optional Stadt:

Möbel › Genève Nous Déménagement Österreich

Möbel

Google Anzeige:

Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 Zirbenbetten Möbel
9400
Wolfsberg
Zirbenbetten aus rein luftgetrockneten Zirbenholz aus den österreichischen Alpen.Das Zirbenbett wir schwebend und metallfrei gefertigt...
das-zirbenbett.kaufen Mw Zirbenbetten Kategorie Betten Object Einkaufswert Bettwaren Schlafsysteme Zirbenmöbel Kontakt Checkout Wolfsberg Event Nützliches Gmb
2 Umzug Umzug Transport
1100
Wien
Wir sind ein erfahrenes Umzugsunternehmen, das sich um verschiedene Arten von Umzügen kümmert. Aus diesem Grund helfen wir Ihnen gerne..
bluemoving.at/ Wien Umzug Bluemoving Möbel Möbeltransport Ihren Umzugsunternehmen Transport Umzüge Blue Kunden Möbellift Organisation Unternehmen Ihr
3 Antiquitäten und Verlassenschaften Wien Antiquitäten Antik
1040
Wien
Hochqualitative Antiquitäten Ankauf in Wien oder österreichweit. Verlassenschaften Ankauf von Experte leicht gemacht. Kostenlose Wertschätzung und Gratis Räumung.Sie möchten Ihre..
antiquitaeten-wien.com Wien Antiquitäten Verlassenschaften Altwaren Ankauf Verkauf Antike Gegenstände Preis Sachen Abholung Gemälde Besichtigungstermin Barankauf Möbel Wirversprechen Abendstunden
4 Loogo Umzüge Österreich Umzüge
5400
Hallein
Mit LOOGO sparen Sie Zeit und Nerven. Überlassen Sie Ihren Umzug den Profis von LOOGO! Profitieren Sie von unserer Organisation und..
loogo.at Umzug Möbel Kartons Möbelküche * + Umzugsunternehmen Privatumzug Angebot Firmenumzug Verpackungsmaterial * Umzüge Loogo Kartons * Lkw * Internationaler Neumöbel Abholung Karton Rechner Demokratischevolksrepublikkorearepublikkroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmauretanienmauritiusmazedonienmexikomikronesienmoldawienmonacomongoleimontenegromosambikmyanmarnamibianaurunepalneuseelandnicaraguaniederlandenigernigerianiuenorwegenösterreichomanosttimorpakistanpalästinensischeautonomiegebie
5 Biotop Schuhe und Möbel Handel Textil
3242
Texing
Die Wollwerkstatt in Texing vertreibt wertvolle und hochwertige Produkte aus Schafwolle. Es handelt sich um Produkte wie Wolldecken, Gymnastikmatten, diverse..
wollwerkstatt.at Filzwolle Merino Meditationskissen Bettdecken Maß Hochwertige Hautpflege Unterbetten Filzpatschen Handschuhe Natur Produkte Kinderbettdecke Faltmatte Plaids Wollmütze
6 Entrümpelung Wien Umzug
1140
Wien
Entrümpelung Wien Entrümpelung Wien ; bedeutet so viel wie die Entsorgung von Gerümpel. Die Frage ist jedoch wieviel kostet das Entrümpeln von..
wiener-raeumung.at Wien Entrümpelung Räumung Gratis Wohnungsräumung Möbel Räumungen Haushaltsauflösung Entsorgen Sperrmüllabholung Kellerräumung Einrichtungen Wiener Hausräumung Entsorgung Altholz
7 Entrümpelung Wien Umzug
1140
Wien
Entrümpelung Wien Entrümpelung Wien ; bedeutet so viel wie die Entsorgung von Gerümpel. Die Frage ist jedoch wieviel kostet das Entrümpeln von..
wiener-raeumung.at Wien Entrümpelung Räumung Gratis Wohnungsräumung Möbel Räumungen Entsorgen Haushaltsauflösung Sperrmüllabholung Kellerräumung Wiener Entsorgung Hausräumung Einrichtungen Entrümpelungen
8 Gastronomiefachhandel Grosshandel Gastronomiebedarf
33178
Borchen
ask gastro UG liefert Gastronomiebedarf und Großküchentechnik namhafter Hersteller deutschland- und europaweit an Hotels und gastronomische Einrichtungen aller Grössen, sowie..
askgastro.shop Gastronomie Gastro Edelstahlmöbel Buffet Mein Kühltechnik Möbel Hygiene Gastronomiebedarf Ersatzteile Konto Neumärker Großküche Einrichtung Backtechnik Cool Line Air Wolf Kochen Gