Möbel › Genève Nous Déménagement Österreich

Möbel


Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 ADH Mölltal Möbel GmbH

9843
Großkirchheim
moelltal-moebel.at Möbel Mölltal Gmb Tischlerei Holz Design Award Shop Wallner Sofas Baumes Lärchenholz Entstehung Verwendung Handwerkskunst
2 Antik Ankauf Antiquitäten

1180
Wien
Sie sind an einem Ankauf Antiquitäten interessiert? Dann sind Sie bei uns genau richtig. Antik Ankauf - Wien bietet Ihnen..
antikankauf-wien.at/ Ankauf Wien Antiquitäten Helvetica Angebot Verlassenschaften Wertschätzung Ort Antike Möbel Unsere Apx Besichtigung Open Sans
3 Räumung in Wien NÖ Antiquitäten

1040
Wien
Sofortiger Barankauf möglich Gerne helfen wir Ihnen beim Verkauf Ihrer gesamten Verlassenschaft Ankauf Wien oder von Antiquitäten daraus. Wir kaufen international..
antik-experte.at Roboto Antiquitäten Condensed Ankauf Wien Light Verlassenschaften Gegenstände Möbel Ihr Regular Antiquitätenhändler Verkauf Barankauf Kunst
4 Umzugsunternehmen Umzug +

8952
Schlieren
Wir als Umzugsfirma in Zürich bieten eine umfangreiche Leistungsangebot für Privatumzüge und Firmenumzüge an, denn sie sind ein fester Bestandteil..
umzugsservice-zh.ch Zürich Umzug Umzugsservice Ich Umzugsfirma Service Gmb Möbel Team Offerte Dank Ihren Mitarbeiter Schäden Preis
5 Umzugsunternehmen Umzugsfirma

8952
Schlieren
Umzugsservice Zürich GmbH – Ihre Umzugsfirma direkt aus Zürich Schlieren. Umzüge und dazugehörige Services von höchster Qualität. Wir als Umzugsfirma in..
umzugsservice-zh.ch/ Zürich Umzugsservice Umzug Ich Umzugsfirma Service Gmb Möbel Team Offerte Dank Mitarbeiter Schäden Ihren Reinigung
6 Babyzimmer einrichten mit den Inneneinrichtung

1080
Wien
Die Raumelfen haben sich auf die Planung und Einrichtung von Babyzimmern, Kinderzimmern und Jugendzimmern spezialisiert. Die beiden Schwestern überzeugen durch..
dieraumelfen.at/leistungen-kinderzimmer-einrichten-wien/ Kinderzimmer Raumelfen Planung Kindermöbel Leistungen Ihr Möbel Besprechung Asoral Kinderzimmers Fragen Informationen Accessoires Showroom Ja
7 Zirbenbetten Möbel

9400
Wolfsberg
Zirbenbetten aus rein luftgetrockneten Zirbenholz aus den österreichischen Alpen.Das Zirbenbett wir schwebend und metallfrei gefertigt...
das-zirbenbett.kaufen Mw Zirbenbetten Kategorie Betten Object Einkaufswert Bettwaren Schlafsysteme Zirbenmöbel Kontakt Checkout Wolfsberg Event Nützliches Gmb
8 Umzug Umzug Transport

1100
Wien
Wir sind ein erfahrenes Umzugsunternehmen, das sich um verschiedene Arten von Umzügen kümmert. Aus diesem Grund helfen wir Ihnen gerne..
bluemoving.at/ Wien Umzug Bluemoving Möbel Möbeltransport Ihren Umzugsunternehmen Transport Umzüge Blue Kunden Möbellift Organisation Unternehmen Ihr
9 Antiquitäten und Verlassenschaften Wien Antiquitäten Antik

1040
Wien
Hochqualitative Antiquitäten Ankauf in Wien oder österreichweit. Verlassenschaften Ankauf von Experte leicht gemacht. Kostenlose Wertschätzung und Gratis Räumung.Sie möchten Ihre..
antiquitaeten-wien.com Wien Antiquitäten Verlassenschaften Altwaren Ankauf Verkauf Antike Gegenstände Preis Sachen Abholung Gemälde Besichtigungstermin Barankauf Möbel Wirversprechen Abendstunden
10 Loogo Umzüge Österreich Umzüge

5400
Hallein
Mit LOOGO sparen Sie Zeit und Nerven. Überlassen Sie Ihren Umzug den Profis von LOOGO! Profitieren Sie von unserer Organisation und..
loogo.at Umzug Möbel Kartons Möbelküche * + Umzugsunternehmen Privatumzug Angebot Firmenumzug Verpackungsmaterial * Umzüge Loogo Kartons * Lkw * Internationaler Neumöbel Abholung Karton Rechner Demokratischevolksrepublikkorearepublikkroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmauretanienmauritiusmazedonienmexikomikronesienmoldawienmonacomongoleimontenegromosambikmyanmarnamibianaurunepalneuseelandnicaraguaniederlandenigernigerianiuenorwegenösterreichomanosttimorpakistanpalästinensischeautonomiegebie
11 Biotop Schuhe und Möbel Handel Textil

3242
Texing
Die Wollwerkstatt in Texing vertreibt wertvolle und hochwertige Produkte aus Schafwolle. Es handelt sich um Produkte wie Wolldecken, Gymnastikmatten, diverse..
wollwerkstatt.at Filzwolle Merino Meditationskissen Bettdecken Maß Hochwertige Hautpflege Unterbetten Filzpatschen Handschuhe Natur Produkte Kinderbettdecke Faltmatte Plaids Wollmütze
12 Entrümpelung Wien Umzug

1140
Wien
Entrümpelung Wien Entrümpelung Wien ; bedeutet so viel wie die Entsorgung von Gerümpel. Die Frage ist jedoch wieviel kostet das Entrümpeln von..
wiener-raeumung.at Wien Entrümpelung Räumung Gratis Wohnungsräumung Möbel Räumungen Haushaltsauflösung Entsorgen Sperrmüllabholung Kellerräumung Einrichtungen Wiener Hausräumung Entsorgung Altholz
13 Entrümpelung Wien Umzug

1140
Wien
Entrümpelung Wien Entrümpelung Wien ; bedeutet so viel wie die Entsorgung von Gerümpel. Die Frage ist jedoch wieviel kostet das Entrümpeln von..
wiener-raeumung.at Wien Entrümpelung Räumung Gratis Wohnungsräumung Möbel Räumungen Entsorgen Haushaltsauflösung Sperrmüllabholung Kellerräumung Wiener Entsorgung Hausräumung Einrichtungen Entrümpelungen
14 Gastronomiefachhandel Grosshandel Gastronomiebedarf

33178
Borchen
ask gastro UG liefert Gastronomiebedarf und Großküchentechnik namhafter Hersteller deutschland- und europaweit an Hotels und gastronomische Einrichtungen aller Grössen, sowie..
askgastro.shop Gastronomie Gastro Edelstahlmöbel Buffet Mein Kühltechnik Möbel Hygiene Gastronomiebedarf Ersatzteile Konto Neumärker Großküche Einrichtung Backtechnik Cool Line Air Wolf Kochen Gefrier Kunden Melamin Servierartikel
15 Möbel Handl GmbH Einrichtung

3860
Heidenreichstein
moebelhandl.at
16 Desigano.com Möbel

5203
Köstendorf
Desigano.com steht für qualitativ hochwertige Designer Möbel und Leuchten aus Europa. Finden Sie im Onlineshop einzigartige Sofas, Stühle und Tische..
desigano.com/ Leuchten Barhocker Sessel Etagenbetten Tische Gartenmöbel Möbel Beistelltische Stühle Stehtische Teppiche Wandklappbetten Designer Sofa Hängeleuchten Blumentöpfe Bartheke Kissen
17 Die schnelle Teppichreinigung bei Teppichreinigung

1080
Wien
Sie haben Teppiche in Ihrem Eingangsbereich liegen? Dann sollten Sie sich um eine professionelle Teppichreinigung umsehen. Denn wenn Ihre Teppiche..
teppichreinigungen-wien.at/ Teppich Teppichreinigung Teppiche Polstermöbelreinigung Wien Professionelle Reinigung Qualität Orientteppiche Wert Teppichreinigungen Wienat Möbel Partners Termin Jahre
18 Umzugsservice in Salzburg von Umzug

4180
Zwettl a.d.Rodl
Österreichs erster Umzugsvergleich mit Sofortergebnis! Egal ob private Übersiedlung, Möbeltransport, oder Firmenumzug wir machen es ihnen leicht. Finden und Vergleichen Sie noch..
flottumzug.at Umzug Salzburg Entrümpelung Linz Umzugsservice Umzugsfirma Möbel Demontage Internationaler Umzugslift Gern Services Montage Umziehen Doch Komplettangebot Sodass Preisen Räumungen Unternehmen * Kostenlose
19 Hane Möbel Möbel

1100
Wien
Neueste modernste Möbel zum Tiefpreis mit prompter Lieferung inklusive Montage. Hoch qualitative Möbelstücke mit toller Beratung nur bei Hane Möbel...
hane.at Esszimmer Schlafzimmer Moderne Aktion Sitzgruppen Ecksitzgruppen Möbel Avantgarde Babyzimmer Hane Polstermöbel Betten Jugendzimmer Italienische Dekoration Matratzen Sitzgarnituren Federkernmatratzen
20 Hane Möbel Möbel

1100
Wien
Neueste, modernste Möbel zum Tiefpreis mit prompter Lieferung inklusive Montage. Hoch qualitative Möbelstücke mit toller Beratung nur bei Hane..
hane.at Schlafzimmer Esszimmer Sitzgruppen Aktion Ecksitzgruppen Moderne Möbel Babyzimmer Avantgarde Hane Betten Polstermöbel Jugendzimmer Italienische Wohnwände Sitzgarnituren Server
21 Zirbenbetten Einrichtung Möbel

9400
Wolfsberg
Natur Zirbenbetten von Schröcker aus rein luftgetrockneten Zirbenholz von den Nockbergen...
das-zirbenbett.com Zirbenbetten Zirbenbett Natur Nachtkästchen Schröcker Schlafen Zirbenmöbel Tischlerei Planung News Bettwaren Zirbennachtkästchen Schlafsysteme Zirbenholzbett Wirkung Weißenbachstraße Zirbenpolster Schrnke
22 Möbel aus Beton Betonmöbel

Betonmöbel individuell von Hand gefertigt. Jedes Möbel ist ein Einzelstück. ... möbel aus beton Home Möbel Kamin Holz Beton Möbel Sideboard Waschtisch Architektur Sichtbetonstiege
xn--beton-mbel-kcb.at Betonmöbel Beton Möbel Sichtbeton Möbel
23 Möbel Pillichshammer Herzlich Pillichshammer Möbel GmbH & Co. KG Möbel
4870
Vöcklamarkt
Möbel Pillichshammer Möbel Tischlerei Planung Möbelbau Vöcklamarkt ... . Pillichshammer Möbel GmbH Co. KG Gries Vöcklamarkt Diese -Adresse ist vor Spambots geschützt
moebel-pillichshammer.at Möbel Pillichshammer Möbel Tischlerei Planung
24 Antike Möbel Shop Antike
6252
Breitenbach am Inn Austria
Antike Moebel Shop Matthias Seidner ... aktivieren um alle Funktionen in diesem Shop nutzen zu können. Antike Moebel Shop - Matthias Seidner
antike-moebel-shop.at Antike Moebel Shop
25 Antik Möbel Antike Antik
4600
Wels
Antik möbel online. Alte Bauernmöbel. Landhausmöbel Weichholzmöbel Vintage Möbel. Antik Möbel aus verschiedenen ... Möbel Vintage Möbel Antik Möbel Antike Tische - Antik Möbel Antike Schränke - Antik Möbel Antike
antik-zone.at Antik Möbel Bauernmöbel Wiechholzmöbel
26 Home Erotische Möbel erotische

Individuell gefertigte erotische Möbel oder auch SM Möbel genannt für Privat und Business aus Österreich. ... Erotische Möbel Wir fertigen Träume und Fantasien Erotische Möbel Wir fertigen Träume und Fantasien
erotische-moebel.at Erotische Möbel Sm Möbel Günter Grasser
27 OK Möbel Home Schreiner
5340
Sankt Gilgen
OK Möbel Sankt Gilgen ... Home Leistungen Referenzen Aktuelles Unser Betrieb Kontakt Anfahrt Möbel nach Mass Möbel
ok-moebel.at Schreiner Schreinerei Tischler Möbel
28 Antik möbel antique furniture hlb.project

antik möbel sekretär antique furniture secretaire ... ANTIK MÖBEL MAP ANTIK MÖBEL GALERIE GEBRAUCHT MÖBEL GEBRAUCHT MÖBEL GALERIE ACCESSOIRES ACCESSOIRES
antik-ambiente.at Hlb.project Moebel Secretaire Sekretär
29 Möbel Innsbruck Tischlerei Möbel

Möbel Innsbruck ist das Spezialgebiet der Tischlerei Jenewein. Anfertigungen nach Maß und nach Ihren Vorstellungen. ... und gerichtl. beeid. Sachverständiger für Möbeltischlerei Möbel Innsbruck by www.tischlerei-jenewein
tischlerei-jenewein.at Möbel Innsbruck
30 ELLENSOHN. Handgemachte Möbel aus Möbel

Ellensohn Möbel Homepage handgemachte Massivholzmöbel Vollholz Massivholz Bauart und Design ... ELLENSOHN. Handgemachte Möbel aus Holz. Ein Baum wächst mehr als hundert Jahre bis das Holz
ellensohn.or.at Möbel Massivholz Vollholz Handwerk Bauart
31 Das Marken Möbel Outlet Kasper-Wohndesign-Outlet GmbH Möbel
76829
Landau
Das online Marken Möbel Outlet in Österreich | z.B. Rolf Benz KARE Design ... aktivieren um alle Funktionen in diesem Shop nutzen zu können. moebel-style Mein Warenkorb Zur Kasse
moebel-style.at Möbel Outlet Rolf Benz Ewald Schillig
32 Möbel See Möbel

Möbel See ihr Innenarchitekt in Haid. Möbel See Einfach schön leben ... Möbel See NUR FÜR KURZE ZEIT Besuchen Sie unseren Schauraum. NEU IM SORTIMENT Besuchen Sie unseren
moebelsee.at Möbel See Stilmöbel Inneneinrichtung Innenarchitekt
33 Die Möbel Sensation! Jetzt möbel

MöbelSensation.de Deutschlands großer Möbel OnlineShop. Bekannte Marken größte Vielfalt günstige Preise und ... Möbel Home Kontakt Beratung Warenkorb Ihre Vorteile Persönliche Beratung Best-Preis
stilbetten.at Möbel Günstig Onlineshop Bestellen
34 Möbel und Designermöbel günstig Möbel

llll? Hochwertige Möbel und Designermöbel im Shop günstig online kaufen. Kauf auf Rechnung ? Versandkostenfrei ... Garderoben Sets Tische Home Office Möbel Schlafen Kind Jugend Büro Gewerbe Stühle Sessel Tische
jenverso.at Möbel Shop
35 Günstig Möbel kaufen Schreibbüro und Lektorat OG Möbel
6380
St. Johann in Tirol
Dieser Shop bietet erstklassige Möbel zu Top Konditionen. Regelmäßiges Vorbeischauen lohnt sich. ... - Jugendzimmer Küche Schlafzimmer Wohnzimmer Lampen und Leuchten Programmpartner Kontakt günstig Möbel
guenstig-moebel-kaufen.at Möbel Möbelhaus Einrichtung Küche
36 Suppan Suppan suppan
1050
Wien
Einrichtungshaus für Indische und Chinesische Möbel massiven Esstischen und Landhausmöbel in Wien Österreich. ... Kommoden Sideboards TV-Möbel Nachtkästchen Schränke Regale Schränke Regale Truhen Licht Orientalische
suppanundsuppan.at Suppan Indische Möbel China Möbel
37 Fenster Türen Kaun GmbH Fenster
4490
St. Florian
TischlerQualität bei Fenster Türen Möbel MöbelRestauration und Antiquitäten von der Tischlerei Kaun ... Kastenstockfenstersanierung Wohnen Schlafen Kochen Baden Arbeiten Kastenfenster Restauration Türen Möbel/Fußböden
kaun.at Fenster Türen Möbel Antiquitäten
38 Objekteinrichtungen Stockbetten objekteinrichtung

Stranig Extrem starke Möbel Objekteinrichtungen Stockbetten Ihr Spezialist für stark ... Startseite Extrem starke Möbel Referenzen Unternehmen Aktuelles Objektinrichtungen
stranig.at Objekteinrichtungen Stockbetten Stranig Möbel
39 Möbel und Designermöbel online möbel

Der MöbelOnlineShop für Designermöbel. Große Auswahl tolles Design für alle Wohnbereiche bei avandeo: Hochwertige ... Passwort zugeschickt. Mein Warenkorb ? Möbel SOFAS SCHLAFSOFAS BETTEN ESSTISCHE COUCHTISCHE
avandeo.at Möbel Onlineshop Günstig Bestellen Online Kaufen Möbelshop Möbelhaus
40 URBA Ambiente | Willkommen URBA Ambiente GmbH Wohnwände
9020
Klagenfurt am Wörthersee
Wohnwände Wohnwand Möbel für Wohnzimmer Wohnzimmer Möbel Wohnzimmerschrank Wohnzimmer Set ... Lattenrost Sonstiges Attraktive Möbel zu günstigen Preisen! Wie wir das schaffen? Lesen Sie über uns - Link
topmoebel-shop.at Wohnwände Wohnwand Möbel Für Wohnzimmer
41 Home Möbel aus Möbel

Möbel aus Holz Marin Glawitsch Holz Kunst Handwerk ... Möbel aus Holz Martin Glawitsch Home Möbel Werkstatt Über mich Kontakt Links HOLZ + DESIGN
moebelausholz.at Möbel Aus Holz Marin Glawitsch Holz Kunst Handwerk
42 Royal Möbel royal

Möbel möbel moebel österreich möbel österreich
royalmoebel.at Royal Möbel Royal Navrkal Möbelstudio
43 1a Direktimport Möbel mexico

Mexico Möbel im Hacienda Stil und Vieles mehr für Liebhaber südlicher Wohnkultur. Direktimport aus Mexiko. ... Möbel Gartenartikel und Accessoires mit südlichem Flair. Unglaublich preiswert durch Direktimport
1a-direktimport.at Mexico Möbel Mexikanische Möbel Mexico
44 VCM24 | VCM Möbel vcm24

Bei VCM24 dem Möbel Onlineshop gibt es moderne Esszimmerstühle und Esszimmertische. VCM Möbel haben hohe ... ) Sie haben noch keine Artikel in Ihrem Warenkorb Sie sind hier Startseite Hifi- TV-Möbel CD-DVD-Möbel Hifi-Möbel TV-Möbel TV
vcm24.at Vcm24 Vcm Möbel Tv Moebel
45 LAGERHAUS 1900 1950 Möbel ArtDeco

Handel mit Möbel Kunst und Antiquitäten ... Möbel von - Lagerhaus Konkret Gemeinsam Planen Ona B. Aktuell Special Offer
art-deco.at ArtDeco Artdeco Art Nouveau Kunsthandel
46 TheObjects Möbel und Möbel

Hier entsteht ein Online Shop für Möbel und Wohnaccessoires. Wohnideen für anspruchsvolle Menschen ... TheObjects - Möbel und Wohnaccessoires Hier entsteht eine Einrichtungswelt für anspruchsvolle
theobjects.at Möbel Accessoires Wohnaccesoires Möbel Online
47 Möbel Interieur aus Salzburg

Living Lounge Möbel Interieur aus Salzburg ? hier erfahren Sie mehr über unsere Produkte ... Living Lounge Living Lounge Möbel Interieur Innsbrucker Bundesstraße a .Stock Salzburg
livinglounge.at Salzburg Möbel Salzburg Wohnzimmer Salzburg Interieur
48 Exklusive TV HIFIMöbel HifiMöbel

Seit 1999 die Adresse für HifiMöbel TVMöbel TVRack TVPhonomöbel LCDStänder ... Warenkorb Artikel Warenwert ? Warenkorb anzeigen HiFi-Möbel TV-Möbel TV
hifi-moebel.at HifiMöbel TVMöbel TVRack TVPhonomöbel
49 Homepage Möbel Laimer Möbel

Möbel Laimer bietet Beratung und Konzeption für anspruchsvolle Wohnungsideen Design und Handwerk. ... Telefon Map Unsere Leistungen Planung Beratung Möbel Tischlerei Produkte Übersicht Küche
einrichtungshaus-laimer.at Möbel Laimer Möbel Laimer Palting
50 Möbel Online Möbel

Möbel online kaufen
xn--onlinembel-kcb.at Möbel Einrichtung Indoor Outdoor
51 Tischlerei Herbert Reisinger GmbH Herbert Reisinger GmbH tischlerei
8966
Aich
Tischlerei Herbert Reisinger GmbH Möbel Fenster Türen Sanierung ... Home Möbel Kontakt und Copyright Herbert Reisinger GmbH.
tischlerei-reisinger.at Tischlerei Herbert Reisinger Gmbh Steiermark
52 Möbel auf moebelhaus24.at Möbel

... Moebelhaus.at Alles zum Thema MöBEL Startseite Angebote Beiträge Jetzt kostenlos anmelden
moebelhaus24.at Möbel
53 Home Möbel King nach

Nach Wunsch unserer SaunaKunden haben wir unsere neue Tätigkeit eingeführt: als Meisterbetrieb bieten wir professionelle ... Home Möbel Vorzimmermöbel Küchenmöbel Garderobenmöbel Kinderzimmermöbel Badezimmermöbel Büromöbel
mobelkonig.at Nach Mass Möble Möbel King Sauna
54 Homextra Möbel Zeit homextra

Homextra Möbel Zeit Für Schönes Wohnen ... Homextra Möbel Rotenhofgasse Wien + e-mail Diese -Adresse
homextra.at Homextra Türkisches Möbelhaus Wien; Möbel Moebel
55 Möbel günstig online kaufen Möbel
8132
Pernegg
Möbel Betten Sofas oder Tische für Ihre WohnungHausEinrichtung gesucht? Bestellen Sie Ihre WohnEinrichtung ... Möbel sicher einfach online kaufen bei Möbilia Artikel ? Zum Warenkorb » Möbel Badmöbel
moebilia.at Möbel Betten Sofas Tische
56 Gebraucht moebel second hand gebraucht

handlel mit gebraucht moebel second hand furniture arredamenti di secondo mano ... GEBRAUCHTE MOEBEL WOHNZIMMER ESSZIMMER SCHLAFZIMMER VORZIMMER ZIERGEGENSTÄNDE KÜCHE ANTIKES KUNST
gebraucht-moebel.at Gebraucht Moebel Bilig Polovno Neuwertig Ocuvan
57 Pirker Design Trafik Pirker

Pirker Design Trafik Shop Möbel und Interior Design f�r bessere Geschäfte und ... ... für bessere Geschäfte. Einzigartig wie das Leben - Ihre neue Einrichtung von Pirker Möbel und Interior Design
pirkerdesign.at Pirker Möbel Interior Design
58 OnlineMöbelhaus Karakter | Möbel Karakter
6800
Feldkirch
Karakter Möbel und Wohnaccesoires. Karakter bietet Möbel aus massivem Palisanderholz/Sheeshamholz im Kolonialstil und im ... Willkommen beim Online-Möbelhaus »Karakter« - Möbel im Kolonialstil und modernen Blockdesign Möbel
karakter.at Karakter Möbel Accessoires Möbelversand
59 TISCHLEREI PÖLZL STIEGEN Tischlerei

Tischlerei Pölzl: Stiegen Küchen Türen Möbel. 8083 St. Stefan im Rosental. ... Stiegen Türen Möbel Kontakt Wir bringen Leben in Ihre Wohnräume! Unsere Tischlerei bietet
tischlereipoelzl.at Tischlerei Pölzl Bezirk Feldbach St. Stefan
60 Exklusive Outdoor Möbel exklusives
6091
Neu Götzens
EXKLUSIVES DESIGN: Die Agentur für Design Outdoor Möbel Ihr Vertriebspartner von exklusiven Gartenmöbel ... by JoomlaVision.Com Katalog Homepage IMPRESSUM Möbelagentur - EXKLUSIVES DESIGN - Oudoor Möbel für Sie!
exklusivesdesign.at Exklusives Design Outdoor Möbel Garten Möbel
61 Willkommen bei Hochreiter Möbel Hochreiter GmbH Hochreiter
8644
Mürzhofen
Hochreiter Möbel wir planen und realisieren Ihr Projekt
hochreiter-moebel.at Hochreiter Möbel Tischler
62 Tischlerei Mayer: Möbel und Tischlerei

Tischlerei Mayer fertigt Möbel nach Ihren individuellen Wünschen. Unser Repertoire umfasst Treppen/Stiegen Küchen ... Tischlerei Mayer - Möbel und Stiegen/Treppen nach Mass
tischlerei-mayer.at Tischlerei Möbel Treppe Stiege
63 Home Ebenhofer Martin Martin

Martin Ebenhofer. Rechberg. Möbel Handel Montage Service. "Möbel für Ihre Sonnenseite"
ebenhofer-moebel.at Martin Ebenhofer. Rechberg. Möbel Handel Montage
64 Möbel Tischlerei in Aschau netwerk Kreidl GmbH & CO KG Schellhorn
6275
Stumm im Zillertal
Die Möbel Tischlerei Schellhorn bietet Ihnen höchste Qualität und meisterliche Verarbeitung Egal ob ein ... infoschellhorn Unsere Ausstellung Öffnungszeiten Mo - Fr - und -Uhr
schellhorn.at Schellhorn Möbel Gastronomie Franz
65 Mira Möbel

Möbel online bestellen! Mira Möbel bietet günstige Möbel für Ihr Zuhause. ... Wohnzimmer Schlafzimmer Arbeitszimmer Esszimmer Sessel Küchen Garderoben Möbel Kindersofas Kindrbetten Sofa
miramoebel.at
66 Pierburg Möbel und Mehr Gerhard Pierburg GmbH Möbel
5142
Eggelsberg
Handelsagentur Gerhard Pierburg Maßhemden Möbel Geweihe
pierburg.at Möbel Hemden Agentur Maßhemden
67 Möbel Pietschnig Willkommen Tischler
9360
Friesach
Ihr Partner für tolle Möbel schöne Küchen Wohnraumplanung mit bestem Preis persönlicher ... - Möbel Pietschnig Ing. Veronika Kotzent-Pietschnig St. Veiter - Friesach
pietschnig.at Tischler Möbel Einrichtung Friesach
68 Möbeldepot ? Vintage Möbel möbel

Vintage Design Möbel Accessoires und Antiquitäten aus Asien und dem Orient bei Möbeldepot in ... Möbeldepot ? Vintage asiatische Möbel Möbeldepot. Arts - Interiors - Exteriors. Newsletter
moebeldepot.at Möbel Möbeldepot Indisch Indische Möbel
69 Möbel Design Tischler Staller

Tischlerei Staller erfahrene fachmännische und individuelle Beratung sowie die Einzigartigkeit der gefertigten Möbel ... Möbel Design Tischler Staller Suchen HomeMöbel Design Tischler Staller WerkstätteHandwerk
tischlerei-staller.at Staller Tischlerei Staller Satller Siegfried
70 AKTION SITWELL MÖBEL Dekorartikel

AKTION SITWELL MÖBEL : Dekorartikel für Innen und Außen Stühle Barhocker Drehstühle Lounge ... Gartenmöbel Kurzfristig benutzt oder .Wahl Ledergarnituren Lounge Möbel und Fauteuil Polstermöbel Restposten
aktion-sitwell-moebel.at Dekorartikel Für Innen Und Außen Stühle Barhocker Drehstühle
71 FADA Industrie Möbel Fada

FADA Industrie Möbel Interieurdesign
fada.at Fada Stefan Rozic Möbel Möbeldesign
72 Tischlerei Hausleitner » Home Tischlerei Tischlerei
4882
Oberwang
Home Tischlerei Hausleitner Möbel Küche Tischler Oberwang Mondsee ... SA Home Leistungen Küchen Möbel Türen Ess- und Wohnzimmer Schlafzimmer Gewerbe Gastrononomie
tischlerei-hausleitner.at Tischlerei Oberwang Tischler Hausleitner Möbel
73 Möbel Meister moebelmeister

Möbel Meister ein Meisterbetrieb der steirischen TischlerWerkstätten mit hohen Anforderungen an Qualität und Leistung.
moebel-meister.at Moebelmeister Moebel Meister Tischler
74 QOQ Ein Lounge SUNSIGN GMBH Hocker
32514
Traiskirchen
Ein Lounge Möbel das begeistert! QOQ lässt Grenzen zwischen Land und Wasser außen und ... . Ein Lounge Möbel das begeistert! QOQ lässt Grenzen zwischen Land und Wasser außen und innen Design
sunsign-qoq.at Hocker Sessel Sitz Sitzgelegenheit
75 Möbel Shop Franz Franz König GmbH Möbel
6263
Fügen
Im Möbelshop der Franz König GmbH finden Sie geschmackvolle Accessoires Möbel Schmuckschatullen ... Startseite Kategorien Accessoires Gewürzmischungen Möbel Wanddekoration Uhren Licht Kinder Musik Marke
moebel-shop.at Möbel Shop Franz König
76 Wohnideen Möbel Lampen Gartenmöbel Design
40549
Düsseldorf
Onlineshop für moderne Einrichtung mit Wohnideen für Möbel Lampen Leuchten Gartenmöbel und ... designklassiker industrie look landhaus leuchtmöbel lloyd loom massivholz modernes wohnen skandinavische möbel
borono.at Design Möbel Lampen Leuchten PUK
77 Tischlerei Feuerstein ? Fenster Josef Feuerstein GmbH & Co KG Josef
6714
Nüziders
Die Tischlerei Feuerstein fertigt Fenster Türen Küchen Möbel Wintergärten Spezialanfertigungen ... Küchen Tischlerküche Möbel Möbel Handwerkliche Perfektion Emotion in Holz und eine Wohnumgebung
tischlereifeuerstein.at Josef Feuerstein Feuerstein Tischler Nüziders
78 Möbel Design design

Der Möbel Design Guide ein Reiseführer zur Wohnkultur in Österreich. Darüber hinaus führt der ... Registrieren Anmelden Über uns Kontakt News Vorjahres-Trends Newsletter Archiv Möbel Design
moebel-guide.at Design Guide Interior Guide Einrichtung Info
79 Hanli Möbel Ihr möbelmontage
5121
Ostermiething
Wir sind Ihr zuverlässiger Partner für Möbel aller Art jetzt unverbindlich nachfragen!
hanli.at Möbelmontage Möbelaufbau Böden Türen
80 Ihr Möbelhaus für Polstermöbel Ihr

Möbel Küchen Ingolstadt von der Planung bis zum Einbau. Ihr Möbelmarkt in Ingolstadt ... und Hocker Couchtische TV und HiFi Möbel Eck- und Beistelltische Sideboards und Kommoden Regale
wohnorama.at Ihr Möbelhaus Für Polstermöbel Planungs Küchen
81 MÖBEL KARBIENER Handwerk MÖBEL

MÖBEL KARBIENER steht für Handwerk mit Tradition Planung mit Zukunft. MÖBEL KARBIENER in Lambach ... Home Planung Designmöbel Werkstatt Kontakt Home MÖBEL KARBIENER JEDES MÖBELSTÜCK
moebel-karbiener.at MÖBEL KARBIENER Karbiener Thomas Thomas
82 MöbelTrans sijam

MöbelTrans fuer Oesterreich und Ausland ... FIRMA IN GRÜNDUNG! Möbel-Trans-Umzug - UMZUG Rufen Sie uns an wir machen Ihnen ein Spezialangebot
moebel-trans.at Sijam Montage Umzug Lkw
83 Janka Esterhazy Restauratorin janka

janka esterhazy restauratorin historische möbel holzobjekte hasnerstraße 64 1160 vienna ... Home Portrait Arbeitsweise Leidenschaften Atelier Kontakt Jedes historische Möbel
janka-esterhazy.at Janka Esterhazy  esterhazy  wien österreich Möbelrestaurator
84 Polster Möbel Polstermöbelerzeu
3251
St. Georgen
Polster Möbel Werkstatt FELLNER St. Georgen St. Pölten ... ? Polstermöbelrestaurierung ? Matratzenerzeugung ? Fahrzeugtapezierung ? Accessoires ? Antike Möbel ? Über uns Kontakt
polster-moebel-werkstatt.at Polstermöbelerzeugung Kenzo Mulberry Und Ralph Lauren
85 ::: Magnes Möbel ... Robert

Robert Magnes Möbel ... denn Ihr Tischlermeister macht's persönlich.
magnes.at Robert Magnes Möbel Tischler Tischlermeister
86 Mode Online Shop Universal

Universal Versand Ihr Shop um Mode Kleidung Schuhe und Möbel günstig online ... Online Shop - Kleidung - Schuhe - Möbel kaufen Universal Versand Hier finden Sie ein umfangreiches
universal.at Universal Versand Online Shop Mode
87 Khandmade alte Möbel Khandmade

Khandmade Möbel und Wohnaccessoires in Salzburg: Sitzmöbel Sessel Stühle shabby chic ... Khandmade aus alt wird neu Möbel und Wohnaccessoires in Salzburg alte restaurierte Möbel
khandmade.at Khandmade Möbel Und Wohnaccessoires In Salzburg: Alte
88 Franz König GmbH franz könig gmbH Franz
6263
Fügen
Franz König GmbH in Fügen im Zillertal Stuck Weinkeller Trockenbau Möbel ... Weinkeller Wand- Deckengestaltung Badrenovierung Möbel Accessoires Beleuchtung Shop Referenzen Kontakt
stuckateur.at Franz König GmbH Fügen
89 Möbel Fundgrube Home Handel

Möbel Fundgrube Margarethen am Moos ... Anfahrt Möbel Fundgrube Möbel Fundgrube Mit Möbel Fundgrube zum neuen Look! Optik ist immer
moebel-fundgrube.at Handel Großhandel Second Hand
90 Gastronomieeinrichtung Gastroeinrichtung sowie KASON GmbH & Co. KG Kason
94496
Ortenburg
KASON Hersteller von Gastronomieeinrichtung Objekteinrichtung und Hotelzimmereinrichtung. Fabrikverkauf – gebrauchte Gastro Einrichtung – ... - . Uhr +++ Vertriebspartner für DE AT und CH gesucht! +++ Besuchen Sie KASON auf folgenden Messen
kason.at Kason Möbel Moebel Stühle
91 Stefan Kohlbacher Moebel Raumdesign kohlbacher
8580
Koeflach
Stefan Kohlbacher Moebel Raumdesign ... Stefan Kohlbacher Moebel Raumdesign Alte Hauptstrasse Koeflach
kohlbacher-design.at Kohlbacher Möbel Raumdesign Tischler
92 MÖBELOnlineshop für Wohnen Möbel

Im Möbel Versand von nero Möbeloase finden Sie günstige Polstermöbel aus Leder Esszimmerstühle ... Couchtische Eck- Beistelltische Ordnung und Aufbewahrung Anbauwände Regale Raumteiler TV-Möbel Accessoires
nero-moebeloase.at Möbel Versand Polstermöbel Aus Leder Esszimmerstühle
93 Schmalnauer Treppen Tischlerei

Treppen Geländer Türen Möbel Montage Reparaturen 4632 Pichl/WelsLand ... Schmalnauer Treppen Türen Möbel Montage Reparaturen Startseite Projekte Kontakt Schmalnauer Harald
schmalnauer-t.at Tischlerei Treppen Geländer Türen
94 Wood.at: Möbel online planen möbel

Plattform zur OnlinePlanung von Möbeln ... wood Möbel online planen wood ist ein Projekt der Lumplecker Holzindustrieberatung GmbH
wood.at Möbel Planen Internet
95 KÖLBL PROFIMONTAGEN Möbel kölbl
8511
St. Stefan ob Stainz
KÖLBL PROFIMONTAGEN Möbel Türen Parkettböden
profi-montagen.at Kölbl Profimontagen Profi Montagen
96 Altholzdesign Möbel
9131
Grafenstein
Möbel aus Alzholz ... sthon Möbel aus Altholz Startseite Projekte Kontakt Altes Holz neues Design Glashaus
sthon.at Möbel Aus Altholz ; Möbel Aus Holz
97 Schreinerei Wirth | Bucher wb
88339
bad waldsee
wb* schreinerei wirth|bucher bad waldsee objekteinrichtungen innenausbau möbel ... verbindung von form und funktion? mehr schreinerei wirth-bucher innenausbau objekteinrichtungen möbel
wirth-bucher.at Wb Schreinerei Wirthbucher Schreiner
98 Einrichtungen Möbel

Möbel Rantschl ? Küchen Fenster Türen Möbel 3DPlanung Übersiedlungen ... Möbel Rantschl Produkte Küchen Esszimmer Wohnzimmer Schlafzimmer Jugendzimmer Begehbare Schränke
moebel-rantschl.at
99 Eventausstatter EMSON Möbel emson

Eventausstatter EMSON Möbel und Technik für jede Veranstaltung: Barhocker Stehtische Hussen ... der VIP-Lounge der Kleinen Zeitung auf der Grazer Ferien-Messe. Lounge-Möbel und Technik von Emson.
emson.at Emson Mietmöbel Möbel Mieten Veranstaltung
100 Möbel Klein Möbel

Das Möbelhaus mit Herz und Stil ... . Viel Spaß wünscht Ihnen Ihr Team von Möbel Klein. Möbel Klein Wien Landstraßer Hauptstraße
moebel-klein.at Möbel Küchen Wohnzimmer Polstermöbel
101 Rattan möbel rattan

Hier finden Sie qualitativ hochwertige Design und die Gartenmöbel von künstlichen Rattan die die ... im Warenkorb € inkl. MwSt Komfort Rattan Möbel nur für Sie Call + Hängematte Aventura
rattanmobel.at Rattan Mobel Garten Rattanmobel
102 Möbel Ludwig Ludwig
1220
Wien
Möbel Ludwig 4 x in Wien. Wiens größtes Möbelhaus mit 40.000m² Ausstellungssfläche. Der Spezialist
moebel-ludwig.at Ludwig Einrichtung Möbel Küche
103 MayrSchulmöbel | Schuleinrichtung | Mayr Schulmöbel GmbH schulmöbel
4644
Scharnstein
Schulmöbel von Mayr bewahren Lernende vor Haltungsschäden. Entdecken Sie jetzt unsere moderne und ergonomische Schuleinrichtung: ... Möbel für den komfortablen und in jeder Hinsicht gesunden Schulbetrieb. In unserem Portfolio finden
mayrschulmoebel.at Schulmöbel Schuleinrichtung Ergonomische Möbel
104 Tischlerei Künzler Bizau | Tischlerei Künzler GmbH & Co KG Tischlerei
6874
Bizau
Tischlerei Künzler Bizau | Bregenzerwald | Vorarlberg Bezau Küchen Türen ... Küchen Küchen Küchen Küchen Schlafzimmer Bad Möbel Tische + Bänke Kleinmöbel Garderoben Türen
kuenzler.at Tischlerei Künzler In Bizau/Bregenzerwald. Küchen Türen
105 Möbelonline.at Informationen zum

möbelonline.at ist Ihre erste und beste Informationsquelle über möbelonline Hier finden Sie auch weitere ... möbel-online Weitere Links Der Inhaber dieser Domain parkt diese beim Domain-Parking-Programm
xn--mbel-online-rfb.at
106 Home Max Leitner OHG Möbel
4020
Linz
Möbel Leitner Der Einrichter Ihres Vertrauens! ... Beleuchtung Bilder Schauraum Aktuelles Aktuelles Möbel Leitner Newsletter Nanai Fronten Design Noteborn
moebel-leitner.at Möbel Leitner Einrichter Individuelles Einrichten
107 Willkommen in der Kinderstrasse Kindermöbel
1160
Wien
Mode Möbel für selbstbewußte Kinder ... Home Shop Mein Warenkorb Mein Konto AGB´s Widerrufsrecht Versand-Informationen Möbel Materialien
kinderstrasse.at Kindermöbel Kinderbekleidung Kinderkleider Möbel Kinderzimmer
108 Tischlerei Spatzenegger ~ Möbel Tischlerei

Tischlerei Spatzenegger Spatzenegger Tischler Tischlerei Möbeldesign Türendesign Möbel ... Tischlerei Spatzenegger Johann Spatzenegger - Möbel und Türendesign News Design Wohnen Türen
spatzenegger.at Tischlerei Spatzenegger Spatzenegger Tischler Bau
109 Tischlerei OBERASCHER Mondsee :: Tischlerei Oberascher GmbH & Co KG Tischlerei
5310
Mondsee
Tischlerei Oberascher Möbel zum Wohnen und Arbeiten
oberascher.at Tischlerei Tischler Möbel Türen Fenster Küchen Innentüren Hautüren
110 Moebelgoll.at  Diese Website steht zum

Diese Website steht zum Verkauf! moebelgoll.at ist die beste Quelle für alle Informationen die ... moebel-goll Domain erwerben This domain is FOR SALE - Diese Domain steht ZUM VERKAUF Weitere
moebel-goll.at
111 Pure Velvet Möbel Online

Stilvolle und besondere Möbel Dekorationsartikel zu tollen Preisen auch online! Lassen Sie sich ... New In Get the Look! Möbel Beleuchtung Accessoires Dekokissen Kinderzimmer Stoffe Tapeten Sale
purevelvet.at
112 Moebelarchitektur.at Blumberger

Menschen mit Liebe und Freude am Weg. Wir von Blumberger begleiten Sie mit Möbelarchitektur in ... moebel-architektur - Möbel-Architektur ÖFFNUNGSZEITEN MO - DO bis Uhr und
moebel-architektur.at Blumberger Reinhart Waidhofen Waidhofen/Th. Waidhofen/Thaya
113 Tischlerei Ernst Küchen Möbel Tischlerei Ing. Ernst Gmbh & Co. KG Tischlerei
9330
Althofen
Tischlerei Ernst Küchen Möbel Fenster Türen Klagenfurt Althofen Kärnten. Die Tischlerei Ernst steht für Tradition ... Tischlerei Ernst Althofen Klagenfurt Kärnten Küchen - Möbel - Fenster - Türen Die Tischlerei Ernst
tischlerei-ernst.at Tischlerei Fenster Möbel Türen
114 Sanierung Renovierung Fenster Türen Sanierung

RUBUS Rund um Bau Sanierung Wir sind Ihr starker Partner bei Sanierungen
rubus.at Sanierung Sanierungen Fenster Türen Möbel Renovierung Renovierungen Wien
115 Möbel einfach Online bestellen

Moebella24 Möbel Onlineshop Möbel einfach Online bestellen Sofas Betten Essgruppen ... Reggio ? In den Warenkorb Essgruppe Rustico Vintage Style Landhaus Esszimmer Möbel von
moebella24.at
116 Easy Möbel Shop Steiner Shopping GmbH Möbel
3383
Hürm
... Kontakt Steiner Shopping GmbH Easy Möbel® Hainberg Hürm - Mail
easymoebel.at Möbel Wohnen Schlafen Einrichtung
117 Kastlwerkstatt Home Kastl
1130
Wien
Möbelunikate Recycled Wohnaccessoires Möbel Workshops ... Home Möbel Wohnaccessoires Plätzchen gesucht Recycled Accessoires Schon vergeben Making of
kastlwerkstatt.at Kastl Möbel Accessoires Recycled
118 Möbel und Bautischlerei Schösser

Qualität steht bei uns an erster Stelle ! Diese beginnt schon bei der fachkundigen Beratung ... Möbel- und Bautischlerei Schösser - Lanersbach - A Tux
tischlerei-schoesser.at Schösser Thomas Kreativ In Holz
119 Farkas Moebel Tischlerei

Ihr Meistertischler Wohndesign Bau und Möbeltischlerei Bau und Möbeltischlerei · Farkas Alois ... ÜBER UNS BERATUNG PLANUNG AUSFÜHRUNG KONTAKT Einrichtung-Möbel RAUMGESTALTUNG Küche Esszimmer
farkas-moebel.at Tischlerei Möbeltischlerei Bautischler Alois
120 Suche Möbel Home CONST

Suche Möbel Marktplatz zum Suchen und Finden Ausstellen und Verkaufen neuer und ... Finden Ausstellen Verkaufen neuer neuwertiger sowie gebrauchter Möbel. Suchemoebel bietet
suchemoebel.at CONST IT CONSULTING
121 IdeaForDesign.at Interieur auf Interieur

Wir erstellen den Vorschlag und die Visualisierung. Darüber hinaus bieten wir eine rasche Montage und
ideafordesign.at Interieur Auf Massenfertigung Böden Türen
122 HOME | ConverTTable iPhonetable

Der High End Autosimulator / Fahrsimulator inkl. RECARO Sitz als Design Möbel für home ... und Sie habenkeinen Platzverlust! Vielmehr ist dieses Möbel eine Skulptur die Ihrem Raum mehr Atmosphäre verleiht
coffeetable.at IPhonetable Tableconnect Multitouch Simulator
123 Traditionelle Möbel handwerklich Möbel

Traditionelle Möbel fügen sich in keine schnelllebigen Trends sondern überdauern Mode und bleiben sich
moebel-romantik.at Möbel Holz Natur Landhaus
124 Möbel günstig online kaufen
2431
Enzersdorf an der Fischa
KM Handel ist der günstigste Möbel online shop mit unschlagbaren Preisen bei km möbel . ... Shop über uns Kontakt Shop Österreichs bester Online-Shop für Möbel Jetzt NEU Bezahlen
km-handel.at
125 Filzer Möbel Willkommen tischlerei

Kreativmöbel Tischlerei Filzer ... stefanmoebel-filzer
moebel-filzer.at Tischlerei Filzer Holz Leogang
126 Schloss Grubhof – Wohnen Schloss

Schloss Grubhof wurde 1325 erbaut und war die ehemalige Residenz des Königs von Bayern
schloss-grubhof.at Schloss Schlosshotel Möbel Betten
127 Möbel austria – Tage Möbel

Österreichische Möbelfachmesse vom 7. – 8. Mai 2013 im Messezentrum Salzburg ... Besucherinfos Aussteller News Presse Kontakt Registrierung möbel austria
moebel-austria.at Möbel Austria Messe Fachmesse
128 Moebelmarkt.at Informationen zum

moebelmarkt.at ist Ihre erste und beste Informationsquelle über moebelmarkt Hier finden Sie auch weitere ... moebel-markt Domain erwerben This domain is FOR SALE - Diese Domain steht ZUM VERKAUF Domain
moebel-markt.at
129 Wunderbar durchdachte Möbel LIVING SIEDENDORF KG
3400
Klosterneuburg
DesignerMöbel mit einer besonderen Funktionalität handgefertigte Wohnaccessoires und hochwertige Wollteppiche mit geometrischen Mustern. ... Start Produkte Magnetwände Magnete Teppiche Möbel Über uns Service Kontakt Start Produkte
living-siedendorf.at
130 GLAFO MÖBEL Wohnzimmer

Möbel aus Österreich
ninimax.at Wohnzimmer Wohnmöbel Schlafzimmer Schränke
131 Best Möbel

Best Möbel
bestmoebel.at
132 Modl.at :: Modl GmbH Modl Ges.m.b.H. Modl
5202
Neumarkt am Wallersee
Modl GmbH Tischlerei Möbel Objekteinrichtung Küchen ... Produkte Jobs Kontakt MODL - kreativ einrichten die Tischlerei für Ihre Möbel Copyright Modl
modl.at Modl GmbH Tischlerei Möbel Objekteinrichtung
133 Tischlerei Pfister: Möbel nach Möbel
6721
Thüringerberg
Tischlerei Pfister Walter ... Küchen Wohnzimmer Schlafzimmer Verschiedene Möbel Fenster Türen Altbausanierung Kontakt
pfister-holz.at Möbel Fenster Schlafzimmer Walls Türen Betten Garderoben Tischlerarbeiten
134 Möbelshop.at Informationen zum

möbelshop.at ist Ihre erste und beste Informationsquelle über Möbel shop Hier finden Sie auch ... Domain erwerben infodomcollect DE US möbel
xn--mbel-shop-07a.at
135 BöhmMitsch: Möbel nach Maß Böhm-Mitsch GmbH Böhm
2244
Spannberg
Die Tischlerei BöhmMitsch im Weinviertel fertigt Ihre Möbel nach Maß: Küchen Wohn Schlafzimmer
boehm-mitsch.at Böhm Mitsch Möbel Möbel Nach
136 Bambusmöbel Möbel aus Bambus Bambusmöbel

... ... ...sich Ihren Wohnraum mit Möbel aus Bambus einrichten? ...in einem Bambusbett ein neues Schlafgefühl erleben
bambus.co.at Bambusmöbel Bambusmoebel Möbel Aus Bambus Bambusbett Bambusbetten Gelbett
137 Das Online Möbelhaus XXXLutz KG
4600
Wels
Möbel online kaufen bei XXXLutz ? Möbel Leuchten Wohnaccessoires ? Das Online Möbelhaus ... abonnieren XXXL Preisepass alles über den XXXL Preisepass Möbel Wohnzimmer Polstermöbel Wohnwände
xxxlutz.at
138 Möbel Computer Kleinanzeige

Kleinanzeigen kostenlos inserieren verkaufe kaufe suche Gebrauchtwaren Secondhand Computer ... Inserate Diverses Fahrrad Mountainbike TV Hifi Elektro gebraucht Inserate Musik Möbel Sitzgarnitur
haustiermarkt.at Kleinanzeige Kostenlos Inserieren Verkaufe Kaufe
139 Möbel und Raum Asiamöbel
8020
Graz
Exclusive Möbel und Accessoires aus Asien mit Einmaligkeit Lebendigkeit und individuellem Ausdruck ... Vermietung und Sonstiges Newsletter AGB Telefon Adresse Anfahrstplan Herzlich Willkommen bei Möbel
moebelundraum.at Asiamöbel Chinamöbel Hochzeitsschrank Asien
140 CityAntik Jugendstil Wien Jugendstil

CityAntik Jugendstil Wien bietet Jugendstil Moebel Thonet Glas Keramik Schmuck
city-antik.at Jugendstil Wien Goldscheider Meissen Jugendstil
141 Möbel nach Maß

Tischlerei Erwin Kalischko in Neustift / Pühret. Qualitative hochwertige Möbel aller Art termintreu ... Qualitative hochwertige Möbel und Einrichtungen nach Maß aller Art. Termintreu und mit optimalem Preis
kalischko.co.at
142 Moebeltransport.at Informationen zum

moebeltransport.at ist Ihre erste und beste Informationsquelle über moebeltransport Hier finden Sie auch weitere ... + moebel-transport Weitere Links Der Inhaber dieser Domain parkt diese beim Domain
moebel-transport.at
143 Gebrauchte Möbel: Gebrauchtmöbel Kleinanzeigen

Der kostenlose Anzeigenmarkt für gebrauchte Möbel! Gebrauchtmöbel kaufen und verkaufen! Unbegrenzt inserieren und gratis für ... Sofagarnitur Designer Eckbank Couchtisch Möbel für Gastronomie Neue
moebelanzeigen.at
144 Tischlerei Feldkirch Kurt Tischlerei

Tischlerei Feldkirch Möbel Küche Bad Wohnzimmer Esszimmer Schlafzimmer
moebelmeier.at Tischlerei Feldkirch Möbel Küche
145 Air Style Designer
8010
Graz
Bei AIRandSTYLE finden Sie aufblasbare Design Möbel für den indoor und outdoor Bereich. Unsere aufblasbaren ... -Adresse Passwort Passwort vergessen? Registrieren aufblasbare Designer Möbel erweiterte Suche
airandstyle.at Designer Möbel Eventmöbel Möbel Für Events Möbel Für
146 Möbel nach Maß Flewid Media GmbH möbel
29227
Celle
... Individuelle Möbel nach Mass online konfigurieren und bestellen. Moderne Designmöbel aus Massivholz
damao.at Möbel Nach Mass Designmöbel Möbel Online Konfigurieren Möbeldesign
147 Joha Türen Baumart

Joha Türen. Baumart Wohnraumdesign Möbel nach Maß Spezialanfertigung. Qualität besteht! ... officejoha-team » Nachricht schliessen! Joha Türen Möbel by Joha Türmodelle Service Bilder Kontakt
joha-team.at
148 Smart Living ? Möbel SMART LIVING GmbH
1070
Wien
Smart Living in 1070 Wien sind Ihre Ansprechpartner für Wohnkonzepte aus modernen Möbel Beleuchtungssysteme ... für Einrichtung. Unser Spektrum umfasst exquisite Möbel Raumplanung und Inneneinrichtung. Egal ob Möbel
smartliving.co.at
149 Moebel hochwertige Möbel SOLEUM GmbH bambusmöbel
4230
Pregarten
... neue Wohlfühlbereiche schaffen! Sie möchten... ...sich Ihren Wohnraum mit Möbel aus Bambus einrichten
moebel.or.at Bambusmöbel Bambusmöbel Babmusmöbel Bambusmöbel Bambus Möbel Bambusmöbel Möbel
150 Home C. Fank Plattenzuschnitt
8250
Vorau
Plattenzuschnitt Fank Qualität für Heimwerker und Profitischler. Plattenzuschnitte Bekantungen Tischlereizubehör Beschläge ... Willkommen bei C. Fank Möbel! Wir fertigen für Tischler und Möbelhändler Möbel für den gesamten Wohnbereich
c-fank.at Plattenzuschnitt Selbstbaumöbel Platten Arbeitsplatten
151 Tischlerei Josef Kranzl kranzl

Tischlerei Josef Kranzl Niederösterreich Massivholzmöbel Einzelanfertigungen Vintagemöbel Klassische Möbel
tischlerei-kranzl.at Kranzl Tischlerei Holz Design
152 Toscana Möbel

Toscana Möbel
toscanamoebel.at Möbel Massivholz
153 Spechtenhauser :: Fenster Holz- und Glasbau GmbH
6020
Innsbruck
?? Unser Familienunternehmen wird höchsten Qualitätsansprüchen im Bereich Möbel Küchen Glas Fenster ... Erfahrung handwerkliche Präzision und Fenster in Meister-Qualität. Möbelbau Möbel und Innenausbauten
spechtenhauser-moebel.at
154 Vintage and Contemporary Möbel

Shop Antiquitäten Vintage MidCentury und Contemporary Möbel und Lampen von den besten Händlern ... aus dem . Jahrhundert und früher Neues in Vintage Möbel Möbel Alle Möbel Sitzmöbel Tische Aufbewahrung
pamono.at
155 Tischlerei INHolz Schladming Winkler Steiner OG Tischlerei
8970
Schladming
Tischlerei InHolz in Schladming: Individuelle Möbel für Ihren individuellen Geschmack. Wir nehmen uns Zeit für ... und vor allem mit Verlässlichkeit unsere Kunden überzeugen. Individuelle Möbel für Ihren individuellen Geschmack. Wir nehmen
in-holz.at Tischlerei InHolz Schladming Steiermark Österreich
156 Gartenmöbel Exclusive Möbel IHP - Ihr HandelsPartner GmbH & Co. KG Gartenmöbel
6020
Innsbruck
Ihr Spezialist für Gartenmöbel Rattanmöbel in Österreich. Exclsuive Möbel für Garten und Terasse. Tirol ... Kaufabwicklung Schauraum Sicher Einkaufen Empfehlung fritz-Sitzsack moebel-rattan ihp.at the-green-pot Garino
moebel-garten.at Gartenmöbel Rattanmöbel Polyrattanmöbel Online Shop
157 Möbel Messestand und Möbel

Tischlerei und MassMöbelHerstellung sowie Objekteinrichtung FranekEibl GmbH in Adnet beei Salzburg Österreich Tel +43(0)624585074
passt.at Möbel Einrichtung Möbelbau Einrichtungen
158 KWAT :: Nina Habe
8160
Weiz
KWAT :: Nina Habe :: Weiz Steiermark Österreich Produktdesign Design Malerie ... KWAT DESIGN SOLUTIONS Home About Raumgestaltung Möbel Accessoires Brett KH Schuhblock VE
kwat.at
159 Polsterprofi Einrichten Wohnen Markenmoebel

Markenmoebel Inneneinrichtung Innenausbau Hoteleinrichtung Designermoebel Landhausküchen Schreinerei Innenarchitektur
polsterprofi.at Markenmoebel Inneneinrichtung Innenausbau Hoteleinrichtung
160 Startseite Putz Möbel Putz Möbel GmbH logo
8230
Hartberg
Ihr Einrichtungspartner in Hartberg. Erhalten Sie bei uns viele neue Wohnideen und Tipps vom Profi. ... Dekoideen Putz Möbel bei Facebook Besuchen Sie uns auf unserer Facebook-Seite. mehr lesen Küche planen
putzmoebel.at Logo Moebel Wohnen Wohnideen Abholmarkt
161 MÖBEL NACH MASSINNENAUSBAUGESCHÄFTSEINRICHTUNGFENSTERTÜRENTORE TISCHLEREI
1090
Wien
Tischler 1090 Wien Maßanfertigung Holzdesign ... So finden Sie uns Produkte Küchenmöbel Inneneinrichtung Möbel nach Maß Einzelmöbel Individuelle
tischlerei-wolfram.at TISCHLEREI 1090 Wien Möbel Nach Mass
162 WebTischler Natur Möbel Tischler

Hier erfahren Sie alles über individuelle persönliche und passgenaue Einrichtungen ... webTischler - Natur Möbel Design Schauptmayr Herzlich Willkommen Man kann einen Menschen
webtischler.at Tischler Tischler Webtischler Webtischler
163 Küchenstudio Bergheim mit Tischlerei

In Bergheim nahe Salzburg finden Sie das Küchenstudio Bergheim und die Tischlerei Klein. ... in Bergheim erzählen Sie uns von Ihren Vorstellungen und wir erstellen individuelle und handgefertigte Möbel
tischlerei-klein.at
164 GRABNER MÖBEL Baden Wien  Hochrainer GmbH
2500
Baden
Seit 1969 entscheiden sich Kunden für GRABNER MÖBEL in Baden bei Wien. Verwirklichen Sie gemeinsam ... GRABNER MÖBEL Baden Wien Aktuelles Unternehmen Service von A-Z -D Online Küchenplaner Wohnen
grabnermoebel.at
165 Sofa Shop online Designer

Sofashop24 ist der online Shop für exklusive Sofas Ledersofas und schönen Wohnlandschaften. Kaufen Sie ... und Betten aus dem Designer Möbel Onlineshop von Sofashop Hotline Menü Home Wohnzimmer
sofa-dreams.at
166 Teak Gartenmöbel und Vollholzmöbel terrassenmöbel
8042
Graz
Als der grösste Teak und VollholzMöbelAnbieter in Österreich haben wir ständig grössere Mengen von Teakholz ... Teak Gartenmöbel - Vollholzmöbel - Massivholzmöbel - Möbel nach Mass online kaufen AGB Kontakt
fantasteak.at Terrassenmöbel Teakholz Teak Gartenmöbel Gartenmöbel
167 AnaZard Shabby Chic keywords
1230
Wien
Onlineshop für Shabby Chic Vintage Landhausstil Homedecoration Accessoires Möbel Leuchten ... für ? Home Decoration ? Wohnaccessoires ? Möbel ? Modeschmuck ? ? Shabby Chic ? Vintage ? Landhausstil
anazard.at Keywords Kommagetrennt
168 Planungsbüro Hermann Lammerhuber planungsbüro

Das Planungsbüro Lammerhuber ist spezialisiert auf Innenraumplanung die Erstellung von Rohplänen und Innenplänen ... Start Planung Möbel Samina Referenzen Kontakt You need to upgrade your Flash Player Wir setzen
planung-lammerhuber.at Planungsbüro Lammerhuber Innenplanung Raumplanung Innenarchitektur
169 Weißenbek Der energetische

Weißenbek Möbel Design Montage Energetik Feng Shui Radiästhesie ... officeweissenbek - Website www.weissenbek Möbel - Design - Montage - Energetik - Feng Shui
weissenbek.at
170 Amtmann: Tischlerei Innenausbau Möbel
5450
Werfen
Amtmann baut Möbel mit höchster individueller Funktionalität. Funktionalität verstehen wir als das Zusammenspiel von ... Amtmann baut Möbel mit höchster individueller Funktionalität. Funktionalität verstehen
amtmann.co.at
171 Joha Baumart

Joha Türen. Spezialist Inneneinrichtung Wohnraumdesign Möbel nach Maß Spezialanfertigung Tischlerei ... Joha Türen Baumart Joha Möbel Joha-Türen Baumart Möbel by Joha Kontakt Home Willkommen bei Joha
joha.at
172 Ergonomie: Ergonomische Büromöbel

Ergonomie! Infos über ergonomische Möbel für Büro Wohnung Arbeitsplatz. » Bürostuhl » Schreibtisch ... Übersicht Ergon Tischgestell Spine² iMove Vital-Office Ergonomie Vital-Office Bambus Möbel Vital-Office
ergonomie-katalog.at
173 Thalia möbel wohnform löffler möbel

Thalia Möbel im 16. Bezirk in Wien fuehrt Planungen EinrichtungsPlanung Einrichtungsplanung von Qualitätsmöbel in edle
moebel-thalia.at Möbel Wien Planungen Thalia
174 Apuria Glas

einzigartige Möbel
apuria.at Glas Handwerk Holz Möbel
175 Mode Online Shop | Otto GmbH
8020
Graz
OTTO Versand: Der ?????OnlineShop für Mode Lifestyle Schuhe Möbel und mehr. Bequem ... . Möbel Möbel . Heimtextilien Heimtextilien . Baumarkt Baumarkt . Spielzeug Spielzeug . Marken Marken
ottoversand.at
176 M24austria.at M24 GmbH M24austria.at
96482
Ahorn - Triebsdorf
Professionelle und preiswerte Möbel für Gastronomie Gewerbe und Handel bei m24austria.at. Hier finden Sie ... von Einzelteilen und Ersatzteilen für unsere Möbel über Stoffe in verschiedenen Materialien und Farben
m24austria.at M24austria.at Möbel Inneneinrichtung Stühle
177 Möbelcorner Germ GmbH in

Bei Möbelcorner Germ GmbH in 1050 Wien Margareten finden Sie Möbel nach Maß für Küche ... Wir sind Ihr freundliches und kompetentes Fachgeschäft in Sachen Möbel nach Maß Küchen/Einbauküchen Küchenumbau
moebel-germ.at
178 Tischlerei Neunkirchen

Tischlerei Wolfgang Schaller ? Ihr Tischler für Möbel Fußböden Türen Einrichtungen ... Möbel nach Mass Fußböden Türen Einrichtungen Reparaturen und Änderungen Übersiedelungen Herzlich
tischlerei-schaller.at
179 Home Klinar2 Handels Klinar2 Handels OG fenster
9872
Millstatt
Der Spezialist für Fenster Türen In OutdoorMöbel Physiotherm Tischlerarbeiten ... Referenzen Lage Karl Klinar In- Outdoor-Möbel Schauraum Thomas Morgenstern Platz Seeboden
klinar2.at Fenster Türen Möbel Physiotherm
180 Startseite Logo Möbel Putz Möbel GmbH logo
8230
Hartberg
Ihr Einrichtungspartner in Hartberg. Erhalten Sie bei uns viele neue Wohnideen und Tipps vom Profi. ... Sie jetzt unsere Online-Gutscheine -Einfach und sicher direkt online! mehr lesen Logo Möbel bei Facebook Besuchen
logo-moebel.at Logo Moebel Wohnen Wohnideen Abholmarkt
181 Greiner Möbel
2304
Orth an der Donau
Greiner Möbel www.greinermoebel.at Objekteinrichtung Hoteleinrichtung TürenSonderanfertigungen Tischlerei www.judithkeles.com
greinermoebel.at
182 Mothergoose Klassisch zeitlose mothergoose

Klassischzeitlose Möbel Interior Textilien und Spielsachen für Mädchen und Buben von 08 ... Klassisch zeitlose Möbel Textilien und Spielsachen für Mädchen und Buben von bis Produkte
mothergoose.at Mothergoose Calice Trauttmansdorff Wallner
183 Möbel online günstig kaufen
10623
Berlin
Mehr als 2000 Möbel günstig im Online Shop bei KaufUnique.at. Dauertiefpreise bei allen Möbeln ... quadratisch Sideboard Kommoden TV-Möbel Wohnwand LED-Möbel Wandkonsole Konsolentisch Elektrokamin
kauf-unique.at
184 Henders Hazel Henders

Henders Hazel kreiert Möbelmode. Möbel aus eigenem Atelier angefertigt von Fachkräften. ... Schränke Buffetschränke Bücherregale Highboards Lagerschränke Sideboards TV-Möbel Vitrinen Sofas -sitzer
hendersandhazel.at Henders Hazel Kreiert Möbelmode. Möbel Aus Eigenem
185 Home: alles im griff GRIFF

PRODUKTION UND VERTRIEB VON GRIFFEN ALLER ART IM SPEZIELLEN FUER MOEBEL UND EINRICHTUNG ... für Möbel verbunden sind. Von . bis . Februar sind wir wieder auf der ZOW vertreten und freuen uns schon
allesimgriff.co.at GRIFF GRIFFE ALUMINIUMGRIFFE EDELSTAHLGRIFFE HOLZGRIFFE MOEBELFUESSE DESIGN MOEB
186 WohnARTStudio MÖBEL HALTER wohnart

... MÖBEL HALTER Garant für gutes Wohnen Terminvereinbarungen unter ab ..
wohnart-studio.at Wohnart Möbel Halter Bruck Halter
187 Günstiger Baby OnlineShop | Kinderwagen
01665
Käbschütztal
Günstige Babyausstattung in unserem Baby Familienportal mit Kaufempfehlungen und Tipps rund um Baby ... Möbel Kinderzimmer-Ausstattung Die Einrichtung des Babyzimmers bzw. Kinderzimmers richtet sich ganz
baby-und-kind.at Kinderwagen Baby Shop Kindermode Kinderzimmer Möbel Still BH
188 In Baden bei Wien Hochrainer GmbH
2500
Baden
Seit 1969 entscheiden sich Kunden für GRABNER MÖBEL in Baden bei Wien. Verwirklichen Sie gemeinsam ... Wohlfühlen Kochschule Rezepte Kontakt Grabner Möbel im neuen Gewand Neuer Name ? gleiche Qualität
derwohnraumgestalter.at
189 Brege Möbel Sitzmöbel Stuhl

Familienbetrieb Brege Möble aus Wenns im Pitztal stellt Sitzmöbel und Tische aus eigener Produktion her. ... Brege Möbel Wir sind ein professionelles Unternehmen aus Wenns im Pitztal spezialisiert auf Fertigung
brege-moebel.at Stuhl Sessel Hocker Barhocker
190 Hase Kramer | Tischler
6850
Dornbirn
Tischler aus Vorarlberg. Neue Küchenideen im Küchenstudio Dornbirn.Wir sind im hochwertigen Möbel und Innenausbau tätig. ... in Dornbirn. Küchen und Möbel nach Maß. Schauraum Vorarlberg Dornbirn Innenstadt Eisengasse a. Tel
hase-kramer.at Tischler Aus Vorarlber Dornbirn Kuechen
191 Home Tischlerei Weber Tischlerei
8672
St. Kathrein a. H.
Tischlerei Weber Ihre Tischlerei in St. Kathrein a. H. im Bezirk Weiz. Beratung und Planung ... Leistungen Referenzen Unternehmen Aktuelles Kontakt Möbel mit Geschmack Einfach wohlfühlen Küchen nach Mass
tischlerei-weber.at Tischlerei Weber St. Kathrein Am Hauenstein
192 Hochwertige gebrauchte Büromöbel Gebrauchte

Gebrauchte Büromöbel billig günstig preiswert mieten kaufen Wien Niederösterreich ... Gebrauchte Büromöbel günstig - mieten - kaufen - Bene Möbel - Hali Möbel - Neudörfler - Sitzmöbel
moebelmieten.at Gebrauchte Büromöbel Billig Günstig Preiswert
193 Altholz Tischlerei Antikholz altholz

Der auf Altholz spezialisierte Tischler in Salzburg informiert über Möbel aus Antikholz wie z.B. Türen
antikholzwerkstatt.at Altholz Möbel Tischlerei Altholzmöbel Tischler Antikholz Antikholzmöbel Antiquit
194 Tischlerei Thaler Tischlerei
9842
Mörtschach
Wir erzeugen Ihre Möbel nach Maß und Wünschen. So wird Ihr Traum von schöner Wohnen ... Meisterbetrieb hochwertige Möbel die Ihren Wünschen und Bedürfnissen entsprechen. Ausgewählte natürliche
tischlerei-thaler.at Tischlerei Möbel Stiegen Mörtschach
195 Willkommen bei GEA GEA

GEA MÖbel und Schuhe und mehr
gea.at GEA MÖbel Schuhe
196 Tischlerei Freudenthaler GmbH Wohncharakter Altenberg

Tischler Altenberg Freudenthaler Möbel
wohncharakter.at Altenberg Freudenthaler Möbel Tischler
197 Friedrich Otto Schmidt FOS
1090
Wien
Spezialist für Planung und Anfertigung von Inneneinrichtung sowohl als auch auf fachgerechte Restaurierung und ... Restaurierung und Kopie alter Möbel spezialisiert ist. Entsprechend der Tradition des Unternehmens werden seit
fos.at FOS Möbel Restaurierung Innenarchitektur
198 Möbel nach Maß
4451
Garsten
... möbel-dimitrov officemoebel-dimitrov Home Unsere Firma Projekte - Galerie Lieferanten
moebel-dimitrov.at
199 Privileg Technik Möbel Online QUELLE

QUELLE Versand 300.000 Artikel | Möbel Technik Privileg günstig online kaufen | ... Monitore NF Mailing KW Rühren Mixen Notebooks QUELLE - Möbel Privileg Garten und Baumarkt kaufen
quelle.at QUELLE Online Shop Österreich
200 FEHLENDE ÜBERSCHRIFT CoolesHandwerk

CoolesHandwerk Tischlerei Schallert Schallert Mario Cooles Handwerk Tischlerei Mario Schallert Möbelbau Küchen Sonderanfertigung Design Möbel ... FEHLENDE ÜBERSCHRIFT Küchen Bad Möbel Sonderanfertigung Kontakt Links Gästebuch FEHLENDE
cooles-handwerk.at CoolesHandwerk Tischlerei Schallert Schallert Mario Cooles Handwerk Tischlerei
201 AWEST Shop AWEST

AWEST Shop Ladenbau Ladeneinrichtung Geschaeftseinrichtung Ladenbedarf Displays POS
awest.at AWEST Shop Ladenbau Ladeneinrichtung
202 Designermöbel online kaufen im Designermöbel

Designermöbel Möbel namhafter Marken Online kaufen und inspirieren lassen. ?Qualität ?Große Auswahl ?100% ... Registrieren + HOME - DESIGN - LIFESTYLE % sicher einkaufen Toggle navigation MENU Möbel
nunido.at Designermöbel Möbel Einrichtung Sofas
203 Wiesner Möbel .:. Home Einrichtung

Wiesner Möbel | Individuelle Erzeugung von Gästezimmer Hotelzimmern und Einrichtungsobjekten
wiesner-moebel.at Einrichtung Objektgestaltung Möbelerzeugung Handel
204 Tischlerei Walter Trattner..........Möbel aus Tischler
8162
Passail
Tischlerei Walter Trattner Möbel aus Meisterhand
trattner.at Tischler Tischlerei Tischlermeister Meisterbetrieb
205 Tischlerei Lehner Möbel
4611
Buchkirchen
Tischlerei Lehner Möbel und Türen nach Maß
tischler-lehner.at
206 Möbel mit zeitlosem Klang Symphonic GmbH symphonic
8184
Anger
Möbel mit zeitlosem Klang Symphonic GmbH
symphonic.at Symphonic Objektausstatter Hotelausstatter Möbelhersteller
207 Deisl Möbel

... Javascript Menu by Deluxe-Menu Deisl Möbel
deisl-moebel.at
208 Andreas Leibnitz Möbelrestaurator Restaurator

Restaurator Andreas Leibnitz. Reversible Restaurierung von Holzobjekten wie Möbel Kunstgegenständen ... Alte Möbel zu besitzen und mit ihnen zu leben bedeutet eine emotionale Bindung zu bleibenden
andreasleibnitz.at Restaurator Restaurierung Kunst Tischler Antik Antiquitaeten Moebel Polstermoebe
209 Tischlerei Walter Haberl Tischlerei

Tischlerei Walter Haberl Ihr Meisterbetrieb Möbel Fenster Türen Stiegenbau ... Möbel Fenster Türen Stiegenbau Parkett und Blindbodenverlegung Inneneinrichtungen
tischlerei-haberl.at Tischlerei Haberl Möbel Fenster
210 Tischlerei Technisches Buero Ing. Tischlerei
4551
Ried im Traunkreis
Wir fühlen uns verpflichtet umweltkonforme Produkte zu produzieren umweltverträgliche Materialien zu verwenden und ... zu verwenden und garantieren ein optimiertes Design und Alltagstauglichkeit unserer Möbel. Langlebige
mistlberger.at Tischlerei Technisches Büro Möbel Aussengestaltung
211 Moebelfink.at

... moebel-fink Unsere Seiten befinden sich im Aufbau. Besuchen Sie uns wieder. Fragen postmaster
moebel-fink.at
212 Willkommen auf der Startseite Restaurator

Restaurator Andreas Scheinast. Reversible Restaurierung von Holzobjekten wie Möbel Polstermöbel Kunstgegenständen und Vergoldungen. ... Referenzenliste Angebot Möbel Das Berufsbild des Restaurators Neueste Nachrichten Bericht Bawag Filiale Bericht
scheinast.at Restaurator Restaurierung Kunst Tischler Antik Antiquitaeten Moebel Polstermoebe
213 Atelier Majestic Tiger Individuelle
1140
Wien
Individualität für deine Möbel! Kunstmöbel Wohnen Design Lifestyle WIEN Vintage ... Atelier online shop Möbel Wohnaccessoires Zubehör möbelwerkstatt Workshops Neue Seite Inspiration
majestictiger.at
214 Aumeier Möbel aumeier


aumeier.at Aumeier Schönau Schoenau Tischler
215 Tischler Unternehmen Krzeptowski KG tischler

Wir sind ein Tischler Unternehmen mit viel praktischer Erfahrung Tradition ... vor dem Tischlerhandwerk. PROJEKTE Planung und Erzeugung Möbel Privatkunden Firmenkunden Klein und große Objekten
krzeptowski-kg.at Tischler Krzeptowski Tischlerei Tischlermeister
216 La Maison d'Elisa Möbel
1070
Wien
Im französischen WohndekoShop La Maison d'Elisa finden Sie Möbel und Wohnaccessoires im französischen Landhausstil. ... schönen Farben und schlichten Materialien. In meinem Shop finden Sie Möbel und Wohnaccessoires
maison-elisa.at Möbel Wohnaccessoires Französischer Landhausstil Shabby
217 Tischlerei Schober aus Lofer Tischlerei
5090
Lofer
Tischlerei Schober aus Lofer Handwerk mit Idee und Verstand. Traditionelles Handwerk moderne Wohnkonzepte ... der Tischlerei Schober in Lofer. In unserer Werkstatt fertigen wir aus besten Rohstoffen besondere Möbel
tischlerei-schober.at Tischlerei Schober Lofer Planung Möbel Wohnen Küche Bautischlerei
218 Möbel Pommer | Es Pommer

... Service Aktuelle Projekte Über Möbel Pommer Jobs Großhandel Wegweiser Kontakt Eigene Erzeugung
pommer.at Pommer Möbel Schlafzimmer Küche
219 Alles für ein schönes möbel

Mit LionsHome findest du neue Wohnideen exklusive Tipps von unseren Einrichtungsexperten und günstige Möbel ... Million Angeboten. Möbel Badmöbel ? Bar-Möbel ? Betten ? Garderoben ? Hängematten ? Hocker ? Kaminöfen
lionshome.at Möbel Wohnen Garten Shopping Produktsuche Preisvergleich Suchmaschine Für
220 Kunstschmiede | Kunstschmiede Ukovmi Schmiede
2405
Bad Deutsch Altenburg
Ukovmi Kunstschmiede bei Prešov. Schmiedeeiserne Möbel nach Maß Geländer Zäune Tore ... Schmiedeeiserne Geländer Schmiedeeiserne Geländer für Innen- und Außenbereich. Geländer Schmiedeeiserne Möbel
ukovmi.at Schmiede Kunstschmiede Schmiedeeiserne Tore Schmiedeeiserne
221 Home Massiv
8983
Bad Mitterndorf
Massiv Möbel Klassische Möbel Sondermöbel Holz Art Skulptur Büste Holzschnitzerei ... werden zur Umsetzung sowohl eigens gefertigte Kunstgegenständen als auch individuell entworfene Möbel
holzwerke.at Massiv Möbel Klassische Möbel Sondermöbel
222 Tischlerei GRÖMMER – Einrichtung Tischlerei

Tischlerei Grömmer produziert Möbel nach Maß für Krankenhäuser die Hotellerie Gastronomie und den ... Die Tischlerei Grömmer fertigt innovative designorientierte Möbel zum stilvollen Leben
groemmer.at Tischlerei Grömmer St. Roman Oberösterreich
223 F.Z. Möbelmontagen · flott Montage

Wir montieren Ihre Traummöbel in Tischlerqualität beraten aber auch gerne bei Einrichtungsproblemen jeglicher Art ... Art und planen auf Wunsch Ihr neues Möbel sogar millimetergenau und computerunterstützt! Dazu bieten
fz-montagen.at Montage Montagen Möbel Möbel
224 Agentur objekt direkt Andreu

Moebel Agentur fuer Oesterreich der Hersteller Andreu World Bla Station Indecasa Nanimarquina ... Indecasa Sellex Möbel Moebel Teppiche Stuehle Stuhl Stühle Sessel. Barhocker Gastronomiemöbel
objektdirekt.at Andreu World Bla Station Indecasa
225 Tischlerei Bucher GmbH tischlerei

F.Bucher Tischlerei Möbel für Wohnbereich Geschäft und Büro. Bauteile für Industrie Gewerbe ... von Zweckmäßigkeit und Gestaltung ist unsere oberste Maxime. Einzelmöbel Unsere Möbel sind Maßarbeit
fbucher-tischlerei.at Tischlerei Bucher F.bucher Fbucher
226 Home Antikbeimwasserturm antik

antikbeimwasserturm.de antike Möbel restaurationen abbeizen flechten 60siger Jahre Möbel Klassiker der 60 entwurmen polstern sandstrahlen ... machen zu können. Zur Zeit findet ein Räumungsverkauf statt. Auf m² bieten wir alle Möbel zu Sonderpreisen
antik-beim-wasserturm.at Antik Möbel Schrank Kommode Sekretär Tönisvorst Restauration
227 Eichenholz / Betten

Betten und Möbel in Eichenholz von Ihrem Tischler Profi geplant und realisiert
tischlerei-hutterer.at
228 Homestyle4u eShop | Wohnen Paravent

Alles zum Thema Möbel Einrichtung und Wohnaccessoires. Blitzschneller Versand.
homestyle4u.at Paravent Raumteiler Bambusbett Hochbett
229 Aktionen Javahouse Bradach Einrichtungs KG Javahouse
9081
Reifnitz am Wörthersee
Javahouse hochwertige Möbel aus Indonesien
javahouse.at Javahouse Java Indonesien Indonesia
230 Willkommen bei Tischlermeister Himmelstoss! Tischlermeister
9123
St. Primus
Tischlermeister Himmelstoss Tischlerei Möbel
tischlermeister-himmelstoss.at Tischlermeister Himmelstoss Tischlermeister Himmelstoss Tischler
231 Aktionen Javahouse Bradach Einrichtungs KG Javahouse
9081
Reifnitz am Wörthersee
Javahouse hochwertige Möbel aus Indonesien
baligazebo.at Javahouse Java Indonesien Indonesia
232 Home Tischlerei Kapsammer Home

Home. Tischlerei Kapsammer Tischlerei Kapsammer Möbel Moderne Möbel
kapsammer.at Home Tischlerei Kapsammer
233 Home Schmiede

geschmiedeter Stahl Niro Kupfer Messing und Corten traditionell und zeitgemäß am und ... Bildergalerie StartEinrichtungen - Möbel - Gitter - Tore - Grabzeichen - Treppen - Lichtobjekte
metallgestalter.at Schmiede Kunstschmiede Stahl Design Einrichtung Gestaltung Möbel Gitter
234 Moebeldesigner.at

... Thomas Fleihaus Möbel-Designer Home Services PARTNER Küchen Wohnen Bad Jugend Stiegen Schlafen
moebel-designer.at
235 Dental Service Wien Dentaleinheiten
2380
Perchtoldsdorf bei Wien
Dentaleinheiten Möbel Einrichtung für Zahnarztpraxis und Zahntechnikerpraxis Wien Dental Reparatur Service Wien
dental-service.at Dentaleinheiten Möbel Einrichtung Für Zahnarztpraxis Und Zahntechnikerpraxis
236 Beauty Gesundheit Artikel allaround

Finden Sie allaround shopArtikel in den eBay Shops sowie Beauty Gesundheit Möbel ... ) Handy Computer? Foto HiFi Heimwerker Garten Möbel Wohnen Party und Feiern (
all-around.at Allaround Shop Beauty Gesundheit Möbel
237 WERKSTUECK.AT Lampen

Werkstueck.at bietet Objektlösungen in den Bereichen Möbel Lampen und Accesoires.
werkstueck.at Lampen Möbel Accesoires
238 Fenster Türen Tischlerei Krismer GmbH & Co KG Schautischlerei
6460
Imst
Schautischler Krismer Imst Fenster Türen Küche Bad Maßmöbel Zimmer ... Unternehmen Team Kontakt Fenster Fenster nach Mass Türen Die Visitenkarte Möbel Wohnträume Küchen
krismer-imst.at Schautischlerei Krismer Imst Tirol
239 Www.tischlerhandwerk.at | Tischlerei Mathias Tischlerei

Tischlerei Mathias Fellner. Hochqualitative Möbel Design Möbel und mehr von Mathias Fellner.
handwerksregion.at Tischlerei Fellner Mathias Fellner Matthias Fellner
240 Möbel nach Maß dewitt
1110
Wien
The description of my page
xn--mbelnachmass-4ib.at Dewitt Maßmöbel Massmoebel Küche Kueche Wohnzimmer Badezimmer Büroeinrichtung
241 Tischlerei/SchreinereiMöbelKüchen Hamminger St.Johann a. Tischler

... Flash Tischlerei Schreiner Tischler Möbel Braunau Innviertel St.Johann Ried St.Johann Schlafzimmer
tischlerei-hamminger.at Tischler Oberösterreich Braunau St.Johann Tischlerei Schreinerei Tischlerei Schr
242 Startseite Möbi Wohndiskont Möbi Wohndiskont GmbH moebi
5020
Salzburg
Ihr günstiger Möbelabholmarkt in Salzburg und Lamprechtshausen! Möbel für alle Wohnbereiche auf über 3000 m². ... Haben Sie Lust in unseren aktuellen Prospekten zu blättern? Kein Problem. mehr lesen Onlineshop Möbel
moebi.at Moebi Wohnen Wohnideen Abholmarkt
243 Home IDEEN AUS Ideen

Ideen aus Holz Klaus Schallmeiner Ihr Tischler im Bezirk Gmunden. Möbel Stiegen ... und Möbel. INDIVIDUALITÄT Holz ist schon allein durch die Natur individuell. Kein Teil gleicht vollständig
ideenausholz.at Ideen Aus Holu Klaus Schallmeiner;Tischler Tischlerei
244 Startseite urbanek

Möbel für Dein Zuhause! Rund um Wohnen und Einrichten viele inspirierende Wohnideen. ... Verband. Die GARANT-MÖBEL-GRUPPE schafft ein enorm großes Einkaufsvolumen und damit Preisvorteile
moebel-urbanek.at Urbanek Urbanekmöbel Möbel Urbanek Moebel
245 Schnaeppchenhalle Möbel und Gartenmöbel Gartenmöbel

Im Lagerverkauf der Schnaeppchenhalle ist jeden Tag SALE! Moebel Restposten Konkurswaren und Gartenmoebel
xn--mbel-outlet-zentrum-q6b.at Gartenmöbel Billig Abverkauf Sienagarden
246 Startseite Hofmobiliendepot | Möbelmuseum
1070
Wien
Das Hofmobiliendepot. Möbel Museum Wien ist eine Rarität unter den Sehenswürdigkeiten Wiens und ein Geheimtipp: ... Hofmobiliendepot ? Möbel Museum Wien Öffnungszeiten Veranstaltungen im Hofmobiliendepot ? Möbel Museum Wien
hofmobiliendepot.at Möbelmuseum Biedermeier Möbeldepot Wiener Moderne
247 Tischleria /// Tischlermeister Jakober Holz
6133
Weerberg
Iht Tischlermeister in Tirol Holzmöbel nach Maß Designer Möbel Planung und Beratung ... Garderoben Kontakt Handwerksqualität auf höchstem Niveau ... Deine Vorteile! Persönliche Beratung Möbel
tischleria.at Holz Tischler Handarbeit Beratung
248 Meinkasten.at Möbel nach Heinz Stark GmbH Kasten
8502
Lannach
Möbel nach Maß. Made in Austria. Planen Sie Ihren Kasten nach Belieben und Bestellen Sie
meinkasten.at Kasten Küche Maßanfertigung Bestellen
249 Urlaubtipps für Ossiacher See Urlaub

Urlaubtipps Ossiachersee und Faakersee Einkauftipps Möbel und mehr.
bio-bauer.at Urlaub Ossiacher See Faaker See
250 HOME Antiquitäten
9220
Velden am Wörthersee
Antiquitäten Velden am Wörthersee Velden Geschenke Möbel Schmuck Skulpturen ... HOME STANDORT Postazione ANGEBOT Offerta MÖBEL Mobili SKULPTUREN Sculture BILDER Quadri
antiquitaeten-tsantilas.at Antiquitäten Antiques Renaissance Gotik
251 Premium Moebel

... Herzlich Willkommen bei Premium Möbel Ihr Partner für Exquisiten Möbelbau Restaurierungen
premiummoebel.at
252 Willkommen auf der Startseite Küche

Wir planen und fertigen für Sie: Möbel für den Wohnbereich Gaststätten Büros Haus ... und fertigen für Sie Möbel für den Wohnbereich Gaststätten Büros Haus- und Wohnungstüren. Außerdem verlegen
tischlerei-ecker.at Küche Wohnzimmer Esszimmer Schlafzimmer
253 Hutle Möbel | Tischlerei

Hutle Möbel | Tischlerei. Tischlerei mit Planungsbüro Werkstatt und Ausstellungshalle. Standord Dornbirn
hutle-moebel.at
254 Möbel vom Tischler

... Möbel vom Tischler - Paul Hanzlovic - Moosgasse - Zistersdorf - -
moebelvomtischler.at
255 :: trend:schrank | Günter trendschrank

trendschrank Möbel Koller
trendschrank.at Trendschrank Trendchrank.at Möbel Koller Moebel Koller Günter Koller
256 Start :: Bau und Tischlerwerkstätt
8010
Graz
Die Tischlerwerkstätte Vogl wird seit 60 Jahren nun in dritter Generation geführt. Unser Tätigkeitsbereich erstreckt ... bis hin zum Webshop für Möbel und Accesoires." Unsere Philosophie Der Kunde definiert durch seine Bedürfnisse
tischlereivogl.at Tischlerwerkstätte Ernst Vogl Renovierung
257 Rauscher Möbel Möbel


r-rauscher.at Möbel Wohnen Messen Dekor
258 Freund Naturholz Tischlerei Freund Naturholz Tischlerei GmbH & Co KG Freund
5771
Leogang
Nach dem Vorbild der Natur jedes unserer Möbel ist ein wertbeständiges Unikat. Fachmännische Meisterhände ... Nach dem Vorbild der Natur - jedes unserer Möbel ist ein wert-beständiges Unikat. Fachmännische Meisterhände
freund-naturholz.at Freund Tischlerei Möbelhandel Leogang
259 Rootpage Silz
6424
Silz
Strolz Tischlerei Silz Tirol Ihr Tischler Ing. Roman Strolz fertigt Ihre Möbel (Küche ... Tischlerei Strolz News Planung Referenzen Stellenangebote Ing. Roman Strolz Möbel
strolz-tischlerei.at Silz Tischlerei Silz Tischlerei Strolz Strolz Silz Tischlerei
260 Geschirr Gläser Mobiliar schokobrunnen
5020
Salzburg
Nonfood Catering Partyverleih Gläserverleih Salzburg Österreich Leihequipment Leihgeschirr Geschirrvermietung Mietgeschirr ... ... SpülmaschinenGeschirrspüler und Waschbecken MobiliarStühle - Tische - Lounge Möbel Hussen Mietwäsche Kaffeemaschinen
gastrostaff.at Schokobrunnen Champagnerbrunnen Partyverleihsalzburg Hussen Stehtischhussen Gläs
261 Paradis Küchen Paradis

Paradis Küchen möbel nach maß
paradiskuechen.at Paradis Paradis Paradisküchen Paradiskuechen Küchen
262 FOTOMOEBEL FotoMöbel

Möbel aus Österreich ... schnell fotographiert werden. Hier bedarf es vorab einer kompletten Montage. Einmal werden die Möbel
fotomoebel.at FotoMöbel Wohnmöbel Wohnzimmer Schränke
263 Baumkind Möbel aus Recyclingmaterialien

Möbel aus Recyclingmaterialien Möbelstücke aus Altpapier und Holz.. Sustainable Design aus Graz Upcycling
baumkind.at
264 Garten Möbel Home Mexiko 4 U, e.U. Mexiko
1070
Wien
Mexiko 4 U Wohn.der.Ware aus Mexiko! Wir wollen Ihnen unser geliebtes Mexiko näher bringen ... Fliesen Zubehör Geschirr Gläser Glaskrüge Lampen Möbel Holz Möbel Equipales Acapulco Sessel Stuhl
mexiko4u.at Mexiko Mexico Mex Mexiko 4
265 Alfred Dobnig Möbeldesign Alfred
8075
Hart bei Graz
Für Ihren individuellen Wohnstil bietet Ihnen Alfred Dobnig Möbeldesign handgefertigte Produkte und Möbel mit individuellem
alfred-dobnig-moebeldesign.at Alfred Dobnig Möbeldesign Handgefertigte Möbel Möbel
266 Tischlerei Karnische Massivmöbel Stuben Tischlerei

Ihr Profi für massive SchreinerQualität. Tischlerei Karnische Massiv Möbel Stuben Wohnzimmer Schlafzimmer Küchen Landhausküchen. ... massive Möbel Bei Stube Schlafzimmer Wohnzimmer Küche ist die Firma Karnische Massivmöbel GmbH
km-moebel.at Tischlerei Karnische Massivmöbel Stuben
267 MaasCenter Wien maas

Möbel | Haushaltswaren | Heimtextilen | Teppich ... ) + Wohnwand = Setpreis ?. Sitzgruppe ++ Sitzgruppe ++ ? MÖBEL
maas-center.at Maas Center Wien Möbel Sitzgruppen
268 Tischlerei Herbert Lorenz Möbel
8075
Hart bei Graz
Tischlerei Lorenz Möbel..Carports..Stiegen..Decken..
h-lorenz.at Möbel Stiegen Decken Carports
269 A E C Webverzeichnis

A E C LINKVERZEICHNIS ist ein redaktionell geführtes Verzeichnis mit Themen wie Kunst ... A E C - L I N K V E R Z E I C H N I S Surftipps Antiquitäten - Antike Möbel
aec-fallmann.at Webverzeichnis Linkverzeichnis Pagerank Linktausch Verzeichnisse Webkataloge Kun
270 Dekoverleih Wien/Österreich Deko

Verleih von Dekorationsartikeln wie z.B: Sesselhussen Kerzenständer Empfangsdekoration Geschirr Möbel ... Mein Konto Anmelden Möbel Vasen Geschirr Kerzenständer Empfangsdeko Dekomodelle Sesselhussen Säulen
dekoverleih.at Deko Dekor Dekoration Deko Wien Deko Österreich Deko
271 Möbelpolsterei Kneidinger aus Enns Möbel
4470
Enns
Möbelpolsterei Kneidinger in Enns bietet Leistungen im Bereich Möbel neu beziehen reparieren tapezieren ... Kneidinger in Enns bei Linz Wir polstern Ihr Möbel nach Ihren Wünschen auf und beziehen es neu
moebelpolsterei.at Möbel Neu Polstern Polstermöbel Tapezieren
272 WOHNEN nach MASS | Innenarchitektur

Ideen pro Quadratmeter Innenarchitektur und Handwerk | Interior Design Kantner Möbel und Innenausbau
wohnmass.at Innenarchitektur Wohnraumgestaltung Objektgestaltung Möbel Und
273 Heimat Gatto Möbel cms
1050
Wien
Content Management System ... Gatto Heimat . zur Möbel/Taschenaustellung . Online-Shop . Über Uns . Kontakt Gatto sagt hallo
gatto-moebel.at Cms Publish Ecommerce Content Management
274 Haider Möbel und Montagen
3300
Greinsfurth
... Startseite Firmenstruktur Projekte Partner Kontakt Haider Möbel Montagen HaiderMöbel Montagen
t-haider.at
275 DST möbel mobil |

... Sie werden gleich automatisch weitergeleitet zur Website von DST möbel mobil .
dst-moebel-mobil.at
276 Chesterfield leder sitzgarnitur sitzgarniur

Chesterfield möbel ... Ecksofa Schlafzimmer Möbel Stühlen Hocker Tisch Informationen Unsere AGB's ... Liefer- und Versandkosten
chesterfields.at Sitzgarniur Leder Sitzgarnitur Sofa Sessel
277 Lagerfäche.at Lagerflächen von Lagerfläche


lagerflaeche.at Lagerfläche Lagerflächen Lagerflaeche Lagerflaechen
278 LANDHAUSMÖBEL ACHAU Moebel

landhausmoebel achau moebel und accessoires rund ums wohnen
interantik.at Moebel Landhaus Achau Accessoires
279 Werkzeug zum Erfolg Gewerbe

Gradauer GmbH Lösungen für Sie: Im Werkzeug Formen und Maschinenbau in der ... - Formen- und Maschinenbau in der Möbel- Fenster- Türen und Küchenherstellung Papier- und Sägeindustrie
gradauer.at Gewerbe Industrie Metall Holz
280 MOEBEL KOLONIE Kolonialmöbel

... ... Sie werden weitergeleitet auf die Hauptseite der MOEBEL KOLONIE ... Alle Möbel Accessoires
moebelkolonie.at
281 Designerin ? ein Traumberuf? Designerin

Der Beruf der Designerin oder des Designers gilt für viele Menschen als Traumberuf kann ... verantwortlich Fotografien Filme und Webseiten aber auch Bekleidung Möbel Automobile Werkzeuge Schmuck
designerin.at Designerin Designer Design Gestalter
282 Möbel und Skulpturen |

... Direkt zum Inhalt Möbel Skulptur Projekte Kurt Foit News Links Kontakt
kurtfoit.at
283 Willkommen FZMoebel Moebel

Totalabverkauf von Möbel
fz-moebel.at Moebel Möbel Stuhl Stühle Tisch Kommoden Vitrinen Anrichten
284 Hybridmöbel online
3393
Matzleinsdorf
viole sind Hybridmöbel aus Stoff die bunt und individuelle gestaltete werden können. ... was das Besondere an viole ist Wohnen ist viel mehr als das bloße Aufstellen verschiedener Möbel
viole.at Online Möbel Onlinemöbel Möbel Online
285 Willkommen bei Möbel Manzl

... Willkommen bei Möbel Manzl Über Uns Seit der Firmengründung bietet Möbel Manzl eine perfekte
moebel-manzl.at
286 Kunsthandel Antiquitäten Rudolf Mahringer Kunsthandel

Kunsthandel Antiquitäten Mahringer Wien. Möbel Gemälde Skulpturen und Kunstgewerbe aus allen ... HOME NEWS MÖBEL GEMÄLDE KLEINKUNST SKULPTUREN VERKAUFS- U. SCHAURÄUME MESSEN KONTAKT english LEA
kunsthandel-mahringer.at Kunsthandel Antiquitäten Wien Österreich
287 Auflagen.at Stuhl

auflagen.at ... auflagen Please contact us for more information. Search the Web Stuhl Moebel Tisch Chairs
auflagen.at Stuhl Moebel Tisch Chairs
288 GRIESSENBERGER Kultur in Möbel

Kultur in Holz getreu dieser Firmenphilosophie wird jedes Möbel von Hand gefertigt...
griessenberger.at Möbel Design Designmöbel Tischlerei
289 Möbelservice Pfister Ihr moebel

Möbelservice aus Meisterhand Planung Ihrer Einrichtung fachgerechte und rasche Montage Ihrer Moebel ... Fachgerechte und rasche Montage Ihrer Möbel Bei mir erhältlich Garagentore · Dienstleistungen Zustellung
moebelservice.at Moebel Möbel Tischler Schreiner
290 Antiquitäten Figl Home Antiquitäten
1010
Wien
Familie Figl betreibt in dritter Generation den Antiquitätenhandel auf 3000 m² im Denkmalgeschützten Meierhof Plankenberg ... Sie in Ihrem Browser JavaScript aktivieren.> Home Plankenberg Wien Möbel Objekte Ankauf Ausstellung Vergangene
antikhof-figl.at Antiquitäten Handel Altwaren Verlassenschaften
291 Innenarchitekt für wohnen Innenarchitekt

Ideenpavillon ist der Innenarchitekt für alles rund ums Wohnen und Leben. Wir gestalten Büros
ideenpavillon.at Innenarchitekt Innenarchitektur Innenarchitekt Für Villen
292 Helmmoebel.at Informationen zum

helmmoebel.at ist Ihre erste und beste Informationsquelle über helmmoebel Hier finden Sie auch weitere
helm-moebel.at
293 Holzmöbel.at Informationen zum

holzmöbel.at ist Ihre erste und beste Informationsquelle über Möbel Hier finden Sie auch weitere
ww1.xn--holzmbel-r4a.at
294 Moebelshop.at Informationen zum

moebelshop.at ist Ihre erste und beste Informationsquelle über Möbel Hier finden Sie auch weitere
moebelshop.at
295 Wohnzimmermöbel.at Informationen zum

wohnzimmermöbel.at ist Ihre erste und beste Informationsquelle über Möbel Hier finden Sie auch weitere
ww1.xn--wohnzimmermbel-5pb.at
296 QUINTESSENCE Interior Design quintessence

quintessence interior design wien einrichtungsfachhandel quintessence interior design wien einrichtungsfachhandel geschmack schön tapeten einrichtung lampen ... CONSTRUCTION Ground Floor Britannia Rd. London PLANUNG DESIGN AUSFÜHRUNG SHOP BERATUNG STOFFE TAPETEN MÖBEL
quintessence.co.at Quintessence Interior Design Wien Einrichtungsfachhandel Geschmack Schön Tapeten
297 Tischlerei Johann Hengsberger
8543
St. Martin i.S.
Wir schaffen Möbel fürs Leben ... Startseite Betrieb Bereiche Besonderheiten Bildergalerie Kontakt Wir schaffen Möbel fürs Leben
tischlerei-hengsberger.at
298 Hauser möbel design

... Die Firma Hauser-Möbel-Design wurde gegründet. Das Ziel war schon damals hochwertige Möbel
hauserdesign.at
299 Szapacs Design

... =>> Hier geht es zu den Seiten von Szapacs - Design - Möbel =>> Gerhard Szapacs Schulstraße
s-d-m.at
300 EVA Energetisch Veredelte Zirbe
5452
Pfarrwerfen
Energetisch Veredelte Artikel Energetisch Verarbeitetes Arvenholz Energetische Möbel Energetische Arbeit
eva-shop.at Zirbe Zirbenholz Möbel Zirbenmöbel
301 Schlafwelt24.at Informationen zum

schlafwelt24.at ist Ihre erste und beste Informationsquelle über Moebel Möbel Einrichtung home Sessel Sofa ... schlafwelt.at Weitere Links Der Inhaber dieser Domain parkt diese beim Domain-Parking-Programm
schlafwelt24.at
302 Wohnexperte24.at Informationen zum

wohnexperte24.at ist Ihre erste und beste Informationsquelle über Moebel Möbel Einrichtung home Sessel Sofa ... Domain erwerben Sie können die Domain wohnexperte.at kaufen! wohnexperte.at Weitere Links
wohnexperte24.at
303 Antik Möbel Markt (Gerhard

... Antik Möbel Markt Gerhard Mayrhofer Oberwolfern Wolfern + +
antikmoebelmarkt.at
304 Möbel Innenausbau

... Möbel Mitter - design and more Wohnung - Einrichtung Bambus Stühle Barhocker
moebel.co.at
305 Möbel und Accessoires /

... Die Liste der Produkte von A bis Z Möbel Mitter Übersicht alphabetisch geordnet Accessoires
xn--mbel-5qa.or.at
306 Holzmedia_Möbel und Medientechnik_© 2005 Holzmedia

Holzmedia verbindet Möbel und Medientechnik. Zwei Komponenten die zusammen in der Synergie ganz neue ... Holzmedia verbindet Möbel und Medientechnik. Zwei Komponenten die zusammen in der Synergie ganz
holzmedia.at Holzmedia Holzmedia GmbH Manuel Holz
307 Startseite

Altmoebel.at die Lösung für die Möbel ... Startseite Auspolsterung Moderne Möbel Antike und alte Möbel Tischler Werke Küchenmöbel Büromöbel
altmoebel.at
308 Steiner Möbel | Kindergarten Steiner Möbel GmbH
4644
Scharnstein
... Workshop Raumgestaltung "Angelika von der Beek" ... Steiner Möbel GmbH Badstraße Scharnstein tel
steiner-moebel.at
309 Dirnbauer Möbel /

... und Partner Referenzen Dirnbauer GmbH Möbel und Design seit Studenzen Steiermark T + (
dirnbauermoebel.at
310 Chicantiques vintage möbel

... chicantiques vintage living möbel accessoires zur freude was bieten wir? gelebtes
chicantiques.at
311 Dirnbauer Möbel /

... und Partner Referenzen Dirnbauer GmbH Möbel und Design seit Studenzen Steiermark T + (
studiof.at
312 Modul Möbel: Home

... Bildergalerie Anfrage Kontakt Bereit für Veränderungen Modul Möbel Wolfschwenger .-Oktober-
modul-moebel.at
313 Rauchenzauner Möbel GmbH Rauchenzauner Möbel GmbH
4890
Frankenmarkt
... Rauchenzauner Möbel GmbH Mühlberg Frankenmarkt Austria officerauchenzauner
rauchenzauner.at
314 Bambusshop 24 bambus
1100
Wien
Möbel Dekoration und Accessoires aus Bambus und Rattan. Riesige Auswahl im Online Shop. Exklusive ... bei Bambusshop.at Wohnaccessories Gartenaccessories Schutzanstrich Stein im Garten Mehr
bambusshop24.at Bambus Shop Onlineshop Möbel
315 Tischlerei Zeibich Home tischler
1160
Wien
Die Tischlerei Zeibich GmbH ist ein moderner Produktionsbetrieb für Möbel Ladenbau und Messebau. CAD ... zählen wir zu den führenden österreichischen Produzenten im Möbel- Laden- und Messebau
zeibich.at Tischler Wien Burgenland Neutal
316 Stilwerkstatt Tischlerei Leberbauer Restauration

Stilwerkstatt Alte Möbel neu entdecken | Tischlerei Leberbauer
stilwerkstatt.at Restauration Ergänzungen Neuanfertigungen Schellack
317 BiogasTraktor Leberbauer David Restauration

Stilwerkstatt Alte Möbel neu entdecken | Tischlerei Leberbauer
biogastraktor.at Restauration Ergänzungen Neuanfertigungen Schellack
318 Bau und MöbelTischlerei Mühlbacher Eckbank

Bau und Möbeltischlerei Mühlbacher OEG in Weyregg am Attersee ist Ihr Ansprechpartner für maßgefertigte Möbelstücke
tischlerei-muehlbacher.at Eckbank Kasten Türen Fenster
319 KSart.at Metallkunst Metalldesign KSart
3051
St. Christophen
Auf unserer Homepage sehen Sie einen Querschnitt unserer Produkte. Wir fertigen unter anderem Möbel ... darf. Ich fertige unter anderem Möbel Brunnen Feuerstellen Skulpturen Trophäen Pokale Tore
ksart.at KSart Metallkunst Metalldesign Wienerwald Kinastberger Metal Art Kunsthandwerk
320 ULRICH sitzen.schlafen.wohnen Hüsler Hüsler

Seit 1989 fertigen wir in unserer eigenen Holzwerkstatt formschöne schlichte Möbel aus dem Urmaterial ... Unternehmen Team Kontakt T + www.dasbett Startseite Möbel Schlafen Sitzen Aktuelles
das-bett.at Hüsler Nest Möbel Ulrich Viktor Ulrich
321 LAMA MOEBEL | Holzmanufaktur

... LAMA MOEBEL Holzmanufaktur MARTIN LACKNER Schwarzensee A- Neuhaus tel +
lamamoebel.at
322 Möbel Garschall Home

... Rutsch ins Neue Jahr! design by joomladress About joomladress Möbel Garschall Joomla! is
moebel-garschall.at
323 Ambiente Romana Dürner accessories

Hochwertige Stoffe für Möbel Vorhänge und Dekoration sowie Polstermöbel Kleinmöbel und Accessories.
duerner.at Accessories Ambiente Duerner Dürner
324 TISCHLERARBEITEN UND MÖBEL AUS

... wirtschaftlich sein müssen. Fenster Fussböden Treppen TISCHLERARBEITEN UND MÖBEL AUS MEISTERHAND HERZLICH
ihr-tischler.at
325 Möbel für Terrasse und Teakmöbel

Gartenmöbel aus Dänemark sind bekannt für edles Design und Witterungbeständigkeit teakgartenmoebel ... zu teakgartenmoebel Möbel für Terrasse und Garten Infos zu teakgartenmoebel Teakmöbel Gartenmöbel aus Dänemark
gartenmoebel-onlineshop.at Teakmöbel Terrasse Gartenstuhl Gartentisch
326 BOTZ // AGENTUR FÜR LICHT UND MÖBEL
1080
Wien
... botzagentur für licht und möbel Ihr Browser kann leider
botz.at
327 CASA Möbel mehr

... Bettenkollektion bei CASA Coole Möbel für alle Anlässe freistil Kollektion bei CASA HAY - About A Lounge Chair CASA
casamoebel.at
328 Bueromoebel.at Informationen zum

bueromoebel.at ist Ihre erste und beste Informationsquelle über bueromoebel Hier finden Sie auch weitere
buero-moebel.at
329 Gebrauchtemoebel.at Informationen zum

gebrauchtemoebel.at ist Ihre erste und beste Informationsquelle über gebrauchtemoebel Hier finden Sie auch weitere
gebrauchte-moebel.at
330 Sitzmoebel.at Informationen zum

sitzmoebel.at ist Ihre erste und beste Informationsquelle über sitzmoebel Hier finden Sie auch weitere
sitz-moebel.at
331 Massivmöbel.at Informationen zum

massivmöbel.at ist Ihre erste und beste Informationsquelle über massivmöbel Hier finden Sie auch weitere
xn--massiv-mbel-yfb.at
332 Designermöbel.at Informationen zum

designermöbel.at ist Ihre erste und beste Informationsquelle über Design möbel Hier finden Sie auch
xn--designer-mbel-rmb.at
333 Euromontage.at Herzlich willkommen Euromontage

Euromontage Herbert Battlogg Fachkundige Möbel u. KüchenMontage Herstellung u. Montage von Treppengeländer
euromontage.at Euromontage Herbert Battlogg Fachkundige Möbel U. KüchenMontage Herstellung
334 Up.ART.ig by ma|ma GmbH up.ART.ig

up.ART.ig by ma|ma GmbH Das virtuelle Kunstressort Möbel Wandskulpturen Skulpturen
upartig.at Up.ART.ig Upartig Kunstressort Möbel
335 Hotelmöbelgruppe Home | Hotel
6300
Wörgl
Hotel Möbel HMG Hotelmöbelgruppe Hotelzimmer Hoteleinrichtung Hotelmöbelgruppe Die Objekt Hoteleinrichter in Tirol
hotelmoebelgruppe.at Hotel Möbel HMG Hotelmöbelgruppe Hotelzimmer Hoteleinrichtung
336 Ferrocom Möbel in Biedermannsdorf

... Sonderangebote Messetermine Bezugstoffe Downloads Anfahrt Kontakt Herzlich willkommen bei Ferrocom - Möbel! Seit
ferrocom.at
337 Holzmugl Möbel und Holzmöbel
8605
Pogier
Wir bauen ganz eigene Möbelstücke als Unikate aus Holz für wertorientierte Kunden. ... Sie sich ein neues Lebensgefühl dank hochwertiger Echtholzmöbel. Individuelle und maßgefertigte Möbel- bzw
holzmugl.at Holzmöbel Möbelstücke Wunschmöbel Individuelle Kunststücke
338 Clemens moshammer | raum+möbel

clemens moshammer | ingenieur für möbeldisigntischlermeister | wir beraten sie gerne unverbindlich und planen auf ... führen wir u. a. küchen möbel und accessoires folgender marken next küchen next line küchen
raumplusmoebel.at
339 Home flowolf Montage
6552
Tobadill
... meine vielfalt - ihr vorteil Home Über Florian Wolf Hausmeister Möbel Montage Kontakt Partner
flowolf.at
340 Home ocean wood

... ocean wood ? möbel aus booten home shop alle produkte tische und sessel wohnmöbel boot kollektion
oceanwood.at
341 Dagmar Fezzi |Innenarchitektur Dagmar
8010
Graz
Innenarchitektur Inneneinrichtung Raumgestaltung Büromöbel Objekteinrichtungen Einrichtungskonzepte Wohnideen Innenausbau DesignMöbel Planungsbüro MöbelDesign Einrichtungen Raumausstattung Raumplanung Wohnidee
dagmarfezzi.at Dagmar Fezzi Ist Ihr Partner In Sachen Wohnen
342 Designleuchten Designmöbel schöner wohnen beluga
9020
Klagenfurt
Design Leuchten Kartell Möbel TimeoutGraf Shop Graf Licht Kartell Möbel
i-punkt.at Beluga Cubetto Designlampen Designmoebel
343 Gastronomie Möbel / Möbel

... Gastronomie Möbel Möbel für die Gastronomie Möbel für die Gastronomie bzw. Gastronomiemöbel
gastronomie-moebel.at
344 Design Sottsass Colombo Mendini Design

italienisches Design Möbel Glas Keramik Lampen und Objekte Stücke von: ... ." Diese Seite informiert vor allem über die Klassiker des italienischen Designs Möbel
designklassiker.at Design Möbel Verkauf Shop
345 Home
6444
Längenfeld
Fenster und Möbel nach Maß ... MÖBEL UND FENSTER NACH MASS Willkommen in der Fachwerkstätte für Massarbeit und exklusiven Innenausbau
industrieinfo.at
346 Wohnkram Salzburg Gnigl
5023
Salzburg Gnigl
... Geöffnet ist jeden Dienstag und Freitag von . bis . Uhr. wohnkram Salzburg - Gnigl Möbel
wohnkram.at
347 Antike Fundgrube Antikstube: Antik Antik

Die Website der Antiken Fundgrube in Gronau. Hier finden Sie Antiquitäten aller Art. Ob Antike
antikstube.at Antik Antikmöbel Packmor Antike Fundgrube
348 Bauund Möbeltischler Klaudius Tischler

Bau und Möbeltischler in der 3. Generation Spezialist für Hotelerie und Gastgewerbe Design und
klaudius.at Tischler Tischlermeister Schreiner Schreinereibetieb Möbel Einrichtung Spezialmö
349 Walli Gartenmöbel Pavillon Garten Gartenmöbel
2832
Thernberg NÖ
Walli natürlich Holz Gartenmöbel Wohn und Freizeitmöbel für Haus und Garten
walli.co.at Gartenmöbel Walli Holz Möbel
350 Möbel Infos Einrichtungsgegenstände

... Möbel Infos Informationen zum schöneren Wohnen Möbel Infos Einrichtungsgegenstände können mehr
moebel-infos.at
351 Farbenfachmarkt Hinterholzer Farben Farbenfachmarkt

Farbenfachmarkt Hinterholzer Farben Lacke Innenbereich Aussenbereich Holzveredelung Wohnraum Möbel Holzbodenversiegelung Silikat Wohnraumfarben Feuchtigkeit
farben-hinterholzer.at Farbenfachmarkt Hinterholzer Farben Lacke
352 FlügelPianotransporte Startseite Piano

Transporte von Klavier Pianos Möbel Trsoren Flügel usw.
pianotransporte.at Piano Pianino Flügel Stutzflügel Konzertflügel Cembolo EPiano Möbel
353 Tischlerei Gansger tischlereigansger
5440
Golling
Nach eigenen Wünschen gestaltete Möbel spiegeln die Persönlichkeit des Nutzers wieder und sind genauso unverwechselbar ... gestaltete Möbel spiegeln die Persönlichkeit des Nutzers wieder und sind genauso unverwechselbar
tischlerei-gansger.at Tischlereigansger Tischlereigansger.at Tischler Gansger Günther
354 Möbel Pienz | Wir

... Kindermöbelprogramm Fenster Türen Referenzen Galerie Anfahrt Lage Kontakt Möbel Pienz Wir geben Ihren Visionen
meistertischler-pienz.at
355 Stefanik GmbH Stefanik

Stefanik Bau und Möbeltischlerei ... Neuverlegung Möbel Montage Demontage Reparatur Einzelanfertigung
stefanik.at Stefanik Tischlerei Bau Möbel
356 Schrotttec Spatz

Spatz Reindesign Schrotty Trash Möbel Design Tonne Aliens Furniture
spatz-reindesign.at Spatz Reindesign Schrotty Trash Möbel
357 Tischlerei Mayerhofer Holz

Bau und Möbeltischlerei. Handgefertigte Möbel kreativ und kompetent nach Ihren Wünschen umgesetzt.
tischlerei-mayerhofer.at Holz Möbeltischler Möbeltischlerei Josef MAYERHOFER Bautischler Bautischlerei Mö
358 Www.reichelwohndesign.at Wohndesign

Reichel Wohndesign ... Hauptmenü Startseite Unternehmen Produkte Möbel Referenzen Anfragen Kontakt News Neuheiten Login
reichel-wohndesign.at Wohndesign Reichel Raumkonzept Möbel
359 Holzwerkstatt Sarleinsbach GmbH Bad

hochwertige Möbel Planung und Bau individueller Inneneinrichtung Wohnzimmer Küche Schlafzimmer
holzwerkstatt.at Bad Büro Esszimmer Jugendzimmer
360 Tischlerei Kalhamer Tischlerei Kalham

Website der Tischlerei Kalhamer Mattsee Spezialist in der Herstellung von Fenstern und Türen sowie diverser
kalhamer.at Tischlerei Kalhamer Mattsee Türen Fenster Möbel Holz HolzAlu Alu
361 AW Pfeffer Herzlich A&W Pfeffer GmbH Bibliothekseinric
2371
Hinterbrühl
Die AW Pfeffer GmbH bietet Ihnen Möbel für Ihre Büroeinrichtung sowie ergonomische Sitzmöbel für Ihre
awpfeffer.at Bibliothekseinrichtung Nichtraucherschutz Büroeinrichtung Heizsysteme
362 Tischlerei Krumphuber Unternehmen Krumphuber

Die Tischlerei Krumphuber fertigt seit 1997 Inneneinrichtungen und Einzelmöbel nach Maß an. Individuell und funktionell gleichermaßen. ... die Gestaltung unserer Möbel den persönlichen Stil des Kunden unterstreicht. Um auf die verschiedensten
krumphuber.at Krumphuber Johann Tischlerei Tischler Grossendorf
363 Jugendstil Art Deco Jugendstil

 Jugendstil Art Deco | Amstetten. Erstklassig restaurierte Möbel und Lampen von 1900 bis 1930.
jugendstil-artdeco.at Jugendstil Art Deco Jugendstil Art Deco
364 Tischlerei Murauer Möbeltischlerei Tischlerei

Wir fertigen nicht nur hochwertige und einzigartige Möbel an sondern sorgen für die komplette
tischler-murauer.at Tischlerei Tischlereien Möbel Wohnraum
365 Gastronomiemöbel Gastromöbel Polsterbank

Wir bieten Gastronomieeinrichtung Polsterbank Stehtisch Holztisch Gastronomie Bank Gastronomie Möbel ... willkommen bei -GASTRO Ihrem Gastronomie Möbel Shop. Polsterstühle Holzstühle Finden
bankett-outdoor-moebel.at Polsterbank Polsterbank Günstig Kaufen Gastronomie Möbel
366 Möbel polt – Einrichtungshaus

... Unternehmensgeschichte Tischlerei Kontakt Kontakt Anfahrt Ansprechpartner Einrichtungshaus Tischlerei möbel
moebelpolt.at
367 Lesky : Tischler Graz Tischler
8042
Graz
Die Lesky Stiegen Wohnwerkstatt ist Ihre innovative Tischlerei Graz Voitsberg und baut auch
lesky.at Tischler Graz Voitsberg Möbel Stiegen
368 Antiquitaeten Moebel antiquitaeten

Kunsthandel Antiquitäten Möbel aller Stilepochen antike Kachelöfen Bilder Lampen
antiquitaeten-kral.at Antiquitaeten Antik Antiquitaeten Mobel
369 Bauernsessel Bauernstühle
6070
Ampass
... Bauernvitrinen VERSCHIEDENE MÖBEL HISTORISCHE BAUSTOFFE bemalte Bauernmöbel Schützenscheiben Geschäftsbedingungen
rustikal.at
370 Umzug Wien Umzüege umzugsunternehmen

umzug umzug nach umzugshilfe internationaler umzug kosten umzug möbel umzug ... . Möbel n die passenden Verpackung smaterialien. Das Müll das beim Umziehen auftaucht ist leider
umzug4you.at Umzugsunternehmen Umzugshilfe Umzug Umziehen
371 Exklusives Intereieur Exterieur

... ??????? ?? ANTIK-MÖBEL-HESZ LUXUS DER WERTE SCHAFFT. Erlesen Mondän. Exquisite Objekte
hesz.at
372 JOHAN Möbel Natur.
1070
Wien
JOHAN ist zeitloses Design in charismatischer Farb und Formensprache. Authentisch funktionell und natürlich bringt ... Möbel- und Innenausbau vertieft er über Jahre seine Kenntnisse in Planung Abwicklung
johan-wohnen.at
373 Betont. betont
8010
Graz
Das steirische Künstlerkollektiv BETONT widmet sich der Gestaltung von Möbeln und Inneneinrichtungen aus Beton. ... werden. Durch innovativen Formenbau Variationen der Rezeptur und präzise Oberflächenbehandlung entstehen Möbel mit Charme
betont.at Betont Möbel Inneneinrichtung Beton
374 Firma Wolfgang Ungerank Handwerk
6143
Mühlbachl
Einer für (fast) alles ... ich ihnen noch Komplettprogramme von der Demontage der alten Möbel über Trockenbau Malerarbeiten Laminat-Parkettbodenverlegung
zirbenstueberl.at Handwerk Tischler Zirbe Möbel
375 Tischlerei Dreier Bludenz Bürs cad

tischlerei dreier ihr partner für moebel fester küchen innenausbau stiegen
dreier-tischlerei.at Cad Cad Planung Tischlerei Tischler Schreinerei
376 Galanterie_loft21_meineLieblingssachen galanterie

Sabine Zellinger Mode Möbel Schmuck Accessoires Online Präsentation
galanterie.at Galanterie Loft21 Loft 21
377 Derwohndesigner Home Wohnberatung
5230
Mattighofen
Der Wohndesigner ist eine online Wohnberatung und Einrichtungsberatung. Erfahren sie hier wie sie mit einfachen ... Neuanschaffungen einfach nur durch Umdekorieren ihrer eigenen Möbel. Hier und da eine kleine Veränderung eventuell
der-wohndesigner.at Wohnberatung OnlineWohnberatung Innenarchitekt Einrichtungsberatung Einricht
378 Offlimit Storage Lagerboxen in Offlimit

Offlimit Storage Lagerboxen in Deutschwagram Self Storage Lager zu mieten Lagerraum selfstorage self storage wien ... möbellagerung archiv deutsch wagram umzug lager wien zwischenlager storage aktenlagerung möbel einlagern Home
offlimit-storage.at Offlimit Storage Lagerboxen In Deutschwagram Self Storage Lager
379 Diamant's Aktionshalle Wetten Joka

In der Aktionshalle erhalten Sie preisgünstige Einrichtungsgegenstände MöbelRestposten und MöbelAusstellungsstücke für den kompletten Wohnbereich
aktionshalle.at Joka Hasag Optimo Ada
380 DIOGENES NEW LINE

... des ganz Besonderen. ...eben Möbel wie guter Wein
helmut-pramstaller.at
381 Abitare · Design
5020
Salzburg
... Möbel Design Handwerk Technisches Büro Service Suchbegriff Möbel Küche Wohnen Essbereich Wohnbereich
abitare.at
382 Andreas Jagersberger ? Küchenplanung
2733
Schrattenbach
... Andreas Jagersberger Startseite Partner Referenzen Möbel Fenster Türen Tore Sonnen
jagersberger.co.at
383 Lifestyle Design panoptima

... SAUNABAU > Modernes und individuelles Design ZIRBENHOLZ MÖBEL > Betten > Schlafzimmer Möbel
lifestyle-and-design.at Panoptima Dubovy Zirbenholz Möbel
384 Gupfinger Möbelwerkstätte und Einrichtungsstudio Gupfinger

Gupfinger Möbelwerkstätte und Einrichtungsstudio ... Möbel Gupfinger Ges.m.b.H Wiesenharterstraße St. Marienkirchen ++ - -
gupfinger.at Gupfinger Möbel Möbelwerkstätte Einrichtungsstudio
385 Jetlag Salzburg Vintage

Das Jetlag in der Salzburger Herrengasse ist ein VintageLaden kombiniert mit einem Cafe in
jetlag.at
386 Migora Bambusparkett Michelitsch
8020
Graz
... Neu im Programm - Möbel aus Bambus! Überzeugen Sie sich von unseren neuen Bambus Möbel
migora.at
387 Tischler Fritz Tischlerei Tischler

Tischler Fritz Montageservice entwirft baut und montiert Möbel aller Art. Küchen Anrichten
tischlerfritz.at Tischler Tischler Fritz Montageservice Möbel
388 Selfstorage Lagerraum mieten selfstorage

Bei Safe Self Storage finden Sie Ihren günstigen Lagerraum in Wien um Ihre Möbel einzulagern ... labore et dolore magna aliquyam erat sed diam voluptua. At vero eos et accusam et justo duo dolores et
safeselfstorage.at Selfstorage Wien Self Storage Wien Selfstorage
389 Hagen Möbel |Tischlerei |TischlereiMeisterbetrieb|Küchenherstellung|
6890
Lustenau
... hagen möbel tischlereimeisterbetrieb Web Buttons Maker by Vista-Buttons v. NEWSBEREICH .
hagen-kuechen.at
390 Wohnskulptur Wolfgang Wallner Möbel
6060
Hall in Tirol
Wohnskulpturen ... Wolfgang Wallner Wohnskulpturen Licht Möbel Kunst Wolfgang Wallner Anmelden Jimdo-Logout
wolfgang-wallner.at Möbel Lichtobjekt Vintage Skulptur
391 Glaserei Dobie glasklare Dobie Innenbau OG Glaserei
2320
Schwechat
Glaserei Schwechat Wien Reparatur Dusche Türe Notdienst Möbel
dobieglas.at Glaserei Schwechat Wien Reparatur
392 DieTischlerei bei uns Tischler

Wir möchten Ihnen gerne einen Überblick über unser Schaffen geben. Wir lieben Holz und machen
dietischlerei.at Tischler Tischlerei Holzverarbeitung Möbel
393 Tischlerei Waibl: Einrichtung wie Tischlerei
6460
Imst - AUSTRIA
Tischlerei Waibl Ihr Tischler in Imst / Tirol. Gründe warum auch Sie sich für ... dass man zur Verfügung hat. Theodor Storm Warum Möbel und Türen vom Tischler? Tischlerei Waibl aus Imst
harald-waibl.at Tischlerei Tirol Tischlerei Imst Türen
394 Wsdesign Startseite Möbel

Möbelhandel und Tischlerei ... Wolfgang Sturany Möbel für Ihr Zuhause Startseite Galerie Philosophie Leistungen Kontakt
ws-design.at Möbel Designmöbel Wolfgang Sturany Tischlerei
395 Tischlerei Moebel Scheiber GmbH

... Möbel Scheiber GmbH Co KG Leogang Nr. -
moebel-scheiber.at
396 Antike Möbel liebevoll aufbereitet

Die Antikmöbel Spezialisten Gölles Valda in Riegersburg hauchen Antiquitäten liebevoll und professionell neues Leben ein. ... Ihr Spezialist für antike Möbel Mein Konto Sitemap Toggle navigation Home Antikshop
ablaugen-abbeizen-restaurieren.at
397 Wohndesign Preissl Inovatives möbel

Möbel die Begeistern von Ihrem Einrichtungsspezialisten. Persönliche Beratung wird von uns grossgeschrieben. Wir erstellen für
preissl-moebel.at Möbel Moebel Einrichtung Einrichtungsmöbel
398 Einrichtungspartnerring Sofas Einrichtungspartnerring VME GmbH & Co. KG Möbel
33699
Bielefeld
Ob Wohn oder Esszimmer Schlafraum Kinderzimmer oder Küche: Beim Einrichtungspartnerring finden Sie aktuelle
comfortmaster.at Möbel Wohnmöbel Polster Esszimmer Garderoben Kleinmöbel Kinder Und
399 Kröner Scholz Concept Austria

Bregenz Shopping Kröner Scholz Furniture Lifestyle Shopping Beauty Accessoires Möbel Einrichtung Glas Porzellan Bregenz
kroener-scholz.at Austria Bodensee Bregenz Einkaufen
400 Einrichtungspartnerring Sofas Einrichtungspartnerring VME GmbH & Co. KG Möbel
33699
Bielefeld
Ob Wohn oder Esszimmer Schlafraum Kinderzimmer oder Küche: Beim Einrichtungspartnerring finden Sie aktuelle
clever-clean.at Möbel Wohnmöbel Polster Esszimmer Garderoben Kleinmöbel Kinder Und
401 Kopfstand mobiliar: designmoebel kopfstand

kopfstandmobiliar gmbh ausstattungsservice fuer messen: designmoebel mieten und kaufen fuer messen events ... OF EVENTS · visit us at BEST OF EVENTS zuständig für möbelkultur auf messen und events info
design-moebel.at Kopfstand Mobiliar Design Moebel Mieten
402 Einrichtungspartnerring Sofas Einrichtungspartnerring VME GmbH & Co. KG Möbel
33699
Bielefeld
Ob Wohn oder Esszimmer Schlafraum Kinderzimmer oder Küche: Beim Einrichtungspartnerring finden Sie aktuelle
enzo-baresi.at Möbel Wohnmöbel Polster Esszimmer Garderoben Kleinmöbel Kinder Und
403 HW Büro Design GmbH hochwertige

hochwertige Möbel Büromöbel Büroeinrichtung Bürostühle Drehstühle Chefsessel Drehstuhl
buero-design.at Hochwertige Möbel Büromöbel Büroeinrichtung Bürostühle
404 Einrichtungspartnerring Sofas Einrichtungspartnerring VME GmbH & Co. KG Möbel
33699
Bielefeld
Ob Wohn oder Esszimmer Schlafraum Kinderzimmer oder Küche: Beim Einrichtungspartnerring finden Sie aktuelle
cleverclean.at Möbel Wohnmöbel Polster Esszimmer Garderoben Kleinmöbel Kinder Und
405 Tischlerei Schwingenschlögl :: HOME Bau
3874
Litschau
Bau und Möbeltischlerei Tischler Innenausbau Maßmöbel Tischlerei Möbel Einzelanfertigung Vollholzmöbel Echtholzmöbel Niederösterreich Waldviertel
schwingenschloegl.at Bau Und Möbeltischlerei Tischler Innenausbau
406 Kopfstand mobiliar: designmoebel kopfstand

kopfstandmobiliar gmbh ausstattungsservice fuer messen: designmoebel mieten und kaufen fuer messen events ... OF EVENTS · visit us at BEST OF EVENTS zuständig für möbelkultur auf messen und events info
kopfstandmoebel.at Kopfstand Mobiliar Design Moebel Mieten
407 Einrichtungspartnerring Sofas Einrichtungspartnerring VME GmbH & Co. KG Möbel
33699
Bielefeld
Ob Wohn oder Esszimmer Schlafraum Kinderzimmer oder Küche: Beim Einrichtungspartnerring finden Sie aktuelle
lavie-moebel.at Möbel Wohnmöbel Polster Esszimmer Garderoben Kleinmöbel Kinder Und
408 Kopfstand mobiliar: designmoebel kopfstand

kopfstandmobiliar gmbh ausstattungsservice fuer messen: designmoebel mieten und kaufen fuer messen events ... OF EVENTS · visit us at BEST OF EVENTS zuständig für möbelkultur auf messen und events info
xn--kopfstand-mbel-5pb.at Kopfstand Mobiliar Design Moebel Mieten
409 Einrichtungspartnerring Sofas Einrichtungspartnerring VME GmbH & Co. KG Möbel
33699
Bielefeld
Ob Wohn oder Esszimmer Schlafraum Kinderzimmer oder Küche: Beim Einrichtungspartnerring finden Sie aktuelle
young-citizen.at Möbel Wohnmöbel Polster Esszimmer Garderoben Kleinmöbel Kinder Und
410 Kopfstand mobiliar: designmoebel kopfstand

kopfstandmobiliar gmbh ausstattungsservice fuer messen: designmoebel mieten und kaufen fuer messen events ... OF EVENTS · visit us at BEST OF EVENTS zuständig für möbelkultur auf messen und events info
miet-moebel.at Kopfstand Mobiliar Design Moebel Mieten
411 Einrichtungspartnerring Sofas Einrichtungspartnerring VME GmbH & Co. KG Möbel
33699
Bielefeld
Ob Wohn oder Esszimmer Schlafraum Kinderzimmer oder Küche: Beim Einrichtungspartnerring finden Sie aktuelle
moebel-partner-ring.at Möbel Wohnmöbel Polster Esszimmer Garderoben Kleinmöbel Kinder Und
412 Kopfstand mobiliar: designmoebel kopfstand

kopfstandmobiliar gmbh ausstattungsservice fuer messen: designmoebel mieten und kaufen fuer messen events ... OF EVENTS · visit us at BEST OF EVENTS zuständig für möbelkultur auf messen und events info
xn--design-mbel-yfb.at Kopfstand Mobiliar Design Moebel Mieten
413 Einrichtungspartnerring Sofas Einrichtungspartnerring VME GmbH & Co. KG Möbel
33699
Bielefeld
Ob Wohn oder Esszimmer Schlafraum Kinderzimmer oder Küche: Beim Einrichtungspartnerring finden Sie aktuelle
youngcitizen.at Möbel Wohnmöbel Polster Esszimmer Garderoben Kleinmöbel Kinder Und
414 Sodemann rihacek: moöbel design sodemann

sodemann rihacek: möbel design Tischlerei Wien Benjamin Sodemann Emanuel Rihacek Grüntorgasse
sodemann.at Sodemann Rihacek Möbel Design Tischlerei
415 Bau und Möbeltischlerei Mattle Bautischlerei

Die Bau und Möbeltischlerei in Galtür Firma Mattle ist der Profi rund um Möbel
tischlerei-mattle.at Bautischlerei Möbeltischlerei Küchenstudio Fenster
416 Andreas huelber Furniture

Single pieces and small series of socalled furniture; usable sometimes practical primarily powerful. ... geb. Möbel- Grafik- Webdesigner; derzeit hauptsächlich in der Agentur orange moon tätig
huelber.at Furniture Möbel Interior Einrichtung
417 LIDAUER Tischlerei GmbH Scharnstein

... LIDAUER Tischlerei GmbH Scharnstein - Exklusive Möbel Ladenbau Oberösterreich Österreich Unsere
lidauer.at
418 Einrichtung Raumaustatter Raffetseder Raumaustatter

Ein Komplettausstatter für alle Wohnbereiche? Raffetseder wird´s einrichten. ... ? Raffetseder wird´s einrichten Möbel fürs Leben. Die passende Gestaltung des Eigenheims schafft Lebensfreude
raffetseder-moebel.at Raumaustatter Möbel Accessoires Wohnen Möbel Einrichtung Planung Pöchlarn
419 Home | Helmut Walter

... Tischler Walgau Tischler Vorarlberg Schreiner Walgau Schreiner Vorarlberg Möbel Walgau Möbel Vorarlberg
helmut-walter.at
420 Home | Tischlerei Kilzer EBS Smart Solutions Software GmbH kilzer
9900
Lienz
  Jetzt neu bei Tischlerei Kilzer: Die Tischlerei Kilzer GmbH Co. KG ist ein ... Innentüren Haustüren Möbel nach Maß Projekte Startseite Kontakt Sitemap Herzlich willkommen
kilzer-tueren.at Kilzer Tischlerei Unternehmen Freude
421 Start Guido Zotti
5020
Salzburg
... Sie uns in die Welt von Guido Zotti! Wir zeigen Ihnen eine Auswahl aus der Fülle unseres Angebots antike Möbel
guidozotti.at
422 Küchenstudio Wohnideen Küchenstudio

Entdecken Sie traumhafte Wohnideen im Küchenstudio bzw. Wohnstudio. Ihr Innenarchitekt hilft Ihnen bei der Verwirklichung ... Share Europa Möbel Verwaltungs GmbH Co KG Salzburger Linz + -
europamoebel.at Küchenstudio Wohnideen Innenarchitekt Wohnstudio
423 Design Hütte Möbel Vakantie

Design Hütte Trend Lifestyle Holiday Urlaub Vakantie ... -Ausstellung! DeSign Hütte Wo den sonst.... Über uns Möbel Studio Kollektionen Modern Relax Blofield Trones
design-hutte.at Vakantie Urlaub Holiday Verhuur For Rent Vermietung Verkauf
424 Herzlich Willkommen Fenster

Tischlerei Schöpp Faistenau ... Bau- und Möbeltischlerei Schöpp Familienbetrieb seit Informationen Willkommen Über uns Möbel
tischlerei-schoepp.at Fenster Türen Möbel Tischlerei Bödn Alt Möbelverkauf
425 Calligaris moderne Möbel: Italienisches

Calligaris: arredamento casa moderno e funzionale design italiano. Oltre 800 modelli: sedie tavoli ... Couchtische Wohnzimmer - möbel TV- HiFi-Möbel Wandregale Sleeping Doppelbetten Schlafzimmer - möbel Zubehör
calligaris.at
426 Einrichtung Möbel und

... Willkommen! Attachè Inneneinrichtung - Ihr persönlicher Berater für Einrichtung Möbel und Design Aktuelles
attache.at
427 Elmecker Einrichtungsstudio für DAN
4193
Reichenthal
Einrichtungsstudio Elmecker für alle Ihre Wohnträume ... Ing. Werner Elmecker Geschäftsführer Küchen Möbel Projekte Über uns Links Ortsplan Kontakt Küchen Erst
ee-studio.at DAN DANKüchen DAN Freistadt
428 Designklassiker 20stes Jahrhundert Möbel
6850
Dornbirn
Alexandra Alge Möbelagentur
moebelagentur-alge.at Möbel Sessel Tisch Stuhl Teppich Eternit Lampen Accessoir
429 Zeitlhofer mehr als nur

... und Möbelfachhandel ZEITLHOFER! Ich verspreche Ihnen ?mehr als nur Möbel?. Einzigartige und umsetzbare Ideen
zeitlhofer-moebel.at
430 BENLEVI  MANUFAKTUR 
6020
Innbsruck
Unsere Möbel erzählen Geschichten. In ihnen bleibt Vergangenes lebendig. Sie spiegeln wider woher wir ... BENLEVI - MANUFAKTUR PHILOSOPHIE BENLEVI KLEIDUNG TASCHEN MÖBEL KONTAKT
benlevi.at
431 :: Tischlerei Huber Peter Huber Peter GmbH Tischlerei
6460
Imst
Tischlerei Huber Peter Möbel aus Zirbenholz Individueller Innenausbau Tischlerei in Tirol. Auch
tischlerei-huber-peter.at Tischlerei Tischler Imst Komplettausstatter Böden
432 :: Tischlerei Huber Peter Tischlerei

Tischlerei Huber Peter Möbel aus Zirbenholz Individueller Innenausbau Tischlerei in Tirol. Auch
wellness-huber.at Tischlerei Tischler Imst Komplettausstatter Böden
433 :: Tischlerei Huber Peter Huber Peter GmbH Tischlerei
6460
Imst
Tischlerei Huber Peter Möbel aus Zirbenholz Individueller Innenausbau Tischlerei in Tirol. Auch
treppen-huber.at Tischlerei Tischler Imst Komplettausstatter Böden
434 Www.lechnerfranc.at Fair

Lechner Franc Import von Fair Trade Produkten Kunsthandwerk Leder Korbwaren
lechner-franc.at Fair Trade Kunsthandwerk Leder Korbwaren
435 Willkommenbei der Tischlerei MEISTER möbel

Tischlerei Meister. Keine Billigmöbel aber hochwertige individuelle Einrichtung zu günstigen Preisen; Maßarbeit
tischlerei-meister.at Möbel Einrichtung Tischler Tischlerei
436 KITZ LINE Möbel Kitz
6370
Kitzbühel
Handwerk Pur und unvergleichlich! Toni Ober KITZ LINE in Kitzbühel in Tirol. ? Vitrinen ... Interpretiert. Die neuen Kitz Line Möbel aus der Tischlerei Ober überzeugen mit Geradlinigkeit und klaren Formen
kitzline.at Kitz Line Toni Ober Online
437 Antikmöbel Ewald Hainberger antik
4150
Berg bei Rohrbach
Antikmöbel Ewald Hainberger ... Home Stilkunde Restaurierte Möbel Restaurierung Vorher/Nachher Sonstiges Gartenholz
antikmoebel-eh.at Antik Moebel Ewald Hainberger
438 StilGewohnt Möbelhandel GmbH StilGewohnt

... Start Webshop Möbel Lampen Kamine Über uns Adresse Gästebuch Sie benoetigen Javascript
stilgewohnt.at StilGewohnt Landhausmöbel Landhausstil Landhaus
439 Manninger Möbel GmbH  Manninger Möbel GmbH
8261
Sinabelkirchen
Wohnen Handwerk Manninger in Sinabelkirchen ist ein Familienbetrieb und vereint Handwerk und Einrichtungshaus. ... Manninger Möbel GmbH Aktuelles Unternehmen Küchenausstellung Wohnen Essen Schlafen Referenzen
manninger.co.at
440 Startseite Country Classics country

Was das Herz begehrt! Unter diesem Motto kombiniert Country Classics in Kitzbühel Möbel und Accessoires.
countryclassics.at Country Classics Kitzbühel Michaela Schulze
441 Gerhard Höckner Designeria Gerhard

Planung + Design für Wohn und Geschäftsobjekte mit Fokus auf Massivholz vom Einzelmöbel bis zur
werkstatthoeckner.at Gerhard Höckner Massivholz Vollholz Naturholz
442 Tischlerei Hacker Krusdorf Anton
8345
Straden ... in Google Maps anzeigen
Tischlerei Hacker Ihr Tischler macht´s persönlich! Tischlerei Hacker Krusdorf 54 8345 Straden ... ist Wohltuend Möbel aus Holz sind eine ganz sinnliche Erfahrung! Einrichtungen werden gesehen gehört begriffen
tischlerei-hacker.at Anton Hacker Tischler Tischlerei Möbel
443 Möbel Rieder Möbelhaus Möbel Rieder KG
5282
Ranshofen
... tischler tischlerei möbel möbelhaus einrichtungshaus möbelrieder moebelrieder möbel rieder stuhl
moebelrieder.at
444 Kilim Mobilya Viyana

... Viyana - Kilim Möbel Wien - Stilev GmbH.
stilev.at
445 MStudio Reiter Altenmarkt mstudio
5541
Altenmarkt i.P.
Moebel und Mehr Gefuehle und Emotionen MStudio Reiter Altenmark im Pongau
tischlerei-reiter.at Mstudio M Studio Reiter Altenmarkt Pongau Brunn Bauer
446 G.Oberndorfer Geplantes Einrichten oberndorfer

G.Oberndorfer Geplantes Einrichten ... Startseite Über mich Planung Leistung Projekte Böden Esszimmer Küche Möbel Schlafzimmer Treppen
go-einrichten.at Oberndorfer Tischler Einrichten Möbel
447 Georg Brandstetter Tischlerei Georg

Tischlerei Georg Brandstetter Wohnen zum Wohlfuehlen mit Ideen und kreativem Design Einrichten
tischlereibrandstetter.at Georg Brandstetter Tischlerei Einrichten
448 DeWitt Nußdorf dewitt
1190
Wien
Auch als Selbstbaumöbel sind de Witt Möbel nach Maß mit zinsenfreier Teilzahlung in der
dewittwien.at Dewitt De Witt Möbel Nach Maß
449 Wohnsinnspreise: Wohnschnäppchen zu Wahnsinnspreisen wohnsinnspreise

Wohnsinnspreise bietet Wohnschnäppchen zu Wahnsinnspreisen. Hier finden Sie hochwertige Ausstellungsstücke und Restposten von Markenmöbeln zu ... -Angeboten Designer-Möbel für Ihr Wohnzimmer zu unschlagbaren Wahnsinnspreisen! Top-Schnäppchen
wohnsinnspreise.at Wohnsinnspreise Wohnsinnspreis Möbel Schnäppchen Möbel Günstig Kaufen Günstige
450 HUBER: INTRO tischler

Tischlerei und Wohnstudio Ing. Huber KG; Fenster Türen Möbel Planungen
huber-ybbs.at Tischler Huber Huber Ybbs Huberybbs
451 Exclusive Geschenkideen: Kunsthandwerk aus Pavillon

Gazebo Statuen aus Holz und Stein Windspiele Räucherwerk und Zubehör Amuletten
kunsthandwerk-bali.at Pavillon Bali Kunsthandwerk Räucherwerk Buddha Masken Wandmasken
452 Mimis Home Collektion Deco

Deco Altholz Möbel Teelichte Geschirr Blumen Vogelhäuser Bludenz Mimis Polster Zirbenkissen Schnäpse Mimis Home
mimis.at Deco Altholz Möbel Teelichte Geschirr Blumen Vogelhäuser Bludenz Mimis
453 Esstische Tische

... und in verschiedenen Farbvariationen. Wir stellen Möbel nach unseren eigenen Entwürfen her
massivmassmoebel.at
454 Treppenbau Möschl Stiegen bauen Treppenbau

Treppenbau Möschl Konzeption und Ausführung: Gelebte Wohnkultur formschön und ästhetisch. Treppenbau Stiegen
treppenbau-moeschl.at Treppenbau Stiegen Treppen Treppenplanung
455 LeskyTischlereiStiegenbau Stallhofen Tischlerei

Tischlerei Stiegenbau Möbel Fenster Böden Türen Steiermark Graz
wohnmeister-stiege.at Tischlerei Stiegenbau Möbel Fenster
456 Vinval ? Lifestyle Shop Chur

Lifestyle shop in der Schweiz mit nachaltigen DesignerMöbel und EBikes / EMopeds.
vintageelectricbikes.at Chur EBike EBikes Schweiz
457 Tirolstein Tiere
6020
Innsbruck
In der Altstadt von Innsbruck finden Sie Europas umfangreichstes Fachgeschäft für exclusiven Schmuck einzigartige ... Kontakt Schmuck Asiatika Wellness Moebel Skulpturen Mineralien Fossilien Exklusives
tirol-stein.at Tiere Mineralien Schmuck Fossilien
458 Gebrauchte Büromöbel kaufen mieten Gebrauchte

Gebrauchte Büromöbel günstig mieten kaufen Wien gebrauchte Drehstühle gebrauchte Aktenschränke Wien
gebraucht-bueromoebel.at Gebrauchte Büromöbel Günstig Mieten Kaufen Wien
459 +++++ Willkommen bei Planit Architektur

Architektur Innenarchitektur Planung Möbel Sanieren Sanierung Salzburg Einrichten
planit.at Architektur Innenarchitektur Planung Möbel Sanieren
460 Startseite Kunsthandwerk Alois Zirbenholz
9981
Kals am Großglockner
Zirbenkunst aus Osttirol ... TPLBEEZSEARCH Startseite Über mich Umgebung Uhren Schüsseln Möbel Kontakt ZIRBEN KUNST GRATZ Das Besondere
kunsthandwerk-gratz.at Zirbenholz Schnitzerei Alois Gratz
461 Startseite: Reibenbacher Naturholztischler Reibenbacher

Reibenbacher Naturholztischler: Der Mensch wohnt in der Natur. Möbel aus Vollholz und Keramik. ... Individuelle Möbel für einzigartige Menschen Willkommen beim Naturholztischler Reibenbacher Gottfried
reibenbacher.at Reibenbacher Naturholztischler Tischlerei Möbeltischler Naturverbunden Massivhol
462 New shabby style by shabby

Shabby chic Shabby style Landhaus country alte Möbel ... Navigation aufklappen/zuklappen Startseite Über uns World of Heart`s Accessoires Möbel Gästebuch
new-shabby-style.at Shabby Chic Shabby Style Landhaus
463 CLAIRE LIGNE Lettenmayr Akazie

Claire Ligne Wir bringen die Welt in Ihr Zuhause Online Shop für besondere
claire-ligne.at Akazie Akazien Sonnenliege Akazienbank Akazienliege
464 AKTUELLES Tischlerei Möbelwerkstätte

... ? Althaussanierung OBJEKT-EINRICHTUNG ? Möbel ? Bau TEILE- PRODUKTION ? Zuschnitt ? Bekantung ? CNC ? Produkte
kernbichler.at
465 Peko Tischlerei Handel

... /Gartengestaltung Wood Plastic-Composite Designermöbel Teak Möbel Gartenmöbel Zäune... mehr Green Symphony
peko.co.at
466 POSCH Antiquitäten
8190
Birkfeld
... sowie Baumaterialien. Wir restaurieren antike Möbel in unserer eigenen Werkstatt und übernehmen
posch-antiquitaeten.at
467 Treitner Wohndesign | Wohnträume Treitner GmbH Küche
1100
Wien
Treitner Wohndesign in Wien ist Ihr Partner wenn es um Ihre Wohnungseinrichtung geht. Ob ... bis zum Schlafzimmer planen wir mit der modernsten Computersoftware. MEHR ÜBER PLANUNG Tischlerei - exklusive Möbel
treitner.at Küche Wohnzimmer Schlafzimmer Vorzimmer Möbel Schrank Wohnen
468 Stuchly die Tischlermeister: Stuchly GmbH & CO KG Fenster
6712
Thüringen
Stuchly ... stuchly die Startseite Fenster Rahmensysteme Förderungen Referenzen Türen Möbel News Betrieb
stuchly.at Fenster Türen Möbel Verglasungen
469 LIEBLICHKEITEN LIEBLICHKEITEN

LIEBLICHKEITEN LIEBLICHKEITEN ist immer auf der Suche nach Besonderheiten. Viele unserer Produkte kommen aus ... Geschenke Accessoires Schmuck Möbel - einfach LIEBLICHKEITEN Home About Contact Basket NEU
lieblichkeiten.at LIEBLICHKEITEN Geschenke Accessoires Schmuck Möbel
470 Wohnen ist leben .... Wohnkultur KILGA GmbH Wohnkultur
6020
Innsbruck
Wohnkultur Kilga Seilergasse 15 6020 Innsbruck Tel.: +43 512 57 61 83 ... PROJEKTE BETTENDESIGN Schramm TEXTILIEN accessories OUTDOOR möbel INFOCORNER NEUHEITEN PARTNER wohnen
kilga.at Wohnkultur Möbel Tirol Kilga
471 Tpdesign | wohnraumgestaltung TPDesign

Machen Sie Raum für neue Ideen. Geben Sie Ihren eigenen vier Wänden mehr und neue ... Wohnraumgestaltung mit Möbel-Design für Ihr Zuhause "Architektur ist im Idealfall immer direkte Auseinandersetzung
onlinemoebel.at TPDesign Einrichtungstraum
472 > > > JENNINGS

Kindermode Kinderwagen Möbel Kinderzimmer Babyausstattung Taufe Kinderbekleidung Jennings ... Babys Bekleidung Kinderwagen Möbel Stofftiere Kids Teenies Contact Babys Bekleidung Kinderwagen
jennings.at
473 Büromöbel versandfrei bestellen Büromöbel

Ihr Experte wenn es um Büromöbel geht! MarkenBüromöbel versandfrei mit Sofortprogramm und Rechnungskauf ? TrustedShops zertifiziert ... Bisley Gera-Möbel Leuwico Dauphin und Bejot hergestellt. Diese Marken sind für Ihre hohen
bueromoebel-experte.at Büromöbel Büro Möbel Büroeinrichtung Bueromoebel
474 Möbelvisionen Schleinzer tvmöbel

... at - officemoebelvisionen at - konzept moebel design design by schleinzer möbelvisionen - konzept
moebelvisionen.at Tvmöbel Tv Möbel Funktionsmöbel Fernsehschrank
475 Alpenkid Startseite

Alpenkid aus Österreich bietet Möbel für Kindergarten Hort Krippe Krabbelstuben aus Massivholz ... HORTMÖBEL MÖBEL FÜR TAGESBETREUUNG KINDERGARTENEINRICHUNG KRABBELSTUBENEINRICHTUNG KRIPPENEINRICHTUNG
alpenkid.at
476 Home Denk Holz GmbH holz

Denk Holz GmbH ... mit. Wir bieten Ihnen Möbel für den gesamten Wohnbereich Büro- und Geschäftseinrichtungen Eingangs
denkholz.at Holz Tischler Möbel Moebel
477 3d Möbelplanung Plan

Professionelle Einrichtungsplanung für Kunden Händler und Tischler! ... - Service Möbel KOSZ Clever Einrichten
kosz.at Plan Planung Einrichtung Küche
478 ... besonderes aus Holz koermer

tischlerei kunsthandwerk koermer ... Tischlerei und Kunsthandwerk Körmer bietet Ihnen aus einer Hand Tischlerei Kunsthandwerk Möbel
koermer.at Koermer Körmer Tischlerei Tischler
479 NTWDesign Tischlerei Neunteufl Oberstrahlbach ntw

NTWDesign Tischlerei Willibald Neunteufl Oberstrahlbach 3910 Zwettl Waldviertel Holz Möbel
ntw-design.at Ntw Ntw Design NtwDesign Neunteufl
480 Art Deco Furniture Art Polsterei

TOGO DESIGN™ manufacture of upholstered furniture for home Gartronomie restaurant cafe
coffeehouse.at Polsterei Polstermöbel Art Deco Möbel Art Deco
481 MDESIGN MANFRED AFFENZELLER MDesign

MDESIGN KATSDORF MANFRED AFFENZELLER Artikel: Polstermöbel Sofa Couch Barhocker TV Möbel
m-design-wohnen.at MDesign MDesign Katsdorf Affenzeller
482 Wohnaccessoires Schöner Wohnen Möbel

Schöner wohnen mit Designermöbel Wohnideen und Wohnaccessoires von Casanello. Online kaufen und bestellen in ... casanello - wohnen in schönster form bleiben sie gespannt moebel Wohnaccessoires mit Geschmack
casanello.at Möbel Wohnideen Schöner Wohnen Online
483 Fürstenfelder Messetage Startseite Meister Möbel Unger GmbH & Co KG Messetage
8280
Fürstenfeld
Fürstenfelder Messetage. Vom 9.11. November 2012 finden die Fürstenfelder Messetage unter dem Motto "Feuer ... Startseite Meister Möbel Meister Möbel Homepage SPIRIT OF FIRE Kachelöfen und Kamine SPIRIT OF FIRE
messetage.at Messetage Hausmesse Fürstenfeld Meister Möbel
484 HomepageTitel Home Schreiner
8053
GRAZ
HomepageTitel Graz ... und qualitätsvoller Handwerksarbeit übernehmen wir gerne die Fertigung Ihrer Wunsch-Möbel und Einrichtungsgegenstände
tischlerposch.at Schreiner Schreinerei Tischler Möbel
485 Massivholz Tischlerei Josef Holzner Tischlerei

Tischlerei wir fertigen aus Massivholz: Küchen Türen Haustüren Treppen ... BAUTISCHLEREI KÜCHEN MÖBEL u. INNENAUSBAU OBJEKTBEREICH SONDERLÖSUNGEN KONTAKT SO FINDEN
joholzner.at Tischlerei Schreinerei Massivholztischlerei Biotischlerei
486 Mietmöbel Loungemöbel und ORGATECH AG Mietmöbel
71277
Rutesheim
Die Orgatech AG bietet ein sehr großes Angebot günstiger Mietmöbel für jede Veranstaltung. Loungemöbel ... eröffnet. mehr .. Möbel Mieten für Baselworld Edles Geschmeide und funkelnde
orgatech-austria.at Mietmöbel Möbel Mieten Loungemöbel Mieten
487 Objekt Wohneinrichtungen

... für die Lieferung von Möbel für Hotels Büros Seminarräume öffentliche Gebäude Industriebetriebe. Wir bieten
wirth-online.at
488 Handwerkholz Anton Bereuter Handwerkholz

Handwerkholz – Anton Bereuter: Tischlerei Möbel Treppen Stiegen Rodelhersteller Rodelerzeuger
handwerkholz.at Handwerkholz Anton Bereuter Tischlerei Tischler
489 Andreas Czipin Design.ACLine Edelstahl

Wir helfen Ihnen bei der fachmännischen Umsetzung. Vom Prototypenbau bis zu Spezial Anfertigungen wir nehmen
ac-line.at Edelstahl Geländer Quarantäneboxen Rohrschleiffen Vordächer Treppen Toiletenpapi
490 Mamatreff.at Die Seite mamatreff

Auf mamatreff treffen sich Mamis und Papis um Kleidung Möbel oder Spielzeug zu verkaufen ... Mädchen - Größe - Mädchen - Schuhe Umstandsmode Mehr Kategorien anzeigen Möbel in Betten
mamatreff.at Mamatreff Mama Börse Forum
491 Massivholzküchen zu günstigen Preise
12435
Berlin
Exklusive klassische und moderne Massivholzküchen Ihr Profi für Küchen Möbel Küchenplanung ... sich in Form- Farb- und Materialart ihrer Möbel wieder. Dabei spielt Massivholz eine ganz entscheidende Rolle
massivholzkuechen.at
492 Startseite Tischlerei Martin Tischlerei Martin Tritscher GmbH tischler
8970
Schladming
Küchenplanung und montage Sauna Infrarotkabinen und Wellnessbereiche in Holz Objektmöbel und Gastronomieeinrichtungen. ... Werkstatt unsere Arbeiten Wohnen Küchen Wohnräume Badezimmer Schlafräume Möbel Objektmöbel Tische Sitzecken
martin-tritscher.at Tischler Tischlerei Schladming Holz
493 Luis Scheicher Antiquit�en Luis

Luis Alois Scheicher Antiquit�en M�el Moebel Antiquitaeten alte Tische Kasten Kaesten K�ten Einrichtung alt Rarit�
luis-scheicher.at Luis Alois Scheicher Antiquit�en M�el Moebel Antiquitaeten Alte
494 TischlereiPale KG Fiss TischlereiPale

TischlereiPale KG Fiss ein Handwerksbetrieb mit Tradition im gehobenen Innenausbau erfüllen wir
tischlerei-pale.at TischlereiPale Lebensräume Tischler Innenausbau
495 DieGUTEMÖBELwerkstatt | MARTIN STREITFELD

Möbelwerkstatt | Tischlerei | Schreinerei Martin Streitfeld entwirft und baut für Sie Möbel ... home philosophie gute möbel wohnzimmer küche schlafzimmer badezimmer vorzimmer sonstiges universal
gutemoebel.co.at
496 Joko Individueller Möbelbau möbel

Willkommen bei der Tischlerei Josef Kothbauer in Niederwaldkirchen. Ihr Tischler für individuellen Möbelbau. ... Accessoires News von Joko-Möbel -- Weihnachtsmarkt Reichenthal » Mehr -- Weihnachtsmarkt
joko-moebel.at Möbel Möbelbau Josef Kothbauer
497 Schwarzott Einrichtungshaus Werkstätte schwarzott
2500
Baden
Möbel von Wittmann de Sede Cor interlübke Poliform bulthaup und ... Baden ? are-einrichtungshaus-xyaddks-schwarzott Presse ? AGB ?
schwarzott.at Schwarzott Möbel Tischler Wittmann
498 FunderMax FunderMax

FunderMax for people who create. Egal ob Möbel Fassade oder Innenausbau: An der ... für Möbel- und Innenraumgestaltung. Bild Doimo Cityline Werden Sie FunderMax Insider! Erhalten
fundermax.at FunderMax Compactplatten Schichtstoffplatten Beschichtete Spanplatten
499 Gesund wohnen | biologisch zirbelholz

Gesund wohnen. Biologisch wohnen. barrierefrei wohnen ein traumhaftes Gefühl. Mit Relax@Home dem neuen ... . Metallfreie Möbel Schlafsysteme Betten Kissen . Barrierefrei wohnen . . D Planungsstudio
relaxathome.at Zirbelholz Gesund Barrierefrei Wohnen Betten Schlafsysteme Möbel Schreinerei
500 Zeitreise 4.5 Home Altwaren

Platz für Ihren Slogan ... ! Bei mir finden Sie Möbel Glas Porzellan Bücher uvm. aus den verschiedensten Epochen. Lassen
zeitreise45.at Altwaren Gebrauchtwaren Räumungen Verlassenschaft
501 Tischlerei Haas GmbH Haas

Tischlerei Haas in Grödig bei Salzburg produziert Möbel und Einrichtung und ist Spezialist für Raumgestaltung
tischlereihaas.at Haas Tischlerei Grödig Salzburg
502 HOLZSIGI: Home HolzSigi

Handgemachte maßgerfertigte Möbel aus Massivholz aus der Oberpfalz im Herzen Bayerns. HOLZSigi fertigt Ihre ... Skip to navigation Skip to content HOLZ-SIGI Datenschutz Home Möbel Gartenhaus Saunen
holz-sigi.at HolzSigi Massivholz Schreinerei Massivholz Schreinerei
503 Serecom SEsselREanimationCOMpany

Möbel mit faszinierender Austrahlung aus einzigartigen Stilepochen f?r die Wohnräume der Gegenwart wiederbelebt. Vintage ... Glanz zurückzugeben. Möbel mit faszinierender Austrahlung aus einzigartigen Stilepochen f?r
serecom.at
504 Naturkosmetik Naturprodukte für

Naturkosmetik Möbel Nahrungsergänzungsmittel günstig bestellen Tipps für Allergie Neurodermitis gesunde ... Atemschutz Bücher und Notfallhelfer Möbel Bett Nach Kategorie Wohnaccessoires Ordnung Auflagen/Unterbett
purenature.at
505 ARTELIA AT | Rattan Paket 24 GmbH Gartenmöbel
12527
Berlin
Wir ? Gartenmöbel aus Polyrattan. Egal ob Loungemöbel Terrassenmöbel oder Rattanmöbel wir bieten ... Artelia Lounge Möbel Mein Warenkorb Zur Kasse Angebote Rattanmöbel Loungemöbel Esstisch Sets Sofas
artelia.at Gartenmöbel Polyrattan Gartenmöbel Rattan Gartenmöbel
506 Tischlerei Baumgarnter Bautischlerei

Wir sind eine Bau und Möbeltischlerei in 1150 Wien mit eigener CNCAnlage. Wir erzeugen Kastenfenster ... Ladenbau Möbelprogramm Restaurierung Materialkunde Häufig gestellte Fragen CNC Möbel Kinderzimmer
tischlerei-baumgartner.at Bautischlerei Möbeltischlerei CNCAnlage Möbelrestaurierung
507 Www.artigo.at Mein Wohndesign Lampen

Große Auswahl an Gartenmöbeln Stühlen Sesseln Tischen Couchtischen sowie Küchenutensilien ... und lassen Sie sich inspirieren. Finden Sie Ihre Traum-Möbel und überzeugen Sie sich selbst von bester
artigo.at Lampen Liegen Küchenutensilien Möbel Online
508 Rattan Dreams Ihr Burger & Degroute Rattan Dreams GmbH Rattan
4061
Pasching
Besuchen Sie unseren Showroom in Linz Pasching und genießen Sie Momente der Ruhe und ... Ihnen ein exklusives Sortiment an hochwertigen und stilvollen Rattan-Möbel. Verleihen Sie Ihrem Garten Ihrer Terrasse
rattan-dreams.at Rattan Möbel Moebel Garten Design Wellness Oase Sauna
509 Hopfer Siegfried Haus Reparaturen

Hopfer Siegfried für Haus und Garten Reparatur und das Aufstellen bzw. Einbau Ihrer ... ! Die Reparatur und das Aufstellen bzw. Einbau Ihrer Möbel bis hin zum Verlegen Ihrer Fertigparkettböden biete
hopfer-sigi.at Reparaturen Haus Garten Hecke
510 Sitzmöbel Bär Home Sitzmöbel

Unsere Möbel sind robust zeitgemäß individuell in der Farbgebung und mit viel Liebe ... über unser reichhaltiges Angebot an Sitzmöbeln zu verschaffen. Unsere Möbel sind robust zeitgemäß individuell
sitzmoebel-baer.at Sitzmöbel Bär Baer Sitzmoebel
511 Das Ideenreich Fieberbrunn

Das Ideenreich Fieberbrunn ist ein kleiner Laden. Hier findest Du Annie SloanProdukte wie Chalk Paint ... Gründe um alte Möbel aufzupeppen Die Qualität und das Handwerk von früher Erinnerungsstücke
dasideenreich.at
512 Mode Schuhe

Schuhe Mode Möbel und vieles mehr online kaufen. Große Auswahl ? Top Marken ... Kinder Babies Trachtenmode Accessoires Taschen Schmuck Uhren Brillen Möbel Heimtextilien Sport
ladenzeile.at
513 Potocnik Home Schreiner
8572
Bärnbach
Potocnik Bärnbach ... ist die Technik des Drechselns wieder in die Gestaltung unserer Möbel und Bauwerke zu integrieren
drechslerei-potocnik.at Schreiner Schreinerei Tischler Möbel
514 Home Schreiner
8223
Stubenberg
Tischlerei Bausch Stubenberg ... aus. Mit viel Liebe zum Detail und mit sauberer Handwerksarbeit fertigen wir Ihre Wunsch-Möbel
tischlerei-bausch.at Schreiner Schreinerei Tischler Möbel
515 Home Plainer Großhandel

Herzlich willkommen beim Spezialisten für Sicht und Sonnenschutz. Leben und Wohnen Sie Ihren persönlichen Traum ... Möbel. Bei uns profitieren Sie von maßgefertigten Produkten. Wirwissen worauf es ankommt ? gutes Design
plainer-innendesign.at Großhandel Für Innendesign Innendesign Franz Plainer
516 MEISTER MÖBEL


meister-moebel.at
517 ::: ROSSMANN MÖBEL :::


rossmann-gmbh.at
518 Möbel Haselbauer


haselbauer.at
519 Möbel Leitgeb


moebel-leitgeb.at
520 DB möbel


db-moebel.at
521 Möbel nach mass


massmoebel4you.at
522 Tischlermeister Uwe Heymann in Möbelwünsche
12101
Berlin Tempelhof-Schöneberg
Tischlermeister Heymann in Berlin Tempelhof Schöneberg realisiert seid über 25 Jahren nahezu all Ihre Möbelwünsche. ... Form follows function Aktuell haben wir Möbel im Sonderverkauf siehe unten Planungsmöbel Regal
moebelwunsch.at Möbelwünsche Möbelwunsch Heymann Uwe Heymann
523 TISCHLEREI SCHWAB A5205 tischler
5205
Schleedorf
TISCHLEREI SCHWAB A5205 SCHLEEDORF DIE TISCHLEREI IHRES VERTRAUENS ... Tischlerei Schwab - Munten - A- Schleedorf - Möbel nach Maß - Wohnen - Küche - Bad
tischlerei-schwab.at Tischler Tischlerei Schwab Schleedorf
524 Tischlerei Kases GmbH Tischler


kases.at Tischler Tischlerei Waldviertel Kunst
525 Home  Einrichtungen Eilmannsberger EILMANNSBERGER GmbH Ulrichsberg
4150
Rohrbach
EILMANNSBERGER MHK Küchenpartner Fenster Türen Innenraum Individuell geplant und in
eilmannsberger.at Ulrichsberg Rohrbach Meisterbetrieb Küche
526 System8X regalsystem

system8X ist ein indiviuell gestaltbares Regalsystem oder auch Möbelsystem/Möbelbausystem bestehend aus massiven Komponenten.
system8x.at Regalsystem Regalsysteme Ordnerregale Büroschrank
527 Equip 4 Event GmbH equip4event GmbH miet
1120
Wien
Verleih von Mietmöbel für alle Arten von Veranstaltungen ... Das ideale Mietmöbel Sortiment Wir haben die Möbel Sessel Tische Hussen Zelte
equip4event.at Miet Möbel Sessel Tisch Husse Verleih Event Messe
528 Iser Antik Antikmöbel

Die Firma Iser Antik bietet alles rund um die antike Möbel an: Restauration An ... Substanz wieder zur Geltung bringen. Überlieferte Möbel sind ein Dokument ihrer Zeit und das jeweilige
josefiser.at Antikmöbel An Und Verkauf Antikmöbel Restaurierung
529 Übersiedlung Räumung übersiedlung

wir machen Übersiedlungen EU weit Räumungen in ganz Österreich entsorgungen alter Möbel ... Demontage von Möbel Küche usw. Verpackungsmaterial Verpackung Kleintransport Lieferung usw
ubsumzug.at übersiedlung Räumung Umzug Entrümpelung
530 Karasek Gartenmöbel hochwertige St. Karasek & Co Ges.m.b.H & Co KG Gartenmöbel
1230
Wien
Karasek Gartenmöbel bietet hochwertige Möbel für Garten und Terrasse wie Gartentische Gartenstühle ... Outdoor-Möbel für Gastronomie und Hotellerie. Wellnessmöbel Wellnessliegen Saunaliegen Kippliegen Profi
karasek-gartenmoebel.at Gartenmöbel Gartenstühle Gartenliege Gartentisch
531 Tischlerei in Kirchberg /

Unsere Tischlerei in 3204 Kirchberg an der Pielach Niederösterreich fertigt Maßmöbel und hochwertige Sitzmöbel. ... Anfahrt Möbel von KA-GA bedeuten Möbel nach Ihren Ansprüchen mit hoher Qualität und sehr guter
ka-ga.at
532 Home tischlereihauserbernhard.at Ein

Bereits seit Generationen fertigen wir in unserer Werkstätte ... Werkstätte Möbel. Mit Liebe zum Detail - kein Stück ähnelt dem Anderen. Unser Team begleitet
tischlerei-hauser-bernhard.at Ein Lebendiges Atmendes Material
533 Karasek Gartenmöbel hochwertige St. Karasek & Co Ges.m.b.H & Co KG Gartenmöbel
1230
Wien
Karasek Gartenmöbel bietet hochwertige Möbel für Garten und Terrasse wie Gartentische Gartenstühle ... Outdoor-Möbel für Gastronomie und Hotellerie. Wellnessmöbel Wellnessliegen Saunaliegen Kippliegen Profi
xn--objektmbel-kcb.at Gartenmöbel Gartenstühle Gartenliege Gartentisch
534 Ainhirnholz

Tischlerei Ainhirnholz: Möbel von Tischlermeister Raphael Ainhirn aus Graz; gefertigt in Kumberg (Graz Umgebung); Markenzeichen: ... auf den Kopf und gibt dem massiven Möbel seine Leichtigkeit zurück. Details zum Projekt ? Rubiko Wenn Würfel
ainhirnholz.at
535 Firma Bracha Home Möbel
1140
Wien
Firma Bracha Wien ... Ihre Vorteile im Überblick Individuelle Planung und Gestaltung Ihrer Möbel Flexible Beratung im Möbelstudio
bracha.at Möbel Holz Möbelhaus Einrichtung
536 Home Tischlerei Spanner Tischlerei Spanner GmbH Tischler
8271
Großhart
Seite der Tischlerei Spanner Großhart ... Wir fertigen mit viel Liebe zum Detail und qualitativ hochwertiger Handwerksarbeit Ihre Wunsch-Möbel
tischlerei-spanner.at Tischler Tischlerei Möbel Holz
537 TISCHLEREI STEPPAN . BAU Bau- und Möbeltischlerei Steppan GmbH keywords
2340
Mödling
Die Tischlerei Steppan hat sich in über 80 Jahren zum Spezialisten für hochwertige Möblierungen und ... für jeden Einrichtungswunsch vom einzelnen Möbel bis zur Komplettausstattung Ihrer Wohn- und Geschäftsräume. Unsere
tischlerei-steppan.at Keywords
538 Gastrobedarf VEGA VEGA Vertriebs GmbH & Co. KG
4470
Enns
Bei VEGA finden Sie eine große Auswahl an Gastrobedarf wie Porzellan Besteck Gläser ... Besteck Tafeln Porzellan Speisekarten Exclusive by VEGA Gastronomie-Möbel Porzellan/Geschirr Besteck Glas
vega-direct.at
539 MoebelSpot.at Der günstige online

Top Angebeote für Büromöbel wie Drehsessel Chefsessel Stühle wie auch für Gartenmöbel ... Newsletterregistrierung Moebel Spot - Günstige Möbel für das Büro für den Wohnbereich oder Garten Startseite Bürosessel
moebelspot.at
540 Antiquitäten Holzrestaurator :: möbel

Restauration von Möbeln aller Stilrichtungen speziell alte Oberflächen Polituren Marmorierungen Bauernmalereien und ... Bauernmalereien und Schnitzereien. Nachbau alter Möbel Entwurmung und Beratung zurück nach oben Home
holzrestaurator.at Möbel Holz Restaurierung Restauration Reparatur Konservierung Holzobjekte Restau
541 Tischlerei Mild Sinabelkirchen/Steiermark tischlerei

Tischlerei Mild seit 1905. Ein Familienunternehmen mit Spezialisierung auf zwei besondere Formensprachen: kompromisslose Moderne ... Herzlich willkommen bei Mild der Spezialist für besondere Möbel. Diese Seite benötigt Flash
mild1905.at Tischlerei Architektur Design Moderne Tradition Handwerk Handwerlich Handwerke
542 Home Die Wohnwerkstatt GmbH wohnwerkstatt
5020
Salzburg
Holztisch Zirbenbett Vollholzkueche Leiterstuhl Kinderzimmer aus Holz Ahorn Esche ... tadelloser Produktion zu verbinden. WKO wohnwerkstatt diewohnwerkstatt möbel massivholz vollholz
wohnwerkstatt.at Wohnwerkstatt Diewohnwerkstatt Moebel Massivholz
543 Jugendstil Lampen Antiquitäten

...  Jugendstil Lampen - Antiquitäten Wien - Art Deco - Jugendstilmöbel - Möbel - Möbelhersteller
galerieholzer.at
544 Kleinanzeigen für Österreich
8582
Rosental
? 10.000 kostenlose private Kleinanzeigen ? Auto Motor ? Immobilien ? Haushalt Möbel ... Benutzername Passwort Vergessen Alle Kategorien Haushalt Möbel TV - Hi-Fi - PC Immobilien
12kleinanzeigen.at
545 Antiquitäten Altwaren Antiquitäten

Ankauf und Verkauf von Antiquitäten Altwaren Verlassenschaften Antike Möbel via Experte ... Gegenstände und bieten damit umfassende Möglichkeiten für alle die alte Teppiche und antike Möbel Ölgemälde
antik-experte.at Antiquitäten Antiquitäten Ankauf Altwaren Altwaren
546 Antiquitäten Edith Edler
1010
Wien
Biedermeier Jugendstil Barock Gotik Schmuck Wien Wiener Gemälde Silber Porzellan Restaurierungen Möbel Antik ... Ankauf Möbel Antiker Schmuck Silber Skulpturen Porzellan Gemälde Kontakt Anfahrt Hier finden
antiquitaeten-edler.at

Möbel Genève Nous DéménagementGenève Österreich Möbel - Die Öffnungszeiten können zu Feiertagen Pfingsten, Fronleichnam, Reformationstag und Allerheiligen abweichen. Statistiken: 4 StadtBranche Punkte für "Möbel " - In die Bewertung wird die Anzahl der Besucher und Erfahrungsberichte dieser Themenseite mit einbezogen. Möbel › Genève Nous Déménagement Österreich - Möbel Bewertungen Öffnungszeiten und Erfahrungen. Stand:

Neuer Eintrag 

Die Begriffe Möbel und Mobiliar bezeichnen Einrichtungsgegenstände vorwiegend in Innenräumen wie Wohnungen, Geschäften, Büroräumen oder anderen Nutzungseinheiten, sowie im Außenbereich . Der Begriff steht somit im Gegensatz zu unbeweglichen Dingen , die mit dem Boden oder baulichen Anlagen fest verbunden bzw. verwachsen sind. Möbel Öffnungszeit und Erfahrungen

△ nach oben kostenfreier Eintrag Datenschutz