of Jull Jull
art-of-jull.at Jull Art Deutschland Newws Galerie Objekte Tilly Ereignis Mscorporate Prominenz Ibiza Design Interieur
753 joshuas catering und partyservice wien Catering
Since 2008 Joshua has run the catering business by himself emphasizing unique combinations of ingredients and cooking methods...
joshuascatering.at Catering Events Locations Partyservice Galerie Kochkunst Wien Offering Each Feiern Himself Büfett Thus Dishes Ingredients
754 Gigi Jansa Bildhauerin Jansa
Gigi Jansa Bildhauerin 5020 Salzburg...
gigi-jansa.at Jansa Gigi Bildhauerin Salzburg Inhaltrestaurator Muschelnkünstlerin Arche Bergheim Skulptur Galerie Bildende
755 Startseite Tcore
T3core Basis...
verita.at Tcore En Apache Privat Incoreat Port Film Musik Basis Galerie Permanently The Swing Theaterbio
756 Home Oben
gerd-koch.at Oben Springen Seitenende Katalog Galerie Navigation English Firma Inhalt Deutsch Italiano Spracheinstellungen Sprachauswahl *z
757 vespastadlat Vespa
vespastadl.at Vespa Shop Werkstatt Fahrzeuge Galerie Reparatur Vespaverkauf Reparaturen Baujahr Rollerverkauf Vespastadl Adressemeine Vespas
758 brigitte hauck delmondo Hauck
Zeichnen Malen Kreativ sein. Website und virtuelle Galerie der Künstlerin und Kunsttherapeutin Brigitte Hauck...
hauck-delmondo.at Hauck Delmondo Galerie Brigitte Kunsttherapie Kunst Ausstellungen Acrylmalerei Virtuelle Website Akt Kunsttherapeutinsalzburg Malen
759 Anno 1900 Antiquitaeten aus Wiener
Kunstliebhaber und Sammler finden in meiner Galerie auf mehr als 200 Quadratmeter Ausstellungsflaeche eine grosse Auswahl an Originalobjekten...
anno1900.at Wiener Deco Wien Art Antiquitaeten Auswahl Quadratmeter Meinerhin Jugendstils Hagenbund Galerie Zeit Anno
760 archi64 indexhtml Ziviltechnikerin
architektur64.at Ziviltechnikerin Arch Fax Kothgasser Indexhtml Arbeit Daniela Reisinger Gleisdorf Diplhtl Pernerat Archiing Galerie
761 Kontrapunkt Food
Kontra Punkt Kontrapunkt vinssimo Vinothek Restaurant Slow Food...
vinissimo.at Food Vinothek Restaurant Slow Kontrapunkt Essen Galerie Catering Punkt Vinssimo Vino Wine Weinslowfood
762 Gasthaus Atzmüller Server
gh-atzmueller.at Server Grillabendkarte Kulinarisches Galerie Found The Apache Gtgt Gtgtunsere Veranstaltungen Unser Speisekartefound Haus Port
763 Ursula Kunst im Leben | Startseite Galerie
Online Galerie rund um Bilder Kunst und Handbemaltes...
ursula-kunst-im-leben.at Galerie Kunst Leben Ursula Handbemaltes Bilder Rahmen Kunstwerk Öl Ursuladraxler Malen Rund | Aktuelles_bemalen
764 GALERIE JOHANNES FABER | KOPPITZ Faber
Fotogalerie Faber mit wechselnden Ausstellungen Schwerpunkte sind österreichische und tschechische Fotografie der Klassik und Gegenwart. Gallery faber has...
johannesfaber.at Faber Johannes Galerie Wien Fotogalerie Exhibitions Gallery Koppitz Vienna Fotos Gegenwart Exhibtions |tschechische
765 Home Strasshof
inside2231.at Strasshof Forum Nordbahn Informationsaustausch Galerie Strasshofer Plattform Sstrasshof Pressecommunitybildung Besonderen Deiner Strasshoferinnen Interessierte
766 JVP Bergland Petzenkirchen Bergland
Joomla the dynamic portal engine and content management system...
jvp-bergland-petzenkirchen.at Bergland Petzenkirchen Joomla Passwort Galerie Login Portal Engine Registrieren Management Vorstand Veranstaltungen Benutzerdynamic
767 Ulli Klepalski Willkommen Klepalski
Ulli Klepalski...
ulliklepalski.at Klepalski Ulli Ausstellungen Projekte Reflexionen Bilder Raum Skulptur Biografisches Galerie Design Kunstausstellung Skulpturen
768 Walter Strobl Walter
Homepage des Malers Walter Strobl...
walterstrobl.at Walter Strobl Grafik Lebenslauf Texte Malerei Akt Galerie Druckgrafikfabrik Oesterreich Gemaelde Radierung Werke
769 Artspectra Artspectra
Artspectra...
artspectra.at Artspectra Praskac Tulln Keramik Ausstellungen Vielfalt Kunst Margit Galerie Besuch Firmaausstellungsanfragen Derzeit Homepage
770 Willkommen im Hotel Alte Post in Hotel
Webauftritt des Hotel Alte Post...
altepost-krems.at Hotel Alte Post Krems Restaurant Empfehlung Galerie Anfahrt Speisekarte Obere Wachau Weinherbsturlaub Bienvenue
771 Willkommen bei Galerie M Galerie
Willkommen bei Galerie M...
galeriem.at Galerie Kunst Magistris Margarete Galeriem Objektkunst Bildhauerei Fotografie Bildende Zeitgenoessische Grafikangewandte Film Design
772 Startseite Galerie
Maler und Anstreicher in Niederösterreich...
goerlich.at Galerie Leistungen Maler Anstreicher Mich Passwort Roschdesign Benutzername Marmorspachtel Stockerau Anstreicharbeitengeht Stuck Bezirkinternetseite
773 we workshops for entrepreneurs Join
Intro...
we-workshops.at Join Archiv Downloads Idee Galerie Kosten Programm Workshops Anmeldung Vortragende Teilnahme Veranstalter Introentrepreneurs
774 TPE News News
tribal project eventmanagement...
tribal-project.at News Tpe Tribal Project Partner Weblinks Multimedia Team Galerie Presse Vorschau Dj Eventsltlt
775 HUTkultur Maria Wolschart Galerie
hutkultur.at Galerie Verein Programm Mitglieder Archiv Hutkultur Maria Wolschart Faiasalamanda Szabolcs Beginnnagy Stimmung Volles
776 Willkommen auf der Startseite Golden
Golden Retriever vom Goldberg...
goldberghunde.at Golden Retriever Goldberg Welpen Schiedlberg Oberösterreich Galerie Wurfplanung Hunde Newsbillingswesen Uns
777 ASK Nettingsdorf Badminton Schnuppern
ask-nettingsdorf-badminton.at Schnuppern Nettingsdorf Badminton Galerie Mitglieder Shop Vereinsmeisterschaft Ask Victor Beitrag Turnierergebnisse Medienagentur Kontakt Rechtevorbehalten Y
778 Walters Burgrestaurant Burgrestaurant Obervoitsberg Burgrestaurant
walters-burgrestaurant.at Burgrestaurant Presse Restaurant Weinkarte Galerie Walters Obervoitsberg Speisekarte Voitsberg Restaurantfhrerakellergewlbe Burgtavernevom Angebot Feiern
779 Start GLASEREI STEINBRUCKNER Inhaber Wilfried Krasensky Steinbruckner
None...
glaserei-steinbruckner.at Steinbruckner Glaserei Wilfried Inhaber Krasensky Leistungen Galerie Login Panoramen Traun Start Bilderrahmen Werkstttereparaturverglasungen
780 Karten Mayrverlag Home Karten
Karten Mayrverlag...
innsbruckplan.at Karten Mayrverlag [] Uns Sonderprodukte Port Waltermayr@kompassat Apache Galerie Permanently The Mayrverlagat Kontaktieren Httpwwwkartentouren
781 VW Audi Club Defender Audi
vw-audi-club-defender.at Audi Defender Club Mitglieder Vw Galerie Sponsoren Events Clublokal Gästebuchwebsite Kontakt Gstebuch Z
782 Pepe
Die Website von Udo und Pepe Narrisch Guat...
udo-pepe.at Pepe Udo News Video Narrisch Guat Galerie Faschingsquintettcabarett Quintett Lachen Harmonie Gilde Interview
783 Web Seite Galerie
vws-breitfuss.at Galerie Vollwrmeschutz Web Saalfelden Fassadenausbesserungen Breitfuss Isoliertechnik Arbeitsleistungenziel Preisen Wohnhaus Umbauarbeiten Einsatzmodernster Ausfhrung
784 Karten Mayrverlag Home Mayrverlag
Karten Mayrverlag...
innsbruck-plan.at Mayrverlag Karten Uns [] Httpwwwkarten Mayrverlagat Galerie Stadtplan Produkte Kontaktieren Permanently Thesonderprodukte Apache Port
785 KAMERA CLUB Inzing Home Httpwwwkameraclubatimagesjenewein_ireneschottland_irene_schottlandjpg
kameraclub.at Httpwwwkameraclubatimagesjenewein_ireneschottland_irene_schottlandjpg Galerie Inzing Kamera Club Programm Chronik Webforum Vorstandclublokal Verein Mitglieder Herbstprogrammteilnehmerinnen_ Clubmitgliedern
786 Am Ende des Tages | Ab Tages
Am Ende des Tages Ab 26. August im Kino...
am-ende-des-tages.at Tages Kino Ende Ab | Musikvideo Inhalt Presse Galerie Kinofinder Besetzung Schwarzpayer Film Trailer
787 Willkommen auf der Startseite Gästebuch
Tuning Garage...
tuning-garage.at Gästebuch Weblinks Mitglieder Suchebiete Video News Garage Galerie Unstuning Hauptmenü Auro Z
788 TU Ball Karten
tu-ball.at Karten Geschichte Deutsch Galerie Anfahrt English Ball Saalplan Musikprogramm Eröffnen Tuz
789 Woche des Waldes Woche
waldwoche.at Woche Waldes Programm Galerie Presse Organisationen Rolle Erholungsraum Waldfest Bedeutung Waldtrinkwasser Alpenraum Wirtschafts
790 Weinbau Schweighofer Schweighofer
weinbau-schweighofer.at Schweighofer Zistersdorf Betriebfamilie Weine Alte Galerie Buschenschank Marktstrae Weinbau Buschenschankterminflasche Pasteur Kontakt Johann
791 Home Triathlon Team Wolfsberg Wolfsberg
STO Triathlon Team Wolfsberg ist eine Plattform für alle Triathloninteressierten im Lavanttal. Finde Informationen über Athleten Ergebnisse Termine...
wolfsberg-tri.at Wolfsberg Triathlon Ironman Team Norwegen Ergebnisse Athleten News Navigation Sponsoren Verein Galerie Informationenplattform
792 Fritz Marko Lebensart Marko Marko
Willkommen bei Fritz und Tanja Marko Lebensart Marko. Arbeiten in Öl auf Leinwand Platte und Holz in Verbindung...
fritzmarko.at Marko Lebensart Fritz Tanja Holz Wwwfritzmarkoat Leinwand Kunst Platte Arbeiten Steinmobile Galerie Verbindung
793 Battalion666 Battalion
battalion666.at Battalion Bilder Mhein Sports Ausarbeitung Betreten Airsoftteams Einstellungeninternetauftritt Erwerb Galerie Link Waffen Erklrung
794 WOHNTIPPat Motiv
wohntipp.at Motiv Halter Wohntippat Eichenholz Preis Galerie Beispiele Motive Höhe Tiefe Kinderschreibtisch Material Agbbht
795 SCHüLERHEIM DER HTBLA HALLSTATT Hallstatt
SCHÜLERHEIM der HTBLA Hallstatt Malerweg 173 4830 Hallstatt...
hallstattn.at Hallstatt Htbla Schlerheim Schülerheim Personal Chronik Galerie Anreisetag Copyright Homepage Schlerheimesimpressummalerweg
796 Babykarten Hochzeitseinladungen Einladungskarten Weihnachtskarten Taufkarten Danksagungskarten |
xlfoto.at | Faqs Mein Meine Kurzanleitung Babykarten Galerie Account Hochzeitseinladungen Hochzeit Einladungskarten Weihnachtskarten Taufkarten Papierauswahl Y
797 baskets basketsat Spielplan
baskets.at Spielplan Eisenstein Archiv Server Sponsoren Teams Port Neuigkeiten Anmeldeformular Textil News Galerie Downloadopensslemod_hcgi
798 Bassena Badmanufaktur Förderungen
bassena-bad.at Förderungen News Leistung Leitbild Traumbad Badmanufaktur Galerie Bassena Ihr Alt Altmach Machbad
799 Tina Bayer Physiotherapie Bayer
therapie-bewegt.at Bayer Philosophie Physiotherapie Tina Galerie Energie Mail Biografie Therapie Wienvoranmeldung Bewegtat Diplphysiotherapeutin Christina
800 Panaceo TennisBase Villach Die Tennisbase
Panaceo TennisBase Villach...
tennisbase.at Tennisbase Villach Panaceo ] Team [ Plattform Jugendliche Dobnig Stefan Galerie Lagler Spieler Trojani Turnieren
801 Zirbitzflieger Zirbitzflieger
zirbitzflieger.at Zirbitzflieger Intern Idrosee Specials Zirbitz Tandemflug Meduno Videos Fotos Galerie Flugregeln Wettersponsoren Zirbitzfliegerhymne
802 photographie hannes eichinger Contact
hanneseichinger.at Contact Blog Kids Living Weddingshootings Baby Family Galerie People Interieur Food Photographiehannes Gehts
803 hainbachat Home Anmeldung
hainbach.at Anmeldung Galerie Direkt Hauptnavigation Inhalt Ansichtssuchenavigationsuchen Woche Insgesamt Hainbach Monat Heute Joomla Dorffest
804 Galerie Krinzinger Krinzinger
galerie-krinzinger.at Krinzinger Residency Galerie Stela Matei Jonas Vienna Lift Wine Residencysrifriendsapril Vasileva Glas Oppl
805 Kreativfunke Home Raum
kreativfunke.at Raum Kreativfunke Jump Galerie Projekt Kinderecke Programm Ideen Searchnavigationsearch Preisebitte Uns Contentanfrage Javascript
806 Band
thedreamcatchers.at Band Downloads Dream Galerie Profil Presseinformation Catchersacoustic Catchers Cajon Myspace Geige Finden Klaviergitarre
807 Koutek Partner News
koutek-keg.at News Galerie Incentives Conventions Partner Koutek Meetings Events Gt Welt Momente Leben Madeerlebe
808 Honigland Honigland
hesch.at Honigland Galerie Auszeichnungen Shop Rudi Bienenzucht Silvia Aufbautagen Bitteweyer Imkerei Heschwillkommen  
809 home Dieter Kschwendt Michel Deutsch
kschwendt-michel.at Deutsch Bühne | Audio Derzeit Video Download Leben Repertoire Galerie Michelkritiken Projekte English
810 Home Joomla
Joomla dynamische Portal Engine und Content Management System...
fritzheininger.at Joomla Fritz Presse Art Galerie Ausstellungen Biografie Malerei Login System Managementdynamische Wien Content
811 Home KRAMURI Galerie
kramuri.at Galerie Agb Loginbereich Blog News Permanently The Made Kramuri Port Rsaquo Allgemein Uarr Simpleupload
812 Kontrapunkt Kontrapunkt
Kontra Punkt Kontrapunkt vinssimo Vinothek Restaurant Slow Food...
kontra-punkt.at Kontrapunkt Food Galerie Lokal Slow Vinothek Restaurant Extremschrammeln Vino Neuwirth Weinwine Kontra Mi
813 wwwhans reitbauerat Hans
Hans Reitbauer 8190 Birkfeld Kaiserfeldgasse 15...
hans-reitbauer.at Hans Reitbauer Wwwhans Reitbauerat Birkfeld Kaiserfeldgasse Ikonenbilder Galerie Login Hauptmenüdesign Rechtecopyright
814 Willkommen beim Xavers Joomla
Joomla dynamische Portal Engine und Content Management System...
xavers.at Joomla Xavers Standardkarte Beim Anfahrt Events Galerie Wochenkartedynamische Hauptmenüsystem Portal Content
815 Knausserwald Penz | Because now Shorthorn
knausserwald-penz.at Shorthorn Penz Verkaufen Hochlandrinder Betrieb Galerie Knausserwald Unser Because Einloggen Bericht Kleinen Unter Familie |
816 Klub Kragujevacki Kragujevacki
Copy Cut Klub kragujevacki serbien serben Mattersburg Österreich Burgenland...
klub-kragujevacki.at Kragujevacki Klub Copy Galerie Österreich Burgenland Serben Serbien Mattersburg Cut Sponsorensonstiges Bilder Z
817 High Hill Ranch Hill
highhillranch.at Hill Ranch High Paint Guestb Horses Pferde Galerie Trail Anlage Kuntner Franzaktuell Hildegard
818 Bilderspiegel Heiner Zimmermann Heiner
heiner-zimmermann.at Heiner Zimmermann Bilderspiegel Kunst Klagenfurt Galerie Glas Knife Ferlach Tod Werkeauergasse Komposch Leben
819 home atelier art wallerseeat Homepage
home...
atelier-art-wallersee.at Homepage Atelier Software Henndorfmobiltel Shop Copyright Texte Anfahrt Pache Galerie Kaisergtla Letzte Literaturmariehujo
820 Team Just4Fun Team
Team Just4Fun Weil der Spaßfaktor zählt Die Team Seite von Liebhabern des lauten Basses...
teamjust4fun.at Team Justfun Db Galerie Klicke Drag Bilder Designsserver Found The Terra Wettbewerb Bassrace Dezibel
821 Galerie Hofkabinett Linz Linz
hofkabinett.at Linz Bitte Eintreten Kunstgeschenke Fischnaller Josef Altstadt Vernissage Galerie Bronze Oberoesterreich Hofkabinett Kunstbronzeplastiken
822 GALERIE JOHANNES FABER | KOPPITZ Faber
Fotogalerie Faber mit wechselnden Ausstellungen Schwerpunkte sind österreichische und tschechische Fotografie der Klassik und Gegenwart. Gallery faber has...
jmcfaber.at Faber Galerie Johannes Wien Fotogalerie Gallery Koppitz Exhibitions Vienna Wechselnden Fotos österreichischeexhibtions Has
823 Allgemeines Startseite Veranstaltungen
Gemeinde Krumegg Aktuelles Immobilien Veranstaltungen Vereine etc....
krumegg.at Veranstaltungen Vereine Immobilien Krumegg Gemeinde Allgemeines Wirtschaft Galerie Javascript Umgebung Adresse Mail Gesundheitfax
824 Herzlich Willkommen Herz
wirtschaft-mit-herz.at Herz Spenden Veranstaltungen Solltest Galerie Anstehende Gstebuch Gemeinde Benefiz Zweck Team Allgemein Organisatorenzusammenschlu
825 Wunsch Galerie Hochzeitstisch Hochzeitsliste Hochzeitstisch
Hochzeitstisch oder Hochzeitsliste kostenlos online erstellen und Geschenkideen dem Wunschzettel mit dem Geschenkefinder aus jedem Shop der Welt...
wunschgalerie.at Hochzeitstisch Wunschzettel Geschenkideen Hochzeitsliste Geschenkefinder Leerer Beispiel Galerie Wunschliste Faqrequest Jedem Welt Kostenlos
826 ENERGETIK TAI CHI Tai
naturverstand.at Tai Qi Gong Ji Kurse Shaolin Ingrid Austria Galerie Rezepte Anzeigen Tempel Standortenergetik
827 Home Innsbruck
Wir sind ein Transportunternehmen mit Sitz in Innsbruck. Feldstrasse 11a 6020 Innsbruck Tel.+43 0 512 342570...
zz-stoll.at Innsbruck Verteilung Lkw Zz Galerie Leistungen Php Transporte +etchzustellung Firmenprofil Karriere Sitz Stoll
828 Willkommen | Berggasthof Tenn Tenn
tenn.at Tenn Jump Ferienwohnung Tenner Galerie Stadl Berggasthof Hopfgarten |innersalvenbergwillkommen * Navigation Wahrstötter
829 Startseite Hartl
Startseite...
hartl-forellen.at Hartl Fisch Produktionsanlagen Speisefisch Aktuell Bilder Galerie Rezepte Warenangebot Copyright Personen Nahrungsmittel Erstellthomepagefix
830 Home Friedrich Kleinhapl Friedrich
kleinhapl.at Friedrich Kleinhapl En Portrait Galerie Musik Projects Special Downloads Diskographie Presse News Repertoirepartner
831 Home Valid
Krampus und Perchtenmasken aus dem Hause Kopfkunst Michael Vallant...
kopfkunst.at Valid Galerie Krampus Shop Biografie | Jt Perchtenmaske Vallant Home Linelab Perchtenmasken Hause Michaelkopfkunst
832 Gut Seeleiten Seeleiten
gut-seeleiten.at Seeleiten Gut Moosdorf Tiere Zuhause Geschichte Fotobuch Umgebung Galerie Fische Gottfriedmoosdorfwillkommen Ponys Dengg
833 Kleinnaglerhof Kleinnaglerhof
kleinnaglerhof.at Kleinnaglerhof Almrausch Pongau Help Galerie Johann Aussicht Seehhe Kinder Bauernhaus Sommer Gipfel Johannalpendorf Familieedelwei
834 Home Barbara Steinwandtner Galerie
Barbara Steinwandtner Design in Edelholz und Malerei...
barbara-steinwandtner.at Galerie Malerei Steinwandtner Holz Objekte Edelholz Barbara Design Holzbilder Impressionen Ausstellungen Galerien Michacryl
835 Startseite Die Einrichter Einrichter
unser-tischler.at Einrichter Formular Leistungen Mail Galerie Anfahrt Kunden Jobs Einrichteraustrasse Bild Fragenwebsite Leistungsangebotunserer Obscureaddend
836 Babycafe Breitensee Breitensee
baby-cafe.at Breitensee Babycafe Pfarre Babycaf Findet Statt Galerie Platz Erfahrungen Kindern Erlebnisse Mag Wannpfarrsaal
837 Arik Brauer Festspielausstellung 2009 Galerie
arikbrauer-festspielausstellung.at Galerie Youtube Salzburg Brauer Kontaktanfrage Buch English Ausstellung Linzergasse Einladung Deutsch Austria Wikipediaz
838 Willkommen auf unserer Homepage Galerie
Zoom4You Ruth Crimi Christian Kurz...
zoom4you.at Galerie Zoomyou Kurz Ruth Crimi Christian Unserer Hochzeiten People Homepage Fotostudio Shootinganfrage Fotoshootingportrait
839 Willkommen auf der Startseite Galerie
Malerei Andrea Fuchsberger...
andreafuchsberger.at Galerie Events Vergangene Mal Gestaltherapie Malerei Ausstellungen Nach_ Unendlichen Reserved Fuchsberger Malen Dorothea Kunstwerk Y
840 Mae Terra Seminare Natur
healingsongs.at Natur Terra Seminare Seminarorte Songs Spiegel Healing Galerie Angebote Team Mutter Schattendorf Beziehungenmae Naturraum
841 MOSOTE Monika Sonnleitner Temper Willkommen Monika
Internetauftritt der Künstlerin Monika Sonnleitner Temper. Neuigkeiten Ausstellungen und Bildergalerie...
mosote.at Monika Sonnleitner Mosote Temper Künstlerin News Galerie Webdesign Donau Neuigkeiten Ausstellungen Internetseitenrosenbichlercom Malerin
842 Kunstpage von Andrea Bauer Bauer
Andrea Bauer bildende Künstlerin lebt und arbeitet in Wien...
andreabauer.at Bauer Andrea Kunstpage Click Künstlerin Kunst Lebt Bild Andreabauer WienÖl Galerie Here Acryl
843 Andrann Andrann
Andrann das gemeinsame Projekt von Alauda Roth und Kaarina Kunst Bücher und Bilder Fantastische Erzählungen Romane und Lyrik...
andrann.at Andrann Kunst Edition Kaarina Galerie Alauda Bücher Roth Bildende Enter Bildhauerei Romane Gemeinsameprojekt
844 Chodejum Eggerding Chodejum
Internetportal des Chorensemble Chodejum....
chodejum.at Chodejum Chorensemble Spalte Eggerding Galerie Hauptnavigation Inhalt Chodejumat Repertoire Mitglieder Geschichte Musik Zweiten Internetportalangela
845 Willkommen | Home | Zillertal Llamas Verkauf
Herzlich Willkommen auf der Homepage der Zillertal Llamas. Hier finden Sie alle Infos rund um den Lama ...
zillertal-llamas.at Verkauf Zillertal Stellen Angebot Galerie Uns Llamas Lama | Rund Finden Rohrber Spielefest Kindergeburtstag Wandern
846 Unbenanntes Dokument Dokument
salzburger-kraeuterhof.at Dokument Firmenchronik Salzburger Galerie Produkte Kruter News Unbenanntes Kruterhofim Gewrze Pharaonen Unsergewrze Schon Hofkche
847 MOSES Hochwasserschutz Moses
moses-dbh.at Moses Galerie Haftungsausschluss Javascript Hochwasserschutz Kontaktformular Navigation Bitte Flashplayer Seitenberschriften Adobe Inhalt Funktioniert Version Y
848 Eventmoderator Johann Haas Johann
event-moderator.at Johann Haas Official Eventmoderator Website Gästebuch Moderieren Event Moderation Gmunden Auftrittdj Galerie Moderator
849 Muehlenteufl RAABA Raaba
Muehlenteufl RAABA...
muehlenteufl-raaba.at Raaba Muehlenteufl Mitglieder Gästebuch Login Galerie Chronikbeginn Homepage Reserved Findet Sommerfest Gruppe Uns
850 CHRISTOPSOMMERSGUTER Sommersguter
Dies ist die offizielle Website des Musicaldarstellers Regisseurs Choreographen und Kulturmanagers Christoph Sommersguter....
christophsommersguter.at Sommersguter Christoph Galerie Vbw Presse Engagements Wake Musical News Kulturmanagers Christophsommersguter Regisseurs Vocal Elisabeth Y
851 Gästehaus Dorfzeit Fleischhacker | Gästehaus Dorfzeit Fleischhacker
dorfzeit-fleischhacker.at Fleischhacker Dorfzeit Gästehaus Zimmer Weine Seewinkel Galerie Apetlon Inhalt Boden Naturparadies Neusiedlersee Lacke | Y
852 diefoliererei Startseite Galerie
diefoliererei.at Galerie Bekleben Uns Leistungen Services Kommen Unserem Foliererei Sie * Erlebenerlebenwir Fast Treten Kontaktformular Startseite *
853 Homepage Homepage
chriswalch.at Homepage Arbeiten Walch Natur Sport Gebude Portrt Kulturkonzerte Reportagen Galerie Chris Tiroler Pressefotos Imageereignisse
854 Eva Marschall Allgemein
evamarschall.at Allgemein Found The Konzerte Herbst Horror Mozart Fotos Marschall Ball Rocky Galerie Server Alles Mitternachtseinlage Y
855 Art of Erwin Waldherr Balu
waldherr-nk.at Balu Landschaft Architektur Spotter Menschen Airshow Alteswr Züge Mollis Galerie Erwin Art Samedan
856 Postillions Einkehr Heuriger Speisen
postillion-altaussee.at Speisen Einkehr Postillions Heuriger Gastgarten Galerie Reservierung Lokal Altaussee Bieren Dafr Freunden Internet Claudiadaslokal
857 Refreshing to welcome page Hotel
muik-bad-blumau.at Hotel Blumauerhof Genusscard Seele Grandertechnologie Rogner Friedensreich Information Menu Galerie Alltags Buffet Hundertwasser Plus Angebote
858 Gasthaus Wachtberg | Willkommen am Wachtberg Wachtberg
Joomla dynamische Portal Engine und Content Management System...
wachtberg.at Wachtberg Gasthaus Joomla Attersee Weyregg Gasthauswachtberg Ausblick Engine Wachtbergstrasse Javascript Galerie Fahrminuten Team Gott Sorry
859 Lanyards Bedruckte oder gewebte Gtgt
xn--umhngeband-s5a.at Gtgt Anfrage Galerie Lanyards Straps Logo Premium Photodruck + Leder Short Leer Gewebte Shoelaces Website
860 chorus music Purtscheller Wolf OG Chorus
chorus music Purtscheller Wolf OG...
chorus-music.at Chorus Music Purtscheller Wolf Og Studio Galerie Kompositionen Team Design Partner Adtinterior Dm Yamaha
861 In Aut Jugendreisen Joomla
Joomla dynamische Portal Engine und Content Management System...
inout.at Joomla Web Systems Easy Jugendreisen Vereine Artisteer Reiseveranstalter Informationen Galerie Angebot Tourismus Liebe Aut
862 Willkommen exaktesat Spenglerei
Spenglerei Exaktes...
exaktes.at Spenglerei Exaktes Schön Exaktesat Spezialist Küng Bauspenglerei Galerie Dachwartung Abdichtungbildereinen Einblick Freundlich
863 Volksschule Jagerberg Home Klasse
Volksschule Jagerberg...
vsjagerberg.at Klasse Jagerberg Volksschule Fotos Archiv Aktuell Galerie Team Druckversion Zwillkommen   Uns Wichtig Login
864 InnTeam Eventservices Home Angebot
innteam.at Angebot Eventservices Galerie Leitbild Innteam Unser Kirchgasse Fasser Feiern Arbeitenentdecken Office@innteamatinnteamat Begutachten Beisie
865 copy POOSCH GRAFIK KEG Keg
POOSCH GRAFIK KEG · Werbung · Fotografie · Text...
poosch-grafik.at Keg Grafik Poosch · Werbung Zell Fotografie Cooperate Afrika Webdesign Galerie Foto Design Prospektgestaltung Y
866 Pfarre Oberstinkenbrunn Galerie
Startseite...
pfarre-oberstinkenbrunn.at Galerie Oberstinkenbrunn Pfarre Schalladorf Kirche Kapelle Radwallfahrt Homepage Segnung Berichte Fuwallfahrt Software Patrozinium Kapelleoberstinkenbrunn
867 VTG Pöttsching Pöttsching
xn--volkstanz-pttsching-06b.at Pöttsching Tanz Foto Galerie News Lobegemeinschaft Nichts Gesundheit Beschwingte Tanzen Schwere Uns Lerne
868 Berufsfotografie Pressefotografie Scheucher Gtgt
Super Fotoalbum ein Projekt von MS Creative und I Connection...
msfoto.at Gtgt Galerie Zur Creativecom Fotoalbum Photos Projekt Fotografen Bildergalerien Wwwvollfotografat Wwwms Allgemeinen Fotos Creative Y
869 Lanyards Bedruckte oder gewebte Gtgt
xn--schluesselbnder-blb.at Gtgt Anfrage Galerie Lanyards Straps Logo Premium Photodruck + Leder Produkte Datenschutzhinweise Empfehlen Website Corporate
870 home Wirtschaft
handwerkertanzer.at Wirtschaft Sly Dogs Xing Auftrag Junge Tatumzusetzentanzer Mein Gebot Galerie Homepage Georg Geht Oberstes
871 feb0five Home Febfive
Herzlich willkommen auf der feb0five homepage...
febofive.at Febfive Music Jansa Febofive Konzert Band Galerie Josef Found The Keglovits Benefiz Homepage Musik Krebshilfe Y
872 Pythons Boas und Nattern von Patrik Nattern
Schlangenzucht von Patrik Schikl Phytons Boas Nattern...
schlangenzucht-scheikl.at Nattern Boas Patrik Pythons Scheikl Webdesign Galerie Abzugeben Schlangen Design Schlangenzucht Futterphytons Sch@pleracutes
873 Home Goller
geris-motoshop.at Goller Gebrauchte Lienz Adresse Vinzenz Team News Motoshop Galerie Geris Neufahrzeuge Agb Spambots Fax Y
874 hansns maggies timos website Gallery
das ist die private website von hansn maggie timo...
hansn.at Gallery Hansn Nützliche Maggie Timo Website Timos Speedtest Bad Maggieshansns Galerie Private Foto
875 Villa SunsetPalms Cape Coral Villa
Ab November 2012 wird Villa SunsetPalms in Cape Coral zur Vermietung angebote alle informationen stehen schon aktuell schon...
cape-coral.at Villa Sunsetpalms Cape Coral Florida Vermietung Preise Belegung Haus Front Seats Galerie Stehen Ab Y
876 Startseite Gertis Salon Salon
Gertis Salon Geringergasse 222 1110 Wien...
gertis-salon.at Salon Gertis Wien Geringergasse Anfahrt Galerie Preise Logout Beauty Massage Gesichtsbehandlung Teint Alltag Mkm Y
877 gestuet schloss treffen Schloss
gestuet-schloss-treffen.at Schloss Treffen Gestuet Pferde Aktiviteaten Ziel Reiterei Werte Galerie Lebensraum Griesser Kompetenz Zucht Jahre Y
878 wwwviennamailat Urlaubsfotos
Author Michael Wernsdorfer. Work in progress This site is momentarily used to share pictures with my...
viennamail.at Urlaubsfotos Java Galerie Pictures Wernsdorfer Michael Bildergalerien Christian Bilder Wwwviennamailat Used Tauchen Bildergalerie Version Progress
879 Radar
car-service-sattler.at Radar Reifen Tuning Zubehör Agbs Aktionen Sattler Gebrauchtwagen Galerie Leistungen Partner Anfahrt Uhrfruns
880 Petra Plann Kinesiologie Steyr Kinesiologie
Herzlich Willkommen...
gesund-durchs-leben.at Kinesiologie Durchs Möglichkeiten Plann Mich Kinesiologische Petra Email Systeme Lebenateinsatzbereiche Michkontakt Steyr Galerie
881 Willkommen Carp
Infoseite rund ums carpfishing...
mission-carp-team.at Carp Team Fishing Austrian Ums Mission Galerie Carpfishing Riegersburgberichte Karpfen Gästebuch Hollenburg Infoseite
882 Gerhard Slama sen Begegnung Malerei
Slider Gallery with jQuery...
gerhard-slama.at Malerei Jquery Gerhard Slider Begegnung Galerie Slama Druckversion Beyrouths Preview Flickr Künstler Sencss
883 Startseite Galerie
michaelarois.at Galerie Bilder Biografie Künstlerin Arbeitsprozesserstreckt Ausschnitte Form Dazu Farbenrausch Atelier Wien Jahrenegerlegasse Lebenzeigen
884 Heimat | Hofkäserei Schörgerer Oberndorf in Heimat
Heimat Schörgerer Andreas Lindner Liebe Leidenschaft regionale Zutaten Bio Bauernhof Oberndorf in Tirol Austria Genuss Bio Natur...
schoergerer.at Heimat Oberndorf Schörgerer Bio Uns Tirol Regionale Bauernhofserver Andreas | Neues Genuss Galerie
885 Die Kleidermacherin Evi Heiss Heiss
dirndl-kleid.at Heiss Dirndl Kleidermacherin Anreise Raumtextil Galerie Ybbs Brauchst Sehen Seiten Waidhofen Garderobe Kleiderperfektevi Raumgestaltung Z
886 wwwgerhard aignerat Homepage
homepage dokument webpage page web netz...
gerhard-aigner.at Homepage Page Webdesign Dokument Web Netz Webpage Shop Galerie Vitae Biografie Curriculum Freizeit Standort Y
887 ivents kulturagentur Villacher
ivents.at Villacher Aufsteirern Agentur Kunden Kulturagentur Tracht Kirtag Volxmusik Iventkalender Ivents Pracht Galerie Beim Hof Y
888 Startseite antonchristianglatzs Jimdo Page Praxis
antonchristianglatz.at Praxis Jimdo Galerie Page Download Literaturhinweise Bücher Leseproben Pfiff Anmelden Antonchristianglatzs Bearbeitenvontexte Druckversion
889 Vermessung Wild Wild
vermessung-wild.at Wild Galerie Wildat Vermessung Innsbruck Mobil Ingenieurkonsulent Hubert Fax Vermessungsbro Vermessungswesen Philippmatt@vermessungstaatlich Grabenweg
890 Cafe Bar Old Splendor Cafe
cafe-oldsplendor.at Cafe Splendor Getränke Snacks Themes Wordpress Allgemein Powered Old Club Galerie Fan Wienspectacula
891 Wesselys Gallery Gallery
Welcome to WESSELY`s GALLERY The Edition quotAntilopenartquot presents a Multimedia Gallery...
antilopenart.at Gallery Edition Film Super Multimedia Gouache Collage Antilopenart Collagen Experimentalfilm Welcome Wesselys Foto Gouachen Galerie
892 MENonFIRE | Leistungen
menonfire.at Leistungen Galerie Events Sicherheit Videos Bilder Feuerwerken Website Menonfire News Team Special | Richtig Ecgagb
893 Fendt Bierbauer Warning
fendt-bierbauer.at Warning Failed Bierbauer Galerie Bildreportagen Call Anfrage Unserer Infoblatt Angebote » Produktseite Login Erfahren Y
894 CAM Fotografie | Kinderfotos Fotografie
CAM Fotografie Enzianweg 51 1220 Wien Unser erfahrenes Team bietet ihnen professionelle Betreuung u.a. bei Kinderfotos Hochzeitsreportage...
cam-fotografie.at Fotografie Team Kinderfotos Galerie | Cam Bildpreise Newborn Hochzeitsreportagen Schulfotografie Visionpark Layout Fotos Ideen Kinder
895 Andreas Steiner Galerie Schau STALL Stall
Andreas Steiner Galerie Schau ST.A.LL...
schaustall.at Stall Steiner Schau Andreas Galerie Amstetten Objekte Kunst First Silberschmuck Mak Schaffen Stuttgart Installation Aquarelle
896 We make your Party Eventtechnik
DTC Eventtechnik We make your Party...
dtc-eventtechnik.at Eventtechnik Dtc Party Team Verleih Equipment Firmenprofil Downloads Winkl News Loginbereich Galerie Trappl Frauenhofen Y
897 Home Fannullonis Main Coon Coon
fannullonis-main-coon-cattery.at Coon Homepage Fannullonis Cattery Kitten Maine Main Galerie Do Yourself Here Gallery Fotos Zucht Gästebuch Peter
898 Fanclub LisaValentinat Records
fanclub-lisavalentin.at Records Gg Musical Fanclub Biografie Geheimnis Admin Galerie Copyright Schlagertexte Schlagermusical Lisavalentin Lisavalentinat Fanfotos Y
899 Startseite Möth Tradition
moeth.at Tradition Weingut Möth Brotzeit Navigation Anfahrt Heuriger Ursprung Galerie Winzer Selektion Bregenz überspringenz
900 cave canematStart Konrad
cave-canem.at Konrad Wwwcave Canemat Isarflimmern Hund“ Morla Cave Canematstart Galerie Homepage Lateinischen Buchempfehlungeninformationen Videos Meiner
901 HANNES AUER and friends | Fotografie Fotografie
Hannes Auer Fotografie Werbung Salzburg...
hannesauer.at Fotografie Auer Hannes Salzburg Studio Print Galerie | Anfahrt Photo Industrial Fotos Photos Architektur Photography
902 Home Paintball Sportverein Fallen Angels
Jimdo Page des Paintball Sportverein Fallen Angels ....
fallen-angels-paintball.at Angels Paintball Fallen Sportverein Verein Wirb Jimdo Galerie Gästebuch Anmelden Logout Bearbeitenpage Deine
903 wwwphoto mountainat Salzburg
meine Private Homepage....
photo-mountain.at Salzburg Bilder Panorama Gästebuch Galerie Blogs Wetter Mountainat Login Foto Update Wwwphoto Lastmaurer
904 Willkommen zu SARTORI DIE Sartori
Die Designerin Petra Bacher realisiert unter dem Label SARTORI DIE TORTE ihre phantasievollen Tortenskulpturen....
sartori-torten.at Sartori Torte Petra Presse Torten Galerie Unter English Bacher Label Echo Tortenskulpturen Portrait Phantasievollen
905 Irudiaat Blog
irudia.at Blog Galerie Uns Irudiaat Login Apache Schnappschuß Suban Partner Server Georgbesuchen Kranewitter Christian
906 Hundeschule Pfotentreff Weiz Pfotentreff
pfotentreff-weiz.at Pfotentreff Weiz Hundeschule Borderqueenat Galerie News Google+ Hundeausbildung Team Mitterdorf Liebevolle Mail Arbeit Ausbildung Y
907 moorbad schremsat Willkommen Moorbad
moorbad-schrems.at Moorbad Ganztgig Cafe Restaurant Website Galerie Gesucht Lokal Schremsat Reisegesellschaften Kche Veranstaltungen Willkommen *feiern
908 steck Modellarchitektur Start Modellarchitektur
steck Modellarchitektur...
modellarchitektur.at Modellarchitektur Steck Agbs Leitbild Christoph Galerie Leistungen Weiherburggassea Navigation * Zsteck@modellarchitekturat Servicenavigationkontakt Links Innsbruck
909 Farben Bau | bau malerei Levitra
farbenbau.at Levitra Galerie Buy Sanierung Visit Farben Hits Trockenbau Renovierung Bau Generic Aushub Abruch Pharmacy |
910 julia maier home Julia
Die offizielle Webseite von Julia Maier...
mjmusic.at Julia Maier Purple Album Clouds Projekte News Galerie Biographie Reutte Jazz Shores New Fall Gstebuch
911 Digital Connection Game Community News
digital-connection.at News Serverjoin Community Vergessen Battlelog Awards Downloads Anmelden Sponsoren Teams Einsenden Umfragen Galerie Newsarchiv
912 Fischerstube Home Fischerstube
angelshop-fischerstube.at Fischerstube Partner Gästebuch Produkte Galerie Anfahrt Adminbereich Unsinnsbruck Maturaprojektes Unserervergnügen Webseite
913 Startseite Nachlese
mkweer.at Nachlese News Musikkapelle Weer Joomla Ausschuss Galerie Hauptmenü Mitglieder Templates Wertungsspielfotogalerie Webseite Joomlaskins
914 Deutsch Ordenshaus Schloss Gumpoldskirchen Schloss
do-schloss.at Schloss Deutsch Ordenshaus Gumpoldskirchen Downloads News Tour Gästehaus Schlossat Galerie Kirchenplatz Faxdeg Office@do
915 Marktmusikkapelle StMarein bei Graz Marktmusikkapelle
Webseite der Marktmusikkapelle St. Marein bei Graz Aktuelles Termine Fotos allgemeine Infos...
mmk-marein.at Marktmusikkapelle Graz Joomla Stmarein Mitglieder Galerie Intern Joomlashinecom Uns Fotos Marktmusik Webseite Ahadesign Pickelbach Y
916 Thomas Nechi | Training und Schulung Z
vip-security.at Z Partnerfirmen Presse Xbxfxexbixxxxxxeat Pm Designat Thomas Training Galerie Betätigungsfeld |schulung Nechi News
917 Schalmeienzug Lauterach Schalmeienzug
Information architecture Web Design Web Standards....
schalmeienzug-lauterach.at Schalmeienzug Lauterach Chronik Web Galerie Lieder Mitglieder Gästebuch Shows Design Architecturekeywords Beim Standards
918 Mobile Marketing Innovation Day Ticket
Die Konferenz für Branchenpioniere in Wien. 23.5.2013 Arena 21 Jetzt Ticket sichern Der Summit für Digital...
mobilemarketinginnovationday.at Ticket Wien Mobile Innovation Marketing Partner Team Media Programm Digital Arena Mmid Speaker Galerie
919 Isabella Mayrhofer Isabella
Isabella May...
isabellamayrhofer.at Isabella Mayrhofer Kontaktformular Login Angebot Galerie Email Wwwisabellamayrhoferat Obertrum Zlindenhofstr Telefon Aufbau Office@isabellamayrhoferat
920 Peter Kohl Kohl
Peter Kohl Portfolio...
peter-kohl.at Kohl Peter Treiber Richtwert Lyrik Rechte Copyright Künstler Kunst Ausstellungen Artgalery Biographie Galerie
921 HOME Galerie
mopars.at Galerie Direkt Anmeldung Inhalt Team Lageplan Hauptnavigation Garage Copy Engines Verkauf Stinger Race Sale Y
922 RT10at RoundTable10 Klagenfurt Austria Roundtable
RoundTable Austria...
rt10.at Roundtable Klagenfurt Symbol Table Round Austria Laufen World Pin Fotos Galerie Contact Around Rtat Weihnachtsstand
923 Herbert Hopferwieser Herbert
herberthopferwieser.at Herbert Kalender Hopferwieser Landschaften Hopferwieserindex Galerie Ausstellungen Seiten Powered Gallery Jänner News Zenphoto
924 Willkommen auf der Startseite Kaindorfer
www.cyranos.at Eine Seite der Kaindorfer Wirtschaftsrunde...
cyranos.at Kaindorfer Wirtschaftsrunde Passwort Benutzername Galerie Steuerberater Wirtschftsrunde Kaindorf Hauptmenü Cyranos Registrieren Angemeldet Hotelcyranosat
925 Startseite oeancks Webseite Arbeitsgemeinschaft
oeanck.at Arbeitsgemeinschaft Veranstaltungen Wien Sponsoren Vorstand Neurochirurgie Galerie Mitgliedschaft Webseite Mitgliederbereich Homepage Logout Jimdo Oeancks Y
926 KFZ Technik HGC Über HGC Hgc
hgcarstyling.at Hgc Kfz Handel Werkstatt Login Technik Tuning Galerie Team Hgcarstyling Regersttten Hierzerfax Weiz Gerald
927 Willkommen bei WokMore Restaurant
wokandmore.at Restaurant Speisekarte Galerie Menu Wokmore Lage Tour Reservierung Adresse Sienhere Informationen Team Getrnken Einblick Y
928 Reit und Fahrverein Dachberg Fotos
dachberg.at Fotos Dachberg Csn B* Unser Fahrverein Reit Anmelden Cdn Angebot Folder Tagesritt Hippotherapie Csnhp Galerie
929 Home Appartement
vasiri.at Appartement Content Ferienwohnung Server Galerie Delivery Website Agentur Unsaktivitäten Translation Wwwvasiriat Multilingual
930 Home Ferienwohnung Ferienwohnung
Ferienwohnung...
wohnung-alpbach.at Ferienwohnung Achenschmiedfeld Entfernung Alpbach Urlaub Mail Galerie Moser Freizeitgestaltung Wiedersbergerverbringen Mobiltel Dorf Ortszentrum Aurore
931 Gasthaus GallerHome Gasthaus
einkehrschwung.at Gasthaus Winter Mail Gallerhome Galerie Sommer Kleinarl Galler Spezialitätenstuhlwaldstrae Website Spezialitteninfo@einkehrschwung
932 Ihr Parkettleger Parkettleger
Seitenbeschreibung in zwei Saetzen....
parkettleger.at Parkettleger Partner Galerie Mladosevits Harald Homepage Maria Telefon Arbeit Parkettboden Enzersdorf Schauraumbesichtigungen Verfgung Gren Y
933 Abenteuerwoche Abenteuerwoche
abenteuerwoche.at Abenteuerwoche Disclamier Puchtler Leibnitz Galerie Bulldieabenteuerwoche Bullsponsoren Memoriam Linksbulllinks Klaus Bullin Programmbywwwskorpionaat Kommen Anmeldung
934 Haarstudio Hendrich Haarstudio
haarstudio-hendrich.at Haarstudio Hendrich Specials Galerie Produkte Wien Lerchenfelderstraßeangeboten Leistungen Besuch Terminvereinbarungentelefonnummer Urlaub Fragen
935 Elektrotechnik Nebel GmbH Nebel
Elektrotechnik Nebel GmbH...
elektro-nebel.at Nebel Elektrotechnik Galerie Leistungen Firmenbeteiligungen Team Gmbh Elektro Zhauptmenü * Website Peter Uns Deutschlandsberg
936 enzovelo Startseite Sonstiges
Trekkingbikes Citybikes Pedelecs...
graphik-thefranz.at Sonstiges Galerie Verleih Produkte Downloads Privat Philosophie Werkstatt Anfahrt Support Guten Dinge Seitenlayout Hochwertigindividuell
937 Der neue NISSAN Note Nissan
Lernen Sie den neuen NISSAN Note kennen Features Bilder Berichte und mehr über den city car....
nissan-note.at Nissan Kaufen Preise Ausstattung Note Broschüre Angebote Way Konfigurieren Modelle Fahren You+ Galerie Platzangebot Finanzieren
938 Startseite Herbert Swoboda Herbert
herbertswoboda.at Herbert Swoboda Swing Biographie Galerie Pressefotos Formationen Trio Konzerte Quintett Swobodas Website Logout Jimdo Y
939 Werner Loder Tiffany Werner
Werner Loder Tiffany Mosaik Herzlich willkommen auf meiner Homepage Sehen Sie sich in...
wernerloder-mosaik.at Werner Loder Tiffany Meine Bilder Galerie Mosaik Artist Ruhe Mosaike Informieren Portrait Themen Homepage Y
940 Karl Nuck online Airbrush und Wohn Karl
Homepage für Airbush Wohndesign und Raumdekoration...
nuck.at Karl Airbrush Nuck Gästebuch Galerie Design Wohndesign Wohn Raumdekoration Homepage Arbeiten Airbush Wurzelshopunverbindlich
941 Home Onlinemarketing
drinkomat-hausbar.at Onlinemarketing Portioniersysteme Galerie Produktinformation Shop Passwort Benutzername Designed Form Angemeldet Privat Eingetragen Registrierenhell Design
942 Hudernwirt Hudernwirt
Hudernwirt in Steinhaus das gemutliche Gasthaus mit Atmosphare.Schoner grosser Gastgarten gemutliche Gaststube und herzhafte Hausmannskost....
hudern.at Hudernwirt Gasthaus Gastgarten Steinhaus Wallner Hudern Restaurant Gaststube Firmenfeier Galerie Anfahrt Taxlberg Gemutliche Biergarten
943 Elisabeth Saurugg | Tadelakt Saurugg
Hier findest du Informationen rund um die Künstlerin Elisabeth Saurugg...
elisabeth-saurugg.at Saurugg Elisabeth Tadelakt Films Glimt Workshops Künstlerin Ausstellungen Media Galerie Mich Findest Bronzeskulpturenarbeiten
944 Hermi Lanza Lanza
LanzaHermi Lanzamoderne MalereiAcrylÖlCollageHomepage der Malerin Hermi Lanzaversteckte BotschaftStierkampf...
hermi-lanza.at Lanza Hermi Acryl Moderne Biografie Stierkampf Öl Malerei Versteckte Galerie Collage Homepage Botschaft Malerin Y
945 Willkommen Landkarte
oberpfennigmayrgut.at Landkarte Aufenthaltsraum Aufenthalt Tage Webseite Einquartier Willkommenpension Piritsch Machen Sie Umgebung Pension Galerie Anreiseurlaubsgast
946 Hannelore Sturm Aquarelle Acryl Sturm
Kunstbilder in Aquarell und Acryltechnik von Hannelore Sturm...
eleonore-colore.at Sturm Aquarelle Hannelore Acryl Billets Lebenslauf Galerie Dcntrl Kalender Meditat Konzeption Aquarell Kunst *kunsthandwerk
947 Abersee Perchten Perchten
abersee-perchten.at Perchten Abersee Gästebuch Mitglieder Galerie Geschichte Diezeit Land Hompageperchten Es Finsterniss Dunkelheit Zeit Z
948 Reformhaus Drack Gmunden| Startseite Reformhaus
reformhaus-drack.at Reformhaus Drack Produkte Aktionen Pdf Download Angebote Gmunden Unser Galerie Prospekt Reform Marktplatz Ffnungszeiten Y
949 Weingut Hoffmann Weingut
hoffmann-wein.at Weingut Weine Verkauf Galerie Hoffmann Euch Extras Agbs Partner Weinverkostungen Lageplan Weinbeschreibungen Durchklicken Unter Y
950 Brauchtumsverein Maierdorf Osterkreuz Maierdorf Maierdorf
Brauchtumsverein Maierdorf Osterkreuz Maierdorf...
osterkreuz-maierdorf.at Maierdorf Brauchtumsverein Osterkreuz Kreuz Festlegen Osterhase Ostereier Ostern Watchbvm Favoriten Mitglieder Gästebuchparty Galerie
951 Welcome | Palffy Club Club
palffyclub.at Club Galerie Palffy Videos Programm Partner Hits | Video Sofort House Anfahrtsplan Gina Lisa Permanently The Y
952 ADRIA Pizzeria Ristorante Pizzeria
adria-pizzeria.at Pizzeria Ristorante Adria Lageplan Wein Wienerstraße Speisen Gloggnitz Galerie Feste Traditionsunternehmen Lokalz Tischreservierung
953 Home Benutzername
de-oltn.at Benutzername Oldtimer Passwort Gaestebuch Verein Galerie Group Homepagebeitragshäufigkeit Aufbau Anzahlrights Angemeldet Reserved
954 AMC Pacer Pacer
Oberts Garage. AMC Pacer Ersatzteile bilder Infos. AMC Pacer parts pictures and informations....
pacer.at Pacer Amc Oberts Ersatzteile Garage Geschichte Galerie Parts Wagon Fotos Tober Pacerersatzteile Toro Visuals Y
955 Ecco Arte Aktuell Arte
ecco-arte.at Arte Ecco Aktuell Präsentationen Webmeisterin Publikationen Solutions Retrospektive Galerie Web Copyrightrechte Rs Z
956 Vorschau
packard.at Vorschau Events Hintergrund Austria Galerie Uns Www Artistic Jahre Technik Loading Packard Historie Erfolgsgeschichte Y
957 Hollerberg home Hollerberg
hollerberg.at Hollerberg € Bands Ausflug Eintritt Uhranschl Galerie Zeltzeltplatz Waldfest Gast Auberg Gästebuch Programm
958 Dietmar Hollenstein künstlerische Arbeiten Dietmar
Dietmar Hollenstein Künstler Artist Artwork gentetischer Code Luftpolsterfolie Basisi wien Galerie Ariadne...
hollenstein-dietmar.at Dietmar Hollenstein Arbeiten Luftpolsterfolie Gtgt Basisi Gentetischer Code Galerie Wien Kopiem_web_htmstarthtmartwork Künstlerische Ariadne
959 Acrylbilder Kienberger Monika Acrylbilder
Durch die malerei entfliehe ich dem Alltagsstress und komme zur inneren Ruhe.BilderWien...
acrylart-kiemo.at Acrylbilder Kienberger Bilder Wien Monika Acrylmalerei Meinem Gästebuch Galerie Alltagsstress Entfliehe Kommewarum Malerei
960 Home Kogler
radman.at Kogler Vormittagsgeöffnetradshopschrattenecker Softwaresolutions Galerie Solutions Schalchen Marken Copy Katalogeemailradman@utanetat Software Neudorf
961 Origami österreich Crease
origamiaustria.at Crease Patterns Origami Diagramme Galerie Artikel Hauptseite Neu Gruppe Treffen Leider Lust Bcher Besucher Y
962 Ehrenfelspass Kammern Joomla
Joomla the dynamic portal engine and content management system...
ehrenfelspass.at Joomla Kammern Gästebuch Galerie Ehrenfelspass Bazar Mitglieder Engine Portal Dynamic System Managementcontent Besucher
963 Saison 20112012 wienerteifls Jimdo Saison
wienerteifl.at Saison Request Gästebuch Teifl Page Ebenfalls Galerie Team Wirb Linktippswienerteiflhockeyteam Deine Wiener Jimdo
964 Danninger Ernst Gartengestaltung und Gartengestaltung
Joomla the dynamic portal engine and content management system...
danninger-gartengestaltung.at Gartengestaltung Joomla Gartenpflege Danninger Ernst Beratung Team Galerie Planung Leistungen News Pflege Gartenplanung Reserved Y
965 Dürer GesmbH Home Z
duerer.at Z Transporte Erdbau Office@duererat Galerie Kfz Anfahrtsplan Dürer Firmengeschichte Recyclingwerkstätte Gesmbh
966 wwwhc huttererat Hutterer
Homepage der Werbeagentur Hutterer Fotoservice Hutterer Galerie Impact und H.C. Hutterer Computer Sound Stereo....
h-werbung.at Hutterer Galerie Hc Impact Werbung Foto Fotograf Wiener Art Jutta Werbeagentur Kunst Sound Plakat Y
967 Dark Age Entertainment Dark
Diese Seite ist zur Zeit in Arbeit. Hier entsteht der Webauftritt von Dark Age Entertainment....
darkage.at Dark Entertainment Age Team Legacy Downloads Softwareentwicklung Goldmedaillelinks Veranstaltungen Galerie Wm News Projektespiele Lukas
968 Die Welt in 360186 Ansehen
Panoramafotografie Hochauflösende 360 Grad Fullscreen Panoramabilder in Quicktime VR....
panoramapix.at Ansehen Panorama Panoramabilder Rtelstein Welt Panoramapix Bodenberg Wallpaper Grad Alpbichl Galerie Berge °panoramagalerie
969 Foto Wierer Naturfotografie von Wierer
wierer.at Wierer Naturfotografie Galerie Franz Foto Kamera Bachmair Meiner Canon Astronomieaustria Homepage Fotokunst Hinweise Natur
970 Webseite Edith Eberle Modeatelier Edith
Herzlich willkommen auf der Website von Edith EberleModeatelier bull Design bull Schnittservice....
edith-eberle.at Edith Schnittservice Modeatelier Eberle Design Website Portrait Bull Wolfurt Unterhub Galerie Telfax Emtc Webseite Y
971 wf ein beagle kommt selten alleine Page
quotJimdo Page des Hofberichterstatters von Willi Flip. Auf dieser Page können sich alle Freunde von WF über...
williundflip.at Page Willi Flip Wf Ii Galerie Beagle Meint Williundflips Boschnerjimdopro Selten Hofberichterstatters Freunde Dieser
972 Hörstudio Maria Schobel Home Leistungen
wirhelfenhoeren.at Leistungen Produkte Request Galerie Tinnituszentrum Video Neuheiten Source Error Schobel Uns Hörstudioopen Cms
973 Hotel Albona **** Austria Kategorie
albona-ischgl.at Kategorie Ischgl Preise Angebote Albona Entspannen Hotel Download Tirol Austria Galerie Wohnen Suite Anreise Z
974 Lanyards Bedruckte oder gewebte Gtgt
xn--schlsselbaender-2vb.at Gtgt Anfrage Galerie Lanyards Straps Premium Logo Leder Photodruck + Infos Gewebte Empfehlen Produkte Felt
975 Galerie von Alois E Request
aloisendl.at Request Akt Abstrakt Natur Kärnten Portrait Galerie Studio Verschiedenesport Reisen Architektur Outdoor Bodypainting
976 GrünfelderUrban Welcome to the Official Site Humans
Grünfelder Urban Welcome to the Official Site...
xn--grnfelder-r9a.at Humans Official Welcome Unbenanntes Dokument Urban Grnfelder Httpwwwkuenstlerbundorgdegalerie Galerie Httpwwwkunstvereinkaerntenat Prismahtml Visionworxxgrünfelderurban Prisma
977 Penz Photo | Thomas Penzinger Pressefotograf Steyr
Thomas Penzinger ist ein Pressefotograf aus Steyr. Für seine Aufträge ist er in ganz Oberösterreich tätig. Egal ob...
penz-photo.at Steyr Thomas Penzinger Galerie Penz Photo Pressefotograf Fotos Leistungen Webseite Blanche Google+ Latest | Xing
978 Rote Falken Wien Kinderfreunde Dazu
rotefalken-wien.at Dazu Kinderfreunde Rote Objekt Falken Fehler österreich Galerie Wien Faxverschoben Das Suchwort Rauhensteingasse Z
979 Studio Studio
Joomla dynamische Portal Engine und Content Management System...
nagelstudio-vera.at Studio Joomla Angebot Hände Unser Galerie Aktionen Dynamische Leistungen Sache Engineportal Copyright Charakter
980 DRAG RACEat BESCHLEUNIGUNGSRENNEN Ergebnisse
Dragrace Beschleunigungsrennen in Österreich und Ungarn Rennkalender Termine Ergebnisse Bilder Video Fahrer...
drag-race.at Ergebnisse Fotos Bilder Rennkalender Torgler Drag Beschleunigungsrennen Galerie Meile Staudigl Nicolai Sponsoren Julian Ungarn
981 Startseite Forum
ernestbevinhof.at Forum Gstebuch Ernest Bevin Projekte Gästebuch Kartenansicht Homepage Grere Glanz Mieterbeirat Designhersch Galerie
982 Arena
xbowlarena.at Arena Galerie News Academy Mieten Officexbowlarenaat Internet Werbeagentur Explorer Börse Anfahrt Firefox Shopsalzburg
983 Home Herbstkurse
hundesportclub-hainburg.at Herbstkurse Veranstaltungen Angebot Hainburg Team Galerie Sommer Home Beginn Wwwh Itsat Wünscht Willkommenbeimhscherbstkurs
984 ZZI Zentrum der zeitgemäßen Zentrum
ZZI Zentrum der zeitgemäßen Initiativen...
zzi.at Zentrum Initiativen Zeitgemäßen Zzi Galerie Nachrichten Berichte Projekte Linkliste Copyright Unsz
985 WDA Innsbruck WDA []
{pagedescription}...
wda-tirol.at [] Wda Innsbruck Galerie Design Dtpprint Ausbildungsschwerpunktmediendesign Ausbildungsschwerpunktgrafikdesign Bewerbung | Bewerbungstag Ausbildung Advanced Gt Räumen Y
986 WDA Innsbruck WDA Wda
{pagedescription}...
wda-innsbruck.at Wda [] Innsbruck Ausbildungsschwerpunktmediendesign Bewerbungstag Design Advanced Bewerbung | Ausbildungsschwerpunktgrafikdesign Galerie Dtpprint Ausbildung Meet Good Offenen
987 H W H A T Handwerkshaus
hwh.at Handwerkshaus Galerie Events Firmen Oberndorf Anfahrt H Fläche Konzerte Lesungenobjekt Kunstausstellung Beim Los
988 Startseite glassages jimdo page Klassische
glassage.at Klassische Tapen Spezialmassagen Schwangerschaft Gutscheine Massagen Galerie Jimdo Glassage Die Mich Logout Bitteflashplayer Bearbeiten
989 Home Zucht
powerdogs.at Zucht Hunde Gästebuch Freunde Login Galerie News Anzeige Gruber Grossweiffendorf Unsspambots Mail Joomspirit
990 Ilztal Event GmbH Event
Ilztal Event GmbH Ihr Wegweiser zum perfekten Event...
ilztalevent.at Event Ilztal Events Technik Beratung Galerie Tickets Team Vip Schlager Perfekten Partnertel+ Platz Zug
991 Willkommen bei RS Stahlhandel Stahlhandel
RS Stahlhandel Rudolf Schobe...
rs-stahlhandel.at Stahlhandel Springen Rs Rudolf Stahl Edelstahl Schobe Kontaktseite Inhalt Navigation Programm Galerie Unternehmen Przisionssthle Y
992 RS DEFENSE Willkommen || Defense
RS DEFENSE Willkommen Jeder kann sich verteidigen Selbstverteidigung beginnt im Kopf...
rs-defense.at Defense Rs Selbstverteidigung Angebot Uns Galerie Veranstaltungen Wien Agb Kopf Port Apache Maga Jeder Y
993 Schrank Design Steiner Startseite Schrank
gleittueren.at Schrank Design Steiner Leistungen Designat Galerie Katalog Standort Wolfgang Faxgumpendorferstraße Wien Mailsteineratschrank Steineratschrank
994 [ 2 2 12 ] Two Art
Global Brand Art Two to twelve by Hannes Rossbacher Art Design...
global-brand-art.at Art Rossbacher Twelve Design Brand Two Global ] [ Hannes Claudia Grafik Schloss Kunst Emotion Galerie Willhelminenberg
995 Home Discografie
ihrvorteil.at Discografie Programm Sampler Band Gästebuch Biografie Nosun Fanshop Galerie Download Voting News Stimmungsbandveranstaltungvon
996 MUTTERLIEBE Official Site Mutterliebe
MUTTERLIEBE Der Film...
mutterliebe.at Mutterliebe Inhalt Cast Galerie Film Crew Javascript News Official Partner David Movie Auzinger Kurzfilmchristian
997 MV Harmonia Grossengersdorf Grossengersdorf
mvgrossengersdorf.at Grossengersdorf Foto Galerie Vorstand Besetzung GÄstebuch Mitglieder Wertungen Harmonia Homepage Mv Besucher Gegrmarschmusikbewertung
998 Weinbau Familie Gorth Weinbau
weinbau-gorth.at Weinbau Gorth Familie Heurigen Galerie Jahrgangsweine Termin Strict Info Besucher Unskuraufenthalt Fam Website Gorthnavigation
999 Wetter und Weinbau Trinko Wetter und Wetter
weinbau-trinko.at Wetter Weinbau Trinko Besucher Gästebuch Weine Galerie Haftung Weblinks Banner Hauptstraßebrunnwetterstation
1000 Willkommen Afrika
riesenseifenblasen.at Afrika Tage Wordpress Wien Buchungkontakt Geriatrie Server Galerie Spielanleitungriesenseifenblasen Lade Found Theergotherapie Zubereitungzauberseife Mich
1001 Messe Tulln Du Tulln
hundemesse.at Tulln Messe Tier Du + Kalender Int Musikantenstadl Anfahrt Galerie Kiddyworld Kulinar Energiesparen Bike Agrar
1002 1 UAK Waldviertel Joomla
Joomla dynamische Portal Engine und Content Management System...
1uak-waldviertel.at Joomla Waldviertel Athleten Galerie Ergebnisliste Gästebuch Vorstand Mannschaft Weblinks Medien Trainingheute Engine Template
1003 Hobby Hundefotografie Shootings
Hundefotografin Christine Faltner erstellt Hundefotos aus Leidenschaft die aktive Hundesportlerin zeigt Hunde im besten Licht und...
hundefotografin.at Shootings News Galerie Hobby Hundefotografie Christine Faltner Leidenschaft Licht Aktive Besten Hält Erstelltcopyright
1004 Gasthof HAIDBACH Gasthof
haidbach.at Gasthof Haidbach Anfrage Preise Restaurant Galerie Lage Gruppen Mittersill Zimmer News Ronacher Fam Copyright Y
1005 cr fotoat cr fotos Fotoat
christian rebl foto...
cr-foto.at Fotoat Cr Fotos Rebl News Gästebuch Galerie Foto Christian Vielschön Name Druckversion Bearbeiten
1006 Home grranchs Jimdo Page Leistungenpreise
gr-ranch.at Leistungenpreise Anlage Unterrohrbach Page Training Team Galerie Gr Ranch Memoriam News Pferdehaltung Rv Himotion Y
1007 Cafe Konditorei Eisverkauf Weltzer in Eferding Aschach
Willkommen bei Weltzer.at Eine süsse Sache...
weltzer.at Aschach Konditorei Weltzer Cafe Eisverkauf Eferding Galerie Sache Donausüsse Weltzerat Eis Konditoreis Z
1008 Willkommen bei Crazy Boogiefreaks Boogiefreaks
Crazy Boogiefreaks...
crazy-boogiefreaks.at Boogiefreaks Crazy Anmeldung Gnugpl Lizenz Feld Benutzername Verein Dietach Galerie Wirt Passwort Rechte Joomla Y
1009 Weinbau Karl Hager Hager
hager-weine.at Hager Weinbau Weine Anmeldung Hauptnavigation Direkt Karl Familie Inhalt Weblinksjägerzeile Galerie Auersthal Z
1010 Nickpage Chatter Galerie mit Steckbriefen von Nickpage
Eine Nickpage persönliches Profil Visitenkarte kann man in der Noobie Community als Chatter kostenlos einrichten....
nickpage.at Nickpage Noobie Chatter Steckbriefen Community Galerie Chat Nicknamen Linkpark Onlinechat Webchatvisitenkarte Einrichten Profil Chats
1011 Nibelungen Aristos Aristos
Die Nibelungen Aristos sind eine Langhaarcollie Zucht von Karin und Maximilian Wulz....
nibelungenaristos.at Aristos Nibelungen Collies Welpen Hunde Kalender Unvergessen Galerie Welpenaufzucht Ausstellungen Zucht Langhaarcollie Helfende Langhaar
1012 RNickl Malerin Galerie
..Roswitha Nickl Malerin Galerie Ausstellungen Kurse.....
rnickl.at Galerie Ausstellungen Malerin Kurse Nickl Roswitha Farbenkunde Modellierpaste Anmeldung Bilder Künstler Kalender Kunstakt
1013 Top ConBini Conbini
conbini.at Conbini | Japan Euch Oekaki Galerie Forum Anmeldung Board Programm Partner Hauptgruppen Reiche Muss Originaler
1014 Pension Hartenfels Hartenfels
pensionhartenfels.at Hartenfels Pension Preise Anreise Blumenstube Wellness Willkommmen Galerie Verpflegung Zimmer Zentrum Also Bergbahnoberlech Sonnenterrasse Schlegelkopf Y
1015 ENERGETIK TAI CHI Gong
naturverstand.at Gong Qi Tai Kalender Standort Chi Energetik Tempel Wwwnaturverstandat Copy Ingrid Bilder Kurse Galerie Y
1016 Drau Dach Drau
draudach.at Drau Dach Unternehmen Spenglerei Besten Info@draudachat Fassade Galerie Team Partner Steildach Geschichtenflachdach Stellenangebote
1017 Gabriela Nepo Stieldorf STARTSEITE Iksit
Gabriela Nepo Stieldorf IKSIT...
nepo-stieldorf.at Iksit Nepo Stieldorf Gabriela Tirol Ausstellungen Kontaktformular Biographie Workshops Galerie Bibliographie Reserved Bildhauer Totalstieldorf *
1018 Pension Strauss Strauss
Joomla dynamische Portal Engine und Content Management System...
pension-strauss.at Strauss Pension Joomla Wwwurlaub Galerie Lageplan Spambots Mail Portal Engine Anbietercomfewo Adresse Rights Rappitschsonnenscheinhtm
1019 Willkommen im Hundesalon Liesing Hundesalon
hundesalon-liesing.at Hundesalon Liesing Salon Tipps Terminanfrage Leistungen Galerie Seiten Mich Grossgut Urlaub Wegen Hundegeschlossenherzlich Tipp
1020 Alfred Pfleger Alfred
alfredpfleger.at Alfred Pfleger Violine Presse Videos English Galerie Diskografie Ensembles Wien Strauss Ensemblestrauß Johann
1021 Kunst von Alfredo Alfonso Alfonso
Alfredo Alfonso sind die beiden österreichischen Künstler Christian Hart und Martin Krammer....
alfredo-und-alfonso.at Alfonso Christian Martin Krammer Hart Alfredo Künstler Kunst österreichischen Beiden Galerie Musiktriennale Z
1022 Pension Haßlwanter Home Pension
Die offizielle Homepage der Pension Haslwanter in Ochsengarten...
pension-hasslwanter.at Pension Haslwanter Zimmer Ochsengarten Anfragelage Offizielle Galerie Haßlwanterhomepage Wohnungen übernachtung Wellnessbereich
1023 ÜBER UNS Galerie
hellmondbuehne.at Galerie Uns Gästebuch Server Quotprogrammquot Port Apache Anfahrt Geschichte Archiv Aktuell Beitrag Fotospermanently The
1024 Gerberhaus Culturproduktionen Gerberhaus
gerberhaus.at Gerberhaus Culturproduktionen Wiener Spielplan Galerie Weihnachtskonzert Krakau Bigband Elvis Martinikonzerte Schreiner Gerberhausculturproduktionenunikat Unesco Phantom
1025 Willkommen bei unsere tiere und wirat Katzen
unsere-tiere-und-wir.at Katzen Gästebuch Tiere Hunde Memoriam Marlene Galerie Homepage Unserer Wirat Powered Wedowebatallerechte Update
1026 Textil Art Siglinde Böhmer Siglinde
Siglinde Böhmer zeigt Textilbilder für Raumdesign. Vorbild für manche Textilcollagen aus Rohseide oder Loden waren Mondrian und Klee....
textil-art.at Siglinde Textil Böhmer Ausstellungen Klee Mondrian Art Galerie Vorbild Textilbilder Textilkunst Loden Wohnaccessoiresrohseide
1027 AMCö Alaskan Malamute Club Malamute
malamute.at Malamute Club Alaskan Besuchern Amcö Neuigkeiten Minuten Galerie Login Rescuevorstand Website Rechte Amcalaskan
1028 Fotostudio Gerald Riedler Hochzeitsfotograf Riedler
Für alle Gelegenheiten bei denen es darum geht einen Augenblick in einem perfekten Bild festzuhalten. Dafür steht das...
fotostudio-riedler.at Riedler Fotostudio Gerald Events Portraits Biografie Familienaufnahmen Galerie Passfotos Hochzeitsfotograf Fotobuch Standortgeht Perfekten Hochzeit
1029 KlangGut Klanggut
klanggut.at Klanggut Idee Galerie Programme Veranstalter Gut“ Musikhauptstädte Welthinausbedarf Forum Presse Klavier
1030 ARTEMARA Kunst und Malerei Kunst
Marady Artemara ölmalereiAcrylmalereiKunst und Malerei...
artemara.at Kunst Malerei Artemara ölmalerei Acrylmalerei Galerie Marady Bilder Kaufen Blten Verschiedenesmaras Maraprimes Lust
1031 GAK Wasserspringen Hauptmenü Tournament
gak-wasserspringen.at Tournament Alpe Adria österr Graz Mitglieder Int Jugendmeisterschaftenjugendmeeting Zufinale Paarspringen Ehrenmitglieder Galerie Trainer
1032 Team
txr.at Team Xlarge Passwort Downloads Kalender Benutzername Galerie Event Archiv Normal Gumpenberger Kartbahn Outdoor Uns
1033 GartenZauber ndash RosenLust 2013 Aussteller
garten-zauber.at Aussteller Anreise Rosenlust Geschichte Galerie Gartenzauber Schlosspark Ndash Unkostenbeitrag Garten Wunderbarensommer Gudenus Matuschka Hundemarienschlssl
1034 FORMELBAMBINI Kart
Formelbambini unsere Jungpiloten stellen sich vor....
formelbambini.at Kart Bambini Formelbambini Go Cart Team Sponsoren Trainer Gokart Ergebnisse Rennanzug Alte Galerie Helm Videos
1035 Home Maine Coon of Coon
mainecoon-of-eldorado.at Coon Galerie Maine Boys Kitten Nachdenkliches Cats Riesen Plans Mailyoungsters News Charakter Nature Eldorado *
1036 SPö Enzenreith Aktuelles Enzenreith
Webauftritt SPÖ Enzenreith...
spoe-enzenreith.at Enzenreith Spö Leitner Team Galerie Sepp Download Drpolitik Jugendfeuerwehren Democratic Schriftgre Webauftritt Partei
1037 Home Autohaus Grohs GmbH Gebraucht
fiat-auto.at Gebraucht Neuwagen Wagen Media Galerie Abteilung Lkws Bmedia Port Lkw Permanently Theserver Grohs Pkw
1038 Home Klasse
ttcvillach.at Klasse Mannschaft Bundesliga Sponsoren Galerie Berichte Medien Ettu Geschichte Ligen Unterliga Uhrdonnerstag Volksschule Villacherquot Y
1039 Thai Massage Ungarn Massage
thaimassageungarn.at Massage Thai Preise Ungarn Gäste Galerie Fertőd Thaimassageungarnat Schauenstress Preis Tisch Seele
1040 Tischtennis Trofaiach Tischtennis Trofaiach Trofaiach
tthc-trofaiach.at Trofaiach Tischtennis Tthc Galerie Linktipps Gästebuch Chronik Mannschaften Jimdo Logoutjung Spielerinnen Dieseseite Spielern
1041 Galerie ElisabethKlausThoman Home 6020 Innsbruck Guttmann
galeriethoman.at Guttmann Bruno Innsbruck Moved Walter Apache Krawagna Clegg Gironcoli Pichler Galerie Arkadenhof Peter Permanently The Y
1042 Home studiovocale Studiovocale
Das studiovocale ist ein gemischter Kammerchor mit derzeit 20 Mitgliedern der seinen Schwerpunkt auf geistliche Musikinsbesondere des 20....
studiovocale.at Studiovocale Hörprobenmp Ltd Chor Co Kammerchor Yaml Tnet Repertoire Galerie News Derzeit Josquin Michael Buchenkontaktieren
1043 Welcome to Traditional Thai Massage in Massage
Ein Angebot für Traditionelle Wat Pho Thai Massage in Wien...
thai-massage-wien.at Massage Thai Anfahrt Neuigkeiten Ausbildung Haftung Kontaktformular Hinweise Galerie Preise Angebot Traditionelle Wien Pho Welcome
1044 Willkommen auf der Startseite Vibrations
Trommel Styrian Vibrations Styrian Vibrations Pinggau Djembe afrikanische Musik...
styrian-vibrations.at Vibrations Styrian Direkt Uns Djembe Inhaltschnupper Trommeln Php Galerie Afrika Anmeldung Hörbeispiele Trommel
1045 Silvia039s Creation Silvias
Walzgoldschmuck in Handarbeit aus Österreich...
silvias-creation.at Silvias Creation Walzgold Gold Walzgoldschmuck Galerie Schmuck Austellungen Ausstellungen Modeschmuck Ausstellungmineralienmesse Mittlerweile Allergikerimstande Stadthalle Y
1046 gosia foremna [ zeitgenössische malerei] Malerei]
foremka.at Malerei] Einzelausstellung Wien Foremna Bsendorferstrae [ Zeitgenössische Projekte Oper Galerie Gosiabiografie Texte Bilder
1047 Steirisch Pub Wien Startseite Pub
steirisch-pub.at Pub Steirisch Wien Galerie Poier Sparverein Rent Anfahrtsplan Wochenprogramm Steirerstammtisch Bringen Bilder Panorama Alfkeine
1048 index Kunstschmied
Der Kunstschmied aus dem Tullnerfeld...
kunstschmied-geiger.at Kunstschmied Mich Gallery Galerie Lindenstraße Website Designed Edelstahl Art Schmiedearbeiten Designschmiedeeisenaller Frauenhofentel Uzango
1049 wwwblauersalonat Home Bilder
Blauer Salon Bilder Galerie Malerei Ruheinsel...
blauersalon.at Bilder Galerie Anfrage Ruheinsel Leistungen Idee Salon Gästebuch Blauer Malerei Lageplanwwwblauersalonat Uns Copyright
1050 wwwtonmalereiat Pottery Painting Painting
tonmalerei.at Painting Kunsthandwerk Pottery Galerie Wwwtonmalereiat Tonmalereikunst Bunt Art Kunstforum Bemalte Veranstaltung Tassen Galerien Kunstverzeichnis
1051 Juranitsch Racing Racing
Juranitsch Racing...
juranitsch-racing.at Racing Juranitsch Rad Saison Thomas Presse Material Magnum Equipment Rennen Verfgung Sponsoren Galerie Most Rijeka
1052 Rasse
Siam Katzen die orientalische Tiere bei Siamotal...
siamotal.at Rasse Katzen Orientalische Kater Tiere Katze Siam Siamotal Gästebuch Babys Galerie Siamkatzensiamkatze Siamtiere
1053 FRUCTOMAT HOME Vendingmaschinen Dispenser Partner
fructomat.at Partner Philosophie Dispenser Vendingmaschinen Downloads [] Benutzungshinweise FruchtgetrÄnke Galerie Fructomat Fruchtsaftautomatenlogin Jdm Modelle
1054 Galerie Carinthia
Dr. Irmgard Bohunovsky informiert über die Künstler der Galerie, über die Galerie selbst und über Publikationen. ?-ffnungszeiten und Kontaktinformationen stehen ebenfalls zur Verfügung.
Bohunovsky Carinthia Irmgard Galerie Klagenfurt Web Homepage Ossiach
1055 Galerie Schloss Puchheim
Galerie für zeitgenössische Kunst. In jährlich 5-7 Ausstellungen wird Malerei, Grafik, Skulptur und Fotografie gezeigt. Informationen zur Galerie, Künstler, Ausstellungen und Veranstaltungen.
Peter Wolfgang Galerie Vernissage Einführende Worte Eröffnung Schloss
1056 Galerie Hubert Winter
Stellt die von der Galerie vertretene Künstler vor und berichtet über Ausstellungen.
Art Kunst Michael Galerie Galeriehubertwinter Internationale Birgit Konzeptuelle
1057 Galerie Lehner
Vorstellung der Galerie anhand von etwa 120 Bildern und dazugehörigen Texten.
Ausstellung Galerie Lehner Linz Nächste Wien Ausstellungen Hans
1058 Galerie Bar am Klopeiner See
Die Galerie Bar ist der Treffpunkt für junge Leute am Klopeinersee. Umfassende Bildergalerie, Veranstaltungen.
Galeriebarat Goclick Here Z
1059 Galerie Pehböck
Information über die ausgestellten Künstler, die Kunstwerke und die Galerie.
Galerie Pehböck Pehbck Kunst@pehboeckat Aktuell Naarn Künstler Erwin
1060 Mobile Galerie, Angelika Gall
Stellt das Konzept der Mobilen Galerie vor und bietet zeitgenössische Bilder und Skulpturen.
Kunst Bilder Fuchs Glasobjekte Zeitgenössische Galerie Skulpturen Abstimmung
1061 Mobile Galerie, Angelika Gall
Stellt das Konzept der Mobilen Galerie vor und bietet zeitgenössische Bilder und Skulpturen.
Kunst Bilder Skulpturen Galerie Fuchs Zeitgenössische Glasobjekte Art
1062 Galerie im Taxispalais
Nichtkommerzieller, öffentlicher Ausstellungsort für internationale zeitgenössische Kunst. Bietet Informationen zu Programm, Leseraum und Publikationen sowie eine Kustvermittlung und Fotos der Galerie.
Galerie Taxispalais Tirol Landes Navigation Kunst Art Programm
1063 Galerie im Taxispalais
Nichtkommerzieller, öffentlicher Ausstellungsort für internationale zeitgenössische Kunst. Bietet Informationen zu Programm, Leseraum und Publikationen sowie eine Kustvermittlung und Fotos der Galerie.
Galerie Taxispalais Tirol Landes Kunst Programm Art Navigation
1064 Galerie Ernst Hilger Wien
Bietet neben allgemeinen Informationen auch eine Künstlerdatenbank und eine virtuelle Galerie.
Hilger Galerie Modern Ausstellungen Fairsbrotkunsthalle Partner Ernst Künstlercontemporary
1065 Galerie Ernst Hilger Wien
Bietet neben allgemeinen Informationen auch eine Künstlerdatenbank und eine virtuelle Galerie.
Hilger Galerie Ausstellungen Dorotheergassefairs Editionen Künstler Contemporary Modern
1066 Galerie Brunnhofer und Siebdruck Brunnhofer Ges.m.b.H
Gibt einen Überblick über das Angebot im Sieb- und Digitaldruck mit Produktbeispielen und informiert über Künstler und Veranstaltungen in der Galerie.
Indra Galerie Bilder Rainbowgrey Ausstellung Brunnhofer English Indrablackbirds
1067 Galerie Tulbingerkogel
Galerie im Wienerwald.
Peter Hans Josef Karl Franz Ernst Kurt Walter
1068 Aura-Kachelöfen
Information über den Hersteller von Kachelöfen. Photo-Galerie, Skizzen-Galerie und Produktinformation.
1069 Galerie Judith Walker
Der Webauftritt informiert über die Galerie und ihre Ausstellungen im Schloss Ebenau in Weizelsdorf, erzählt aber auch die Geschichte des Schlosses und der Hollenburg. Ausserdem werden Anfahrtshilfen, Künstlerporträts und Kontaktinformationen angeboten.
Rosental Ebenau Ausstellungen Galerie Austria Walker Schloss Verständnis
1070 Werner Berg Galerie
Die Galerie bietet einen Rundgang durch die Ausstellungen, die Biografie des Künstlers, einen Shop für Billets und Karten sowie Informationen über ?-ffnungszeiten und Kontaktmöglichkeiten.
Rights Multi Teamall Passwort Panel Control Reserved Mscp
1071 Werner Berg Galerie
Die Galerie bietet einen Rundgang durch die Ausstellungen, die Biografie des Künstlers, einen Shop für Billets und Karten sowie Informationen über ?-ffnungszeiten und Kontaktmöglichkeiten.
Reserved Multi Teamall Rights Mscp Panel Anmeldung Server
1072 Galerie Pimmingstorfer
Zeitgenössische Kunst in der Galerie Pimmingstorfer in Peuerbach.
Z Y
1073 Galerie Pendel
Das "Pendel" ist eine Galerie, in der ein breites Spektrum an bildnerischen Ausdrucksformen Raum findet. Neben Malerei, Bildhauerei, Medienkunst und Fotografie gibt es einen eigenen Schwerpunkt für Design, Mode und Architektur.
Domain Kulturpendelat Informationen Parking Kulturpendel Programm Beacons Inhaber
1074 Atelier Raab
Das Atelier beherbergt neben einer kleinen Galerie auch eine Malschule. Kunst zeigen, schaffen und weitergeben macht dieses Haus zu einem kreativen Ort. Informiert über die Galerie und die Malschule.
Raab Atelier Galerie Schloss Mail Heidrun Seit Office@gwzat
1075 Werner Berg Galerie
Die Galerie bietet einen Rundgang durch die Ausstellungen und die Biografie von Werner Berg.
Passwort Teamall Multi Rights Reserved Mscp Panel Anmeldung
1076 Werner Berg Galerie
Die Galerie bietet einen Rundgang durch die Ausstellungen und die Biografie von Werner Berg.
Server Anmeldung Mscp Control Panel Teamall Reserved Multi
1077 Galerie Holzer, Jugendstil und Art Deco
Jugendstil, Art Deco, Art Nouveau, Wiens grösste Jugendstil Galerie auf 1000+?-?
Deco Jugendstil Lampen Wien Art Möbel Mbel Uhren
1078 Sportunion Grieskirchen
Teams, Galerie, Gästebuch.
Grieskirchenschloesserlauf Fg Faustball Leichtathletik Laufen Volleyball Sportunion Badmintonturnen
1079 Doerr
Galerie Dörr, Glas Dörr in Marbach an der Donau
Glaserei Glas Dörr Duschkabinen Küchenrückwände Stiegengeländer Galerie Wintergärten
1080 tex art
Agentur und Galerie für Textile Kunst in Salzburg.
Kunst Bau Textile Textilobjekte Ausdrucksstarke Sichtschutz Schalldämmung Faqs
1081 tex art
Agentur und Galerie für Textile Kunst in Salzburg.
Kunst Bau Textile Ausdrucksstarke Textilobjekte Sichtschutz Licht Farbleitsysteme
1082 Fiestamen
Zur Person, Tagebuch, Galerie, Forum und Gästebuch.
1083 SV Pregarten Tennis
Clubleben, Erfolge, Portrait, Sponsoren, Galerie.
Pregarten Herren Tabelle Sv Hofstadler Alles Klasse Martin
1084 Atomic Cafe
?-ffnungszeiten, Gastro-Philosophie und Photo-Galerie.
Jahre Atomic Bielbienne Biel Cafeacute Biennez Ans
1085 Sport- und Kulturverein FC Donald
Informiert über aktuelle Aktivitäten, mit Galerie.
Archiv Rennlauf Hauptmenü Frisbee Schi Gespannfahren Wandern Donald
1086 Galerie Erbler
Kunstdrucke, Originalradierungen, Grafikeditionen. [A-9562 Himmelberg]
Radierwerkstatt Werbegrafik Editionen Erbler Kupferdruck Galerie Graphik Bilder
1087 SV Gutenberg
Informiert über Chronik, Vorstand und Teams, mit Galerie und Gästebuch.
Gutenberg Events Sv gutenberg Mannschaften Vorstand Verein Bildergalerie Sportverein
1088 Seeappartement Erlberg
Informationen zu den Appartements, Preise, Anreise und Foto Galerie
Unbenanntes Dokumenty
1089 Aramis Quero vom Steinacherhof
Vorstellung des Zuchtrüden mit Galerie, Erfolge und Ahnen.
Konnten Versuchen Kontaktieren Website Seiten Austria Upcat Adresse
1090 Galerie Wuensch, Kunsthandel
Präsentation kubanischer Kunst in Linz, Austria
Art Kunst Wünsch Winfried Cuban Wwwartmarketat Contemporary Kubanische
1091 Ortag-Glanzer, Walpurga
Homepage der österreichischen Malerin mit Biografie und Galerie.
Glanzer_willkommen Walpurga Ortagy
1092 Ulfs Galerie
Bilder der Malerin Hadwig Schubert und des Malers Wolfgang Böhm.
1093 Andys Ein-Mann-Band
Informationssite mit Bilder- und Adio-Galerie und Kontaktadressen.
Band Wojik Andys Gegenwart Sacralmusik Gesang Andreas Sakralmusik
1094 Atelier photo
Presentation des services et galerie dimages. Lausanne, Vaud.
Photo Photos Suisse De Lausanne Photographe Book Studio
1095 Hauptschule Haselstauden
Aktuelles, Lehrer, Schüler, Galerie, Integration, Bücherei.
Japan [] Kat Vorarlberger Netzwerke Titel Schulen Support
1096 Stangl-Kurmulis, Konstanze
Eine Galerie ihrer Bilder und ein Gästebuch.
Bilder Kunstart Stangl Kurmulis Constanze Kunst Kreativitätz
1097 Take Five music
Coverband aus dem Südburgenland bringt Selbstvorstellung, Musikseite, Galerie, Gästebuch und Downloads.
Band Takewwwtakemusicat Takemusic Gruppe Auftritt österreich | Burgenland
1098 Grenzland Oldtimerclub
Neuigkeiten, Vorstellung des Clubs, Termine, Literatur und eine Galerie.
Neuigkeiten Weblinks Gästebuch News Galerie Joomla Poker Oldtimerclub
1099 SV Deutschfeistritz
Vorgestellt werden die Kampf- und Jugendmannschaften, der Vorstand und die Spielergebnisse. Mit Galerie und Archiv.
Permanently The Apache Port Serverz
1100 Galerie Ariadne
JüngereKünstlerinnen und Künstler, vor allem in den Bereichen Malerei und Zeichnung.
Versuchen Spteren Befindet Under Aufbaubitte Constructionplease Wwwariadneatdiese Noch
1101 Rosman, Johan
Galerie zur künstlerischen Entwicklung des Fotografen und Einblicke in seine Studien.
Rosman Johan Fotografie Internet Targets Managedby Meidlingtarget Anfanghosted
1102 Galerie vor Ort
Ausstellungen, Lesungen, Performances, junge zeitgenössische Kunst, Malerei
Galerie Ort Menüz
1103 Galerie Ariadne
JüngereKünstlerinnen und Künstler, vor allem in den Bereichen Malerei und Zeichnung.
Z Currently Aufbaubitte Europe Spteren Zeitpunkt Befindet Constructionplease
1104 Absurd-Das Cafe
Beheimatet auch ein Tatoo-Studio. Bar und Küche, Kalender, Forum, Galerie.
Just Segeln Sailing Skipper Absurd Team Forum Kornaten
1105 Puppenmuseum Villach
Museum der zeitgenössischen Puppenkunst mit angeschlossener Galerie für Künstlerpuppen und Teddybären.
Puppenkunst Künstlerbären Villach Puppenmuseumkünstlerpuppen Seiten Teddybären Z
1106 Ortag, Andreas
Homepage des österreichischen Malers und Grafikers. Biografie, Tagebuch, Galerie, Pinhole.
Ausstellung Raabs Startmenue Horn Raum Ortag Andreas Augenblicke
1107 Atelier Ultramarin
Anbieter für Dekorations- und Illusionsmalerei, Oberflächen- und Fassadengestaltung mit Galerie zu besichtigen.
Atelier Ultramarin Theatermalerei Wandmalerei Raumgestaltung Illusionsmalerei Techniken Stukkaturen
1108 Baxrainer, Wolfgang
Zeigt eine Galerie seiner Werke und informiert über Kurse und Aquarelltage.
Baxis Serviceseite Unterseite Wwwaquarellkurseat Wwwbaxrainerat Error Z
1109 Torjin Taro
Fansite mit Geschichten, Forum, Zitaten, Abenteuern, Gruppenbeschreibungen, Galerie und Charakteren.
Torjin Taro Geschichten Galerie Schwarze Auge Tretet Boronanger
1110 Puppenmuseum, Villach
Museum der zeitgenössischen Puppenkunst mit angeschlossener Galerie für Künstlerpuppen und Teddybären.
Puppenkunst Künstlerbären Seitenteddybärenpuppenmuseum Künstlerpuppen Villach
1111 Puppenmuseum Villach
Museum der zeitgenössischen Puppenkunst mit angeschlossener Galerie für Künstlerpuppen und Teddybären.
Puppenkunst Künstlerbären Puppenmuseumkünstlerpuppenvillach Teddybären Seiten
1112 Tirolkunst
Plattform für Tiroler Künstler und Galerie für Bilder jeder Art. Mit Terminkalender, Newsletter und Kontaktformular.
Galerie Künstler Kunst Tirol Internet Bildhauer Grafiker Art
1113 Alpencamping Nauders
Beschreibung des Platzes mit Preisen und einer kleinen Galerie auch von der Umgebung.
Alpencamping Nauders Camperzelt Mangalify Sonne Urlaub Caravan Seinen
1114 Miatapower
Tipps und Tricks werden zusammengefasst sowie Fotos in einer Galerie gezeigt.
1115 Alpencamping Nauders
Beschreibung des Platzes mit Preisen und einer kleinen Galerie auch von der Umgebung.
Nauders Alpencamping Camperreschenpass Camping Platz Jedem Zelt Caravan
1116 Knill, Christine
Abstrakte Acrylbilder der Malerin aus Hörbranz bei Bregenz am Bodensee. Mit Galerie und Vita.
Internet Tv Handy Alt+ Handys Abfragen Zusatzpakete Produktberater
1117 Alpencamping Nauders
Beschreibung des Platzes mit Preisen und einer kleinen Galerie auch von der Umgebung.
Nauders Alpencamping Jedemseinen Wohnwagen Zelt Camper Camping Mangalify
1118 Harringer, Rudolf
Virtuelle Galerie des Künstlers mit zahlreichen Kategorien wie Fantastic, Spaceart und Abstrakt.
Galerie Kunst Spaceart Natur Abstrakt Tiere Bestellung Mensch
1119 Puppenmuseum, Villach
Museum der zeitgenössischen Puppenkunst mit angeschlossener Galerie für Künstlerpuppen und Teddybären.
Puppenkunst Künstlerbären Künstlerpuppen Villachpuppenmuseumseiten Teddybären
1120 Volksschule
Eine Galerie mit Schülerarbeiten, ein Terminkalender und Infos für Eltern sind abrufbar.
Homepage Adnet Vsbrowserihrem
1121 Textilwerkstatt Ulrike Unterlass
Vorstellung des Sortiments an Filzviechern und -hüten. Mit Filzkunst-Galerie. [A-5541 Altenmarkt]
Ulrike Textilwerkstatt Unterlass Pongau Altenmarkt Marktplatz Spielzeug Unterlaß
1122 Innsbruck, Galerie im Taxispalais
Nichtkommerzieller öffentlicher Ausstellungsort für internationale zeitgenössische Kunst.
Galerie Taxispalais Tirol Landes Art Navigation Kunst Programm
1123 Alpencamping Nauders
Beschreibung des Platzes mit Preisen und einer kleinen Galerie auch von der Umgebung.
Alpencamping Nauders Urlaubcamper Platz Tirol Reschenpass Wohnwagen Mangalify
1124 Innsbruck, Galerie im Taxispalais
Nichtkommerzieller öffentlicher Ausstellungsort für internationale zeitgenössische Kunst.
Galerie Taxispalais Tirol Landes Programm Navigation Kunst Art
1125 Franks
American Bar, Restaurant und Musiklokal. Events, Galerie, Dinner, Drinks, Bar, Philosophie, Kontakt.
Z Y
1126 Hauptschule Frastanz
Schulhomepage mit Schulprofil, Terminen, Klassen, Aktuellem, einer Galerie und einem Gästebuch.
Fotoalbum Wienwoche Sportwoche Teil Klassen Nawi Klasse Sporttag
1127 Zaphyr
Informationen über die angewandte Technik, den Weg zum eigenen Abdruck und Bilder von fertigen Arbeiten in einer Galerie.
Document Untitledy
1128 UTC Leogang
Es werden Informationen über die Ranglisten, Club-Meisterschaften, sowie eine Foto-Galerie gezeigt.
Z Y
1129 Kunst Raum Goethestrasse
Die Galerie informiert über aktuelle Verkaufsausstellungen und ein Archiv mit Ausschnitten früherer Ausstellungen.
Kunstraum Andraschek Goethestrasse Projekt Foto Xtd Then Iris
1130 1.FC Christkindl
Der Fussballverein informiert über den Verein, die Spieler, errungene Erfolge und zeigt Bilder in einer Galerie.
1131 Galerie Chobot
Arbeiten auf Papier und Skulpturen, Betreuung von Nachlässen, z.b. Karl Anton Fleck
Galerie Karl Alfred Chobot Galerien Gironcoli Manfred Knstler
1132 Fischerbräu
Gasthofbrauerei mit einem schattigen Kastaniengarten in Wien. Restaurant, Musikveranstaltungen und eine Panorama-Galerie.
Hopft Fischerbräu Herzy
1133 Kern, Rupert
Online-Galerie des Malers mit Ausstellung der Arbeiten aus den letzten Jahren und Hinweise auf Veranstaltungen.
Galerie Rupert Acryl Atelier Kern Aquarell Holzbilder Holzbild
1134 Fischerbräu
Gasthofbrauerei mit einem schattigen Kastaniengarten in Wien. Restaurant, Musikveranstaltungen und eine Panorama-Galerie.
Herz Fischerbräu Hopfty
1135 Hotel Marmotta
Lage, Anfrage, Preis, Essen, Galerie, Kontakt und Informationen über das Haus und die Betreiber.
Hotel Gargellen Skischule Beschneiung Video Skigebiet Pension Familienmitglieder
1136 Volksschule Gutenberg an der Raabenklamm
Die Schule stellt sich vor. Kinder, Lehrer, Termine, Kindertexte und eine Galerie.
Gutenberg Volksschule Vs Kindertexte Bilder Projekte Raabklamm Hotpotatoes
1137 Stars nStripes
Hits der 60er und 70er Jahre bis zu aktuellen Titeln. Repertoireliste, Galerie, Terminplan und Veranstalterinfos.
Künstler Musik Band Festplanung Hochzeit Veranstaltung Fest Showacts
1138 Schlechte Zeiten
Ironische Site über "die schlechteste Serie der Welt" mit Foto-"Galerie des Leidens", Enzyklopädie, Archiv.
1139 Galerie bei der Albertina
?-sterreichische Kunst des 20. Jahrhunderts mit Exponaten des Jugendstils, der Wiener Werkstätte und der österreichischen klassischen Moderne.
Albertina Galeriey
1140 Keramikum
Die Galerie für Keramik, Malerei, Grafik und Kunstgegenstände präsentiert einige Werke und stellt die beteiligten Künstler vor.
Malerei Kunstkiste Grafik Keramik Gugl Kunstschaffende Künstler Design
1141 Galerie Fotozeile
Präsentation der Fotografien der Studenten aus den Kursen der Fotoschule Wien als Abschlussausstellung. Bilder zu unterschiedlichen Themen.
Fotoschule Fotogalerie Fotozeile Fotokurs Fotokurse Wien Galerie Fotografie
1142 Murauer Jugend Portal
Präsentation des Fotoprojekts für Jugendliche aus Murau. Mit Archiv, Galerie, Forum, Gästebuch und Chat.
Heimat Mei Leitung Browser Fallsz Httpwwwschlosslindatmei Link
1143 Galerie Baumgartner
Veranstalter von Ausstellungen und Kunst-Genuss-Ausflügen. Details und aktuelle Künstler. [A-5020 Salzburg]
Baumgartner Temporis Ars Galeriez
1144 Poszvek, Angelika
Informationen über die Wiener Posaunistin. Lebenslauf, Studium, Bands, Termine und eine Galerie mit Bildern.
1145 Poszvek, Angelika
Informationen über die Wiener Posaunistin. Lebenslauf, Studium, Bands, Termine und eine Galerie mit Bildern.
1146 Poster-Galerie Innsbruck
Rahmen sowie Auswahl von über 1000 gerahmten Bildern. Produktüberblick und Kontaktinformationen.
Z Y
1147 Poszvek, Angelika
Informationen über die Wiener Posaunistin. Lebenslauf, Studium, Bands, Termine und eine Galerie mit Bildern.
1148 Poszvek, Angelika
Informationen über die Wiener Posaunistin. Lebenslauf, Studium, Bands, Termine und eine Galerie mit Bildern.
1149 Museum moderner Kunst - Stiftung Ludwig Wien
Allgemeine Informationen, aktuelle Ausstellungen, virtuelle Galerie.
Stil Wille Kunst [lesen] Moderne Klee Picasso Beuys
1150 Galerie Ernst Hilger
Gezeigt wird ein Programm von Klassischer Moderne bis zur zeitgenössischen internationalen und österreichischen Kunst.
Hilger Galerie Ernst Ausstellungen Fairseditionen News Brotkunsthalle Partner
1151 Galerie Klingberg Salzburg
Präsentiert zeitgenössische Malerei in Ausstellungen und Vernissagen der Salzburger Künstlerin Ines Höllwarth.
Domain Galerie Parking Domains Klingbergat Website Programm Klingberg
1152 TC-Altenberg
Es werden die Mannschaften der Meisterschaftsbetrieb sowie Sponsoren präsentiert. Zudem gibt es eine Foto-Galerie von Festen.
1153 Audi4ever
Bietet eine grosse Galerie, Neuigkeiten rund um Audi, einen Downloadbereich sowie ein Forum zum Erfahrungsaustausch.
Audi Michl Hölli Videos Update Fotos Presse Stammtisch
1154 Ariadne
Galerie für junge österreichische und internationale Malerei und Fotografie in Wien. Stellt Bilder und Künstler mit Lebensläufen vor.
Z Under Host Versuchen Spteren Zeitpunkt Einmalthis Currently
1155 Art Design & Creation
Galerie für Airbrush- und Acrylbilder, Photos, 3D-Art, Gedichte, Links. Stellt den Künstler vor und bietet eine Bildergalerie.
Ms Sklerose Storys Multiple Gedichte Dahlke Rüdiger Meditation
1156 Kulturtreff Altes Kino
Informiert über das aktuelle Programm, bietet ein Archiv und eine Übersicht der aktuellen Ausstellungen in der Galerie.
Browseraltes Stflorian Kulturtreff Technologien Leider Daher Kino Homepage
1157 Creativstudio
Erstellt Hochzeitsfilme für den schönsten Tag im Leben. Informiert über das Team und zeigt eine Galerie erstellter Arbeiten.
Spots Tv Hochzeitsvideos Musikvideoskonzert Google Bogataj File Download
1158 Ariadne
Galerie für junge österreichische und internationale Malerei und Fotografie in Wien. Stellt Bilder und Künstler mit Lebensläufen vor.
Z Constructionplease Host Zeitpunkt Befindet Currently Spteren Wwwariadneatdiese
1159 Galerie Ernst Hilger
Gezeigt wird ein Programm von Klassischer Moderne bis zur zeitgenössischen internationalen und österreichischen Kunst.
Hilger Galerie Brotkunsthallepartner Contemporary Fairs Wien Dorotheergasse Ernst
1160 Sky Surf
Homepage mit einer grossen Galerie zum Thema Fallschirmspringen, weiterhin gibt es noch Sektionen für Fallschirmspringer und Tandempassagiere.
Found Hereserverport Click Found The Proceed Apache
1161 VW-Heaven.at
News, Infos, Galerie, Tuning, Forum, Vorstellungen, Studien und anderes rund um Volkswagen, Audi und Seat.
Z Y
1162 Hotel Berger
Geschichte, Galerie, Ausstattung, Zimmerpreise, Verpflegung, Freizeitmöglichkeiten, Anreise und Online-Anfragemöglichkeit.
Z Y
1163 10er Haus
Galerie in Gmunden. Informiert über die ?-ffnungszeiten und die ausgestellten Gemälde, Skulpturen, Keramiken, Glaskunst, Schmuck, Kerzen und Künstlerbedarf.
Dokument Unbenanntesy
1164 Galerie Johannes Faber
Includes exhibition schedules, photographs from current exhibitions, and contact information. Located in Vienna, Austria.
Faber Galerie Johannes Fotogalerie Wien Exhibitions Gallery Vienna
1165 Drobil, Andreas
Zeigt eine Galerie seiner Werke, erläutert deren Bedeutung und bietet Möglichkeit zur Preisanfrage.
Error Information Services Setup Common Microsoft Custom Administrative
1166 Galerie Fotohof
Art photography in Salzburg, Austria. Information about exhibitions past and present, a photo library and an Austrian Photographers Directory.
Togu Mail Passwort Adresse Fitness Gesundheit Obermaier Mein
1167 Holzbau 1
Zusammenschluss von Holzbauunternehmen im Hausbau in Oberösterreich. Informiert über die Mitglieder und zeigt eine Galerie ersteller Holzhäuser.
Holzbau Erfahren… Holzbauat Betriebe Bildergalerie Dämmung Partnerfirmen Mitglieder
1168 Weingut Melcher Schloss Gamlitz
Vorstellung des Schlosses mit dem Museum Steirische Weinkultur, der hauseigenen Buschenschänke mit Galerie und dem Übernachtungsangebot. Fotos und ein Veranstaltungskalender.
Schloss Gamlitz Feiern Melcher … Hochzeitsfeiern Tagungen Hotel
1169 Galerie 1990
Sowohl junge als auch arrivierte Künstler, vier bis sechs Ausstellungen pro Jahr, mit den aktuellen Terminen. [A-7000 Eisenstadt]
Domain Information Upcz
1170 Fliesenjoe Niederbrucker Josef
Der Fliesenleger aus Mondsee beschreibt die Leistungen in Bad, Küche, Terrasse, Böden, Stein und zeigt in einer Galerie durchgeführte Arbeiten.
Fliesen Niederbrucker Bad Qualität Böden Bäder Spezialist Stiegen
1171 Holzimpuls Kitzmüller
Versteht sich als Problemlöser in Sachen Innenraumgestaltung. Berichtet über das Unternehmen und zeigt eine Galerie mit erstellten Werken.
Holz Georg Impuls Kitzmüller Begleitung Tischler Holzimpuls Druckversion
1172 Kunsthandel Elisabeth Michitsch
Die Galerie ist spezialisiert auf Jugendstil, Art Deco und österreichische Kunst. Schwerpunkte bilden Glas-, Keramik & Metallarbeiten, Möbel & Malerei
Elisabeth Michitsch Emichitsch@elisabeth Michitschat Webseite Aktuell Kunstmanagementberatung Geplanter
1173 Erste ?-sterreichische Taucherakademie
Die Schule bietet Informationen zu Kursen, Reisen, Kundenservice, Tauchguiding und eine Galerie mit ansprechenden Unterwasseraufnahmen. [A-1150 Wien]
Uns Tüv Tauchertreff Wien Reisen Urlaub Tauchen Deine
1174 Mobile Galerie, Angelika Gall
Lithographien und Radierungen namhafter österreichischer Künstler, Originale in ?-l, Raumgestaltung, hochwertige Rahmen. Vor-Ort-Besuche für individuelle Lösungen.
Kunst Bilder Glasobjekte Galerie Fuchs Skulpturen Zeitgenössische Exquisite
1175 Veith, Martin
Zeichnet Karikaturen und Tier-Portraits nach Fotos. Bilder können in Auftrag gegeben werden. Vita, Galerie und Kontakt.
Karikaturen Geschenk Hochzeit Karikatur Bilder Veith Geburtstag Martin
1176 WLB Wiener Lokalbahnen AG
Personen- und Güterverkehr Wien - Baden ("Badner Bahn"). Geboten werden ein Unternehmensportrait, Tarife, eine Galerie und ein Link zur Fahrplanauskunft.
Bahn Tarif Fahrpläne Badner Wiener Auskunft Shop Rechtliche
1177 WLB Wiener Lokalbahnen AG
Personen- und Güterverkehr Wien - Baden ("Badner Bahn"). Geboten werden ein Unternehmensportrait, Tarife, eine Galerie und ein Link zur Fahrplanauskunft.
Bahn Tarif Fahrpläne Badner Wiener Hinweise Auskunft Wlb
1178 Schachclub Raika Rattenberg
Berichtet über Veranstaltungen und Termine sowie über Ergebnisse von Mannschaftskämpfen. Fotos aus dem Vereinsleben werden in einer Galerie angeboten.
Rattenberg Schlossberg Bester Schachklub Chronik Google Leute Tirol
1179 WLB Wiener Lokalbahnen AG
Personen- und Güterverkehr Wien - Baden ("Badner Bahn"). Geboten werden ein Unternehmensportrait, Tarife, eine Galerie und ein Link zur Fahrplanauskunft.
Bahn Fahrpläne Tarif Badner Wiener Shop News Hinweise
1180 WLB Wiener Lokalbahnen AG
Personen- und Güterverkehr Wien - Baden ("Badner Bahn"). Geboten werden ein Unternehmensportrait, Tarife, eine Galerie und ein Link zur Fahrplanauskunft.
Bahn Tarif Fahrpläne Badner Wiener News Shop Auskunft
1181 Mobile Galerie, Angelika Gall
Lithographien und Radierungen namhafter österreichischer Künstler, Originale in ?-l, Raumgestaltung, hochwertige Rahmen. Vor-Ort-Besuche für individuelle Lösungen.
Kunst Bilder Fuchs Galerie Glasobjekte Skulpturen Zeitgenössische Städtemotive
1182 Artbits - Galerie & Edition
Digital erstellte, bearbeitete und gedruckte Werke aus den Bereichen der Fotografie, des Graphic Designs, der 3D- und Rendering-Art, Computer-Art und digitaler Konzeptkunst.
Galerie Artbits Kunst Art Markus Wien Keramik Gerald
1183 Kids-Web Austria
Veranstaltungstipps, Galerie von Kinderwerken und Link-Listen. Angebot strukturiert nach Altersgruppen: small (6-10), medium (10-14), large (ab 14) und Stadtinformationen für Wien.
Rezepte Kidsweb Natur Basteln Malen Menschen Freizeit Wien
1184 Galerie aRtelier Peter Meier KEG
Präsentiert Arbeiten junger noch weitgehend unbekannter Künstler und eine Auswahl Thangkas (tibetischer Rollbilder).
Galerie Kunst Art Wien Galleries Artelier Künstler Bild
1185 RBT Tuning
Tuning und Carstyling. Neuigkeiten, Produkte, Galerie, Standort. [A-4501 Nehofen/Kr.]
Domain Rbt Parking Domains Tuningat Informationen Thema Umzug
1186 ?-sterreichische Galerie Belvedere
Informiert über die Sammlungen und Veranstaltungen in den Belvedere Schlössern.
Belvedere Haus Ausstellungen Sammlungen Programm Museum öffnungszeiten Schloss
1187 Hepp.art
Bildende Kunst von Elmar Paul Hepp. Mit Online-Galerie.
Internet Tv Handy Handys Alt+ Abfragen Produktberater Zusatzpakete
1188 German Alizee Fanpage
Fanpage mit Wallpaper, Skins, Galerie, Songs, Lyrics und Neuigkeiten.
1189 Kulturverein Multikulti
Multikulturelle Events für multikulturelle Menschen. Mit Veranstaltungshinweisen, Rückblick, Galerie, Anfahrtsbeschreibung und Forum.
Stpaul Multikulti Multikulturelle Wriesnik Kulturverein Kulturstätte Events Sternath
1190 Sternwarte der Benediktiner Kremsmünster
Informationen über die Geschichte der Sternwarte, Publikationen sowie Galerie von Museumsobjekten.
1191 Sternwarte der Benediktiner Kremsmünster
Informationen über die Geschichte der Sternwarte, Publikationen sowie Galerie von Museumsobjekten.
1192 Sternwarte der Benediktiner Kremsmünster
Informationen über die Geschichte der Sternwarte, Publikationen sowie Galerie von Museumsobjekten.
1193 Sternwarte der Benediktiner Kremsmünster
Informationen über die Geschichte der Sternwarte, Publikationen sowie Galerie von Museumsobjekten.
1194 VDSt Graz
Studentische Verbindung mit dem Ziel, die Tradition des Studententums aufrecht zu erhalten. Informiert über Veranstaltungen, Mitglieder und Geschichte und bietet Galerie, Forum und Gästebuch.
Vdst Studenten Leoben Deutscher Graz Wien Straßburgtagung Verein
1195 VDSt Graz
Studentische Verbindung mit dem Ziel, die Tradition des Studententums aufrecht zu erhalten. Informiert über Veranstaltungen, Mitglieder und Geschichte und bietet Galerie, Forum und Gästebuch.
Vdst Studenten Leoben Deutscher Wien Graz Straßburgtagung Verein
1196 Schlossbräu Dornbirn, Brauerei Restaurant Bar
Der wiedereröffnete Braugasthof im Dornbirner Oberdorf wird mit einer Galerie, einem Gästebuch und seinem Shop vorgestellt.
Domain Kaufen Domains Aftermarket Kauf Register Golem Hilfe
1197 Die jungen Orangen
Informationen zum Jugenddepartment mit Vorstellung der Themen und Terminen. Präsentiert das Team und zeigt eine Foto-Galerie zusätzlich einen Newsletter.
1198 Galerie Cult
Präsentation von aktueller internationaler und österreichischer Kunst. Zusätzlich werden Ausstellungsprojekte für andere, teilweise kunstfremde Orte konzipiert und realisiert.
Z Y
1199 Galerie Unart
Präsentation nationaler und internationaler bildender Kunst mit dem Schwerpunkt neue gegenständliche Kunst.
Access Apacheerror Thereis Forbidden Z
1200 Gs Diskus
Private Webseite von Gerd Schönbauer mit Tipps zur Haltung und Zucht plus eigener Diskus-Galerie.
Austria Finden Upcat Erstellen Thema Hilfe Seiten Fehler
1201 Hauptschule Lavamünd
Die Schule mit Informatik- und Musikklassen, stellt sich, die Direktion, das Lehrerteam und die Projekte vor. Angeboten werden eine Galerie, ein Rundgang, Schülerberatung und ein Gästebuch.
Centos Apache System Operating Test Centosproject Enterpriselinuxvendor Contact
1202 Benefit Wirtschaft & Training Gmbh
Spezialisiert auf das Organisieren von Seminaren und Events im In- und Ausland. Galerie der letzten veranstalteten Workshops. Übersicht der Förderungsmöglichkeiten durch den Staat.
Benefit Event Unternehmensberatung Bauwirtschaft Training Seminare Trainer Seminarleitung
1203 Löffler, Dagmar
Die in Wien lebende Malerin präsentiert ihre namenlosen Bilder in einer Galerie und informiert über aktuelle Ausstellungen. Mit Fotoalbum und Links zu Wiener Lokalen.
1204 Guldegg English Setter
Historie der langjährigen Zucht. Portrait der Hunde mit Beschreibung, Bildern, Stammbaum und Prüfungs- und Showresultate. Dazu Galerie der Zuchtrüden in und aus der Zuchtstätte.
English Setter Setters Guldegg Hunde Welpen Breed Qualitt
1205 Japan Bonsai
Das Museum bietet Informationen und Bilder zu den Themen Bonsai, Japanische Gärten, Bonsaizubehör und Bonsaischalen mit Galerie und Online-Shop.
Z Y
1206 Team V-max
Stellt sich und seine Fahrer vor. Dazu gibt es eine Datenbank, Presseberichte, ausstehende Termine, eine Galerie und Neuigkeiten.
Team Max Langstrecken Racing Kartnews Kartteamergebnisse Fotos Erfolgreiches
1207 Gertrauds Seifenseite
Bietet Beschreibung der Inhaltsstoffe von Seifen, Anleitungen zum Herstellen von Seife sowie eine Galerie mit selbst hergestellten Seifen.
Seife Seifen Pflanzliche Weihnachtsbillets Fette Seifenseiten Sheabutter Spezielle
1208 Kunsthaus Rondula
Die Galerie zeigt ihre Ausstellungsstücke, Künstler, Programm und Service. Abgebildete Druckgraphiken können über das Kunsthaus bezogen werden.
Kunsthaus Kunst Rondula Künstler Vorschau Kaffee Ganz Ausstellungsobjekteraumtasse
1209 Der Rabe Softwareentwicklung
Preist Individuallösungen und Projektleitung als Kernkompetenz für die Entwicklung und den Neueinsatz von Software. Ausserdem Angaben zur Tätigkeit als Fotograf nebst einer Galerie mit einigen Arbeitsbeispielen.
Fotoshooting Bodypainting Akt Uv Outdoor Zebra Animation Studios
1210 Freeclimber
Mit vielen Informationen zum Training, aktuellen Tourenberichte und Neuigkeiten sowie Topos vieler Klettergebiete in der Zentralschweiz. Dazu gibt es Tipps für Einsteiger, eine Galerie und Links.
1211 LaFemme, Gina
Die in Wien lebende Künstlerin stellt sich vor und präsentiert ihre Bilder, Portraits und Projekte in einer umfangreichen Galerie. Mit Presseartikeln, eigenen E-Cards und Ausstellungskalender.
1212 Radenthein
Offizielle Homepage der Stadtgemeinde Radenthein mit Informationen über öffentliche Einrichtungen, Bürgerservice und Gemeindedaten. Eine Galerie, ein Stadtplan und ein Veranstaltungskalender werden angeboten.
Radenthein Stadtgemeinde Bürgerservice Nockhalle Gemeinde Anreise Vereine Objektnummern
1213 Kunst- und Kulturverein Gundl Graz
Die Seite über die schwul-lesbische Subkultur in Graz bietet eine Galerie, Termine, Lifestyle und berichtet über den Verein.
Graz Wolfgang Kunst Fotos Besser Coming Fühlt Gruppe
1214 Kunst- und Kulturverein Gundl Graz
Die Seite über die schwul-lesbische Subkultur in Graz bietet eine Galerie, Termine, Lifestyle und berichtet über den Verein.
Graz Wolfgang Kunst Fotos Gruppe Fühlt Coming Besser
1215 Kunst- und Kulturverein Gundl Graz
Die Seite über die schwul-lesbische Subkultur in Graz bietet eine Galerie, Termine, Lifestyle und berichtet über den Verein.
Graz Wolfgang Fotos Kunst Immer Gruppe An“ Coming
1216 Ballooning Vorarlberg - G. Schabus
Informationen zum Ballonfahren in Vorarlberg, zur Ballonwerbung mit Preisen und Foto-Galerie. Die Beschreibung einer Alpenfahrt und Sicherheitshinweise werden angeboten.
Impressum Ballooning Gehen Bestellung + Sicherheit Vorarlberg Ballone
1217 Alex Trading-Cards
Die Seite bietet eine Plattform für an NBA-Cards Interessierte, aufgeteilt in unterschiedliche Rubriken und mit einer Galerie von Scans zu dem Thema.
Found Apache Portz Additionally Errordocument Server Found The
1218 Tourismus in der Dachstein-Tauern-Region
Informationsmagazin für Touristen mit Hinweisen zu Veranstaltungen, Diensten, Gastronomie und Einkaufen. Mit einer reichhaltigen Galerie mit Fotos aus der Region.
1219 Ballooning Vorarlberg - G. Schabus
Informationen zum Ballonfahren in Vorarlberg, zur Ballonwerbung mit Preisen und Foto-Galerie. Die Beschreibung einer Alpenfahrt und Sicherheitshinweise werden angeboten.
Preise Ballonfahrt Faq Anzeigen + Sicherheit Bestellung Wo
1220 Kunst- und Kulturverein Gundl Graz
Die Seite über die schwul-lesbische Subkultur in Graz bietet eine Galerie, Termine, Lifestyle und berichtet über den Verein.
Graz Wolfgang Fotos Kunst Besser Coming Gruppe Fühlt
1221 Verein Deutscher Studenten (VDSt) zu Graz
Studentische Verbindung mit dem Ziel, die Tradition des Studententums aufrecht zu erhalten. Informiert über Veranstaltungen, Mitglieder und Geschichte und bietet Galerie, Forum und Gästebuch.
Vdst Deutscher Leoben Studenten Wien Graz Straßburgtagung Verein
1222 Verein Deutscher Studenten (VDSt) zu Graz
Studentische Verbindung mit dem Ziel, die Tradition des Studententums aufrecht zu erhalten. Informiert über Veranstaltungen, Mitglieder und Geschichte und bietet Galerie, Forum und Gästebuch.
Vdst Deutscher Leoben Studenten Wien Graz Straßburgtagung Vereine
1223 Galerie sb13
Rober Trsek - Kärntner Maler, Vertreter der klassischen Moderne, aber auch Werke anderer Künstler werden im Internet ausgestellt und sind käuflich zu erwerben.
Trsek Galerie Sb Malerei Robert Vernissage Bilder Graphik
1224 Aichhorn, Margit
Die ?-sterreichische Künstlerin nutzt ihre eigene ?-lbild-Technik und verarbeitet die kräftigen Farben mit Spachtel und Fingern. Eine umfangreiche Galerie zeigt über 120 ihrer Werke.
1225 Martin Mascherl Manufaktur
Spezialisiert auf ausgefallene Kreationen in Form von Fliegen oder Krawatten für den Hals. Die unterschiedlichsten Materialien, wie Spiegelsplitter, werden dafür verwendet. Eine Galerie ist zu finden.
Mascherl Shop Martin Vienna Manufaktur Unserem Material Kunstwerke
1226 Mandl & Bauer
Der österreichische Hersteller stellt einige seiner Referenzobjekte in einer Galerie vor. Es wird ein FAQ-Bereich (Frequently asked Questions) zum Thema Kaminbau geboten. [A-4170 Haslach an der Mühl]
Inhalt Mandl Installieren Bauer Flashinstallieren Html Alternativer Browserskriptunterstützung
1227 Mandl & Bauer
Der österreichische Hersteller stellt einige seiner Referenzobjekte in einer Galerie vor. Es wird ein FAQ-Bereich (Frequently asked Questions) zum Thema Kaminbau geboten. [A-4170 Haslach an der Mühl]
Inhalt Installieren Bauer Mandl Browser Stellen Flashinstallieren Fürdiesenadobe
1228 Installateur Kreidl
Installateur Meisterbetrieb. Bietet Badezimmer und Bäder sowie Solar-Heizung oder Holzheizung mit Pellets und Hackgut. Mitarbeiter, Jobs, Galerie, Shop.
Content Elektro Kreidl Wärmepumpen Biomasse Solar Page Wasser
1229 von der Gis
Es wird über den Werdegang der Zucht berichtet, die Zuchthunde in Wort und Bild vorgestellt und über die Nachzucht informiert. Weiter wird der Rassestandard dokumentiert und eine Galerie gezeigt.[A]
Server Port Permanently Theapache
1230 Rattenhausen
Unter Ratten und Galerie findet man viele Fotos von Petras Ratten. Zusätzlich gibt es Hinweise zum Wiener Rattenstammtisch und zur österreichischen Notfallvermittlung.
Hilfe Siesicher Website Austria Finden Erstellen Konnten Bitte
1231 Volarte Contemporary Editions
Volarte ist eine Galerie für zeitgenössische Artprints. Präsentiert werden Exponate für ein inspirierendes und beflügelndes Wohn- und Arbeitsambiente.
Z Y
1232 Kahler, Urs
Der Kärntner Fotograf präsentiert seine Werke: Porträt, Akt, Landschaft, Collagen. Die Site bietet ausserdem eine Galerie mehrerer Kärntner Maler.
Maler Kahler Photographie Urs Walkensteiner Kolig Landschaft Janusch
1233 Docekal, Jan
Der tschechische Maler, Grafiker und Kunsthistoriker stellt seine Kollagen vor, in denen er durch Schichtung unterschiedlicher polygraphischer Materialien ein plastisches Relief erzeugt. Vita, Erfolge, Ausstellungen, Galerie.
1234 Schloss Traun
Das Schloss präsentiert sich als Gebäude für Kulturveranstaltungen, Seminare und Feste. Berichtet über die Geschichte, die erfolgte Renovierung, Anreise und zeigt eine Galerie mit Fotos.
Traun Vest Schloss Kulturschloss Detection Abonnement Künstlerinnen Haydnsaal
1235 M-ART internationale Galerie am Börseplatz in Wien
Zeigt Künstler aus der ganzen Welt im Zentrum von Wien. Informationen über die aktuelle und frühere Ausstellungen, ein Künstlerarchiv, Vernissagen, Pressemeldungen, Kontakt, und die ?-ffnungszeiten.
Forbidden Founderrordocumentport Apache Server
1236 Kleinstaasdorf im Tullnerfeld
Kleinstaasdorf liegt am südlichen Rand des Tullnerfeldes und gehört zur Stadtgemeinde Tulln an der Donau. Präsentiert wird unter anderem eine Galerie mit historischen Fotos.
1237 Eckankar ?-sterreich
Die "Uralte Weisheit für die heutige Zeit". Eckankars Lehre betont den Wert persönlicher Erfahrungen als den natürlichsten Weg zurück zu Gott. Mit Infos zu den Seminaren und Veranstaltungsterminen, sowie Galerie und Bücher.
1238 Galerie Dagmar Aichholzer
Werke zeitgenössischer Künstler werden von der Kunstkritikerin Dagmar Aichholzer ausgewählt und zum Kauf angeboten.
Galerie Kunst Dagmar White Aichholzer Spezialisiert Zeitgenössische
1239 Neue Galerie Graz - Egon Schiele
Presents the Leopold Collection at the Neue Galeria Graz, Austria.
Steiermark Eingabeeingegeben Browserleiste Tun Adresse Vernetzen Landtag Steiermärkischen
1240 Anton Tantner
Die Seite des Historikers Anton Tantner (Universität Wien) bietet eine Galerie der Hausnummern, Informationen über Publikationen und Lehrveranstaltungen
1241 Fotoclub Aigen Schlägl
Der Fotoclub zeigt Bilder und Experimente, sowie eine Virtuelle Galerie und Informationen über die Dauerausstellung im Kulturhaus Aigen.
Fehlergefundenfolgender Aufgetreten Die Webmaster Schreibweise Hauptseite Serverbitte Ispconfig Powered
1242 Wiener Schule für Kunsttherapie
Die WSK bietet Weiterbildungen in Kunsttherapie und Phronetik an. Auf den Seiten kann man sich über die Schule und Inhalte erkundigen. Mit Galerie. [A-1090 Wien]
Kunsttherapie Wiener Schule Ausbildung Kultur René Ernst Bildungen
1243 Ansichtskarten aus Unterach am Attersee
Online-Galerie von historischen und aktuellen Ansichtskarten aus Unterach und Umgebung.
Unterach Attersee Ansichtskarten Allgemein Sicht Pinkl Menue Punkte
1244 ?-sterreichisches Notgeld
Für Sammler und Interessenten österreichischen Notgelds ist diese Seite ein absolutes Muss - finden sie doch auf ihr umfangreiche Informationen um ihr Hobby. Eine umfangreiche Galerie zeigt den Besuchern die Vielfalt der Notgelder.
Z Y
1245 ?-sterreichisches Notgeld
Für Sammler und Interessenten österreichischen Notgelds ist diese Seite ein absolutes Muss - finden sie doch auf ihr umfangreiche Informationen um ihr Hobby. Eine umfangreiche Galerie zeigt den Besuchern die Vielfalt der Notgelder.
Z Y
1246 Crazy Trike Wozak
Verleih und Verkauf von Trikes im Raum Salzburg. Dazu Informationen über die Werkstatt und Zubehör. Links und eine Foto-Galerie sind auch vorhanden. [A-5081 Niederalm bei Salzburg]
Dreirder Trikes Vorderrad Trike Dreirad Fahrzeug Hinterrad Klasse
1247 Mein Sierra
Stellt seine Automobile, einen Sierra und einen Capri vor. Ausserdem Berichte von Treffen, Links, Galerie und eine Liste verfügbarer Ausschlachtobjekte.
1248 Kunst und Politik im Naziregime
An vier Kunstwerken wird exemplarisch die Aneignung der Kunst durch das Naziregime betrachtet, daneben gibt es einen Beitrag über die "Führersammlung" für die Neue Galerie in Linz.
Adrian Mitarbeit Germany Network Sculpture Robert Gestaltung Politics
1249 Kunst und Politik im Naziregime
An vier Kunstwerken wird exemplarisch die Aneignung der Kunst durch das Naziregime betrachtet, daneben gibt es einen Beitrag über die "Führersammlung" für die Neue Galerie in Linz.
Adrian Redaktionelle Wassermann Gestaltung Kunstpolitik Woelfl Braun Germany
1250 TUG Racing Team
Ist ein Studentenprojekt und beschreibt was sich hinter der Formula Student verbirgt. Darüber hinaus ist eine Auflistung der Teilnehmer, Neuigkeiten, Pressestimmen, eine Galerie und ein Forum vorhanden. Der Bezug eines Newsletters ist möglich.
Tankia News Team Maxwheel Partner Admin Graz Alumni
1251 TUG Racing Team
Ist ein Studentenprojekt und beschreibt was sich hinter der Formula Student verbirgt. Darüber hinaus ist eine Auflistung der Teilnehmer, Neuigkeiten, Pressestimmen, eine Galerie und ein Forum vorhanden. Der Bezug eines Newsletters ist möglich.
Tankia News Team Partner Maxwheel Admin Graz Alumni
1252 TUG Racing Team
Das Studentenprojekt beschreibt, was sich hinter der Formula Student verbirgt. Darüber hinaus ist eine Auflistung der Teilnehmer, Neuigkeiten, Pressestimmen, eine Galerie und ein Forum vorhanden. Der Bezug eines Newsletters ist möglich.
Tankia News Team Maxwheel Partner Admin Graz Alumni
1253 TUG Racing Team
Das Studentenprojekt beschreibt, was sich hinter der Formula Student verbirgt. Darüber hinaus ist eine Auflistung der Teilnehmer, Neuigkeiten, Pressestimmen, eine Galerie und ein Forum vorhanden. Der Bezug eines Newsletters ist möglich.
Tankia News Team Maxwheel Partner Admin Graz Alumni
1254 Riccis Homepage
Eine Zusammenfassung von der Restaurierung der eigenen Fahrzeuge, einen Corvette Stingray und einen Cadillac. Zudem werden in einer Bilder-Galerie verschiedene Fahrzeuge veröffentlicht.
1255 Caldonazzi Grafik-Design
Das Atelier und die Künstler Martin Caldonazzi und Wilma Zündel werden vorgestellt, Einblicke ind die Galerie aber auch in professionelle Designs werden gewährt sowie Kontaktadressen angeboten.
Caldonazzi Grafik Design Martin Atelierz
1256 Chow Chow Club Austria
Informationen über den Club, Ausstellungen, Rassestandard, Züchter, Welpen und Chow Chows in Not, Deck- und Wurfmeldungen, Champ-Galerie, Ausstellungs-Ausschreibungen und Terminkalender für Clubabende.
Chow Tulln Ccca Club Chows Clubtreffen Wurfmeldungen Kalender
1257 Causa Bloch-Bauer
Die Seite des amerikanischen Anwalts Randol E. Schoenberg hat eine Klage auf Herausgabe von sechs Klimt Gemälden aus dem Besitz der ?-sterreichischen Galerie zum Inhalt. Materialien zum Verfahren und zum Problem "Raubkunst" (deutsch, englisch). Presse-Schau. Links.
1258 Vokalensemble Voices
Das Repertoire des Ensembles umfasst sowohl geistliche als auch weltliche Musik, Messen, Motetten und Madrigale aus der Renaissancezeit, Gospels und Spirituals, Folksongs, Lieder, sowie Schlager und Hits. Konzerttermine, Galerie, Hörproben und die Möglichkeit, E-Mail-Benachrichtigungen zu erhalten.
Voices Vokalensemble Konzert Passau Rahmen Auftritte Wordpress Mariendom—
1259 Katholisches Bildungshaus Tainach
Das katholische Bildungshaus Sodalitas wird als Ort für Seminare und Konferenzen in 5 Sprachen vorgestellt. Schwerpunkte sind die Geschichte mit einer Galerie, das Seminarzentrum, Veranstaltungs- und Bildungsangebote. Ein Gästebuch, ein Dialogforum, Anreise- und Kontaktinformationen ergänzen da Angebot.
Dom Sodalitas Projekt Poletna Tinjah Prihodnost Klangwelten Poti
1260 Katholisches Bildungshaus Tainach
Das katholische Bildungshaus Sodalitas wird als Ort für Seminare und Konferenzen in 5 Sprachen vorgestellt. Schwerpunkte sind die Geschichte mit einer Galerie, das Seminarzentrum, Veranstaltungs- und Bildungsangebote. Ein Gästebuch, ein Dialogforum, Anreise- und Kontaktinformationen ergänzen da Angebot.
Dom Tinjah Poletna Sodalitas Projekt Bildungshaus Ločene Nutzungsbedingungen
1261 Katholisches Bildungshaus Tainach
Das katholische Bildungshaus Sodalitas wird als Ort für Seminare und Konferenzen in 5 Sprachen vorgestellt. Schwerpunkte sind die Geschichte mit einer Galerie, das Seminarzentrum, Veranstaltungs- und Bildungsangebote. Ein Gästebuch, ein Dialogforum, Anreise- und Kontaktinformationen ergänzen da Angebot.
Dom Projekt Poletna Tinjah Sodalitas Prireditve Poti Klangwelten
1262 Sammlerseite für ?-sterreichische Banknoten
Johann Kodnar informiert rund ums österreichische Papiergeld. Mit einer umfangreichen Galerie von Banknoten, einer Auflistung der derzeit erzielbaren Verkaufspreise sowie geschichtlichen Details der Alpenrepublik.
Banknoten Notgeld Sammler Geldscheine Kronen Gulden Papiergeld Schilling
1263 Astronomischer Arbeiskreis Salzkammergut (AAS) und Sternwarte Gahberg
Die Seite stellt die Tätigkeiten des Vereins vor und bietet daneben von Berichten und Reportagen über astronomische Ereignisse (Sonnenfinsternisse, Meteore und Polarlichter). In einer Galerie werden eigene CCD-Aufnahmen ausgestellt. Ein Newsticker informiert über aktuelle Projekte und Veranstaltungen des Vereins.
Sternwarte Gahberg Salzkammergut Astro Astronomie Arbeitskreis Astronomischer Kamera
1264 Pandeka Mihar G=Sentak Austria
Meisterlehrer Mihar Walk Pangeran unterrichtet in Wien Kampfkunst auf der Basis verschiedener "silek"-Stile der Minangkabau. Aktuelles, Entwicklung der Schule, Seminare, Artikel, Photo Galerie. Sprachen: Deutsch, Englisch, Bahasa Indonesia, Baso Minang, Ungarisch.
Paureh G=sentak Tradition Mihar Fighting Kostenlose Sanggar Pmg=sentak
1265 Pandeka Mihar G=Sentak Austria
Meisterlehrer Mihar Walk Pangeran unterrichtet in Wien Kampfkunst auf der Basis verschiedener "silek"-Stile der Minangkabau. Aktuelles, Entwicklung der Schule, Seminare, Artikel, Photo Galerie. Sprachen: Deutsch, Englisch, Bahasa Indonesia, Baso Minang, Ungarisch.
Pandeka Pandekamihar@yahoode Pmg=sentak Tradition Mihar Kostenlose Einstiegskurse Motion
1266 Lentos - Kunstmuseum Linz
Im Auftrag der Stadt Linz errichtet das Baumanagement der LINZ Service GmbH (vormals SBL) am rechten Donauufer nahe des Brückenkopfes das neue Museumsgebäude Lentos Kunstmuseum Linz für die Neue Galerie.
Error Runtime Thecurrent Server Noteserror_ Urldescription Application
1267 Initiativen des Vereins Lebenswertes Leben
Die Sammelseite für die Initiativen des Vereins Lebenswertes Leben. Behindertendorf Altenhof, Kulturzentrum und Galerie Hausruck, Projekt Wege, Fachmesse integra, Projekt Casa Linz, Institut für Physiotherapie, Logopädie und Ergotherapie.
Hilfe Behinderung Menschen Betreuung Altenhof Integra Bildungszentrum Dorf
1268 Bundesgymnasium Dornbirn
Das Bundesgymnasium stellt die Schule, ihre Organisation und ihre Projekte vor. In einer Galerie könne Schüler ihre eigenen Objekte präsentieren, die Schulbibliothek wird durch eine eigen Site repräsentiert, ausserdem gibt es Kontaktmöglichkeiten zu Beratungs- und anderen Einrichtungen, die mit der Schule in Zusammenhang stehen.
Dornbirn Browserbg Ihrem Z
1269 Permanent Brain
Ein kleines Museum führt durch eine Galerie mit Covergrafiken klassischer Schachprogramme. Man kann bedeutende "Mensch gegen Maschine" Partien im Browser nachspielen [benötigt Java] oder herunterladen. Neben einem Quicktest für die Kombinationsstärke von Schachprogrammen finden sich Kommentare über die Schachnovelle, kommentierte Links sowie einige kostenlose Eröffnungsbibliotheken zum Engine-Testen.
Computerschach Permanent Brain Chess Computers Schach Schachcomputer Oldies
StadtBranche.at Österreich Web Katalog für Galerie Österreich - Statistiken: 3 StadtBranche.at Österreich Punkte für "Galerie Österreich" - In die Bewertung wird die Anzahl der Besucher und Erfahrungsberichte dieser Themenseite mit einbezogen. Galerie › Taxi Wien Öffnungszeiten Österreich Bewertungen Galerie Österreich Erfahrungen und Öffnungszeiten Datum: Kontakt StadtBranche.at

Neuer Eintrag 

Tipps & Tricks für Arbeit & Leben:



△ nach oben kostenfreier Eintrag Datenschutz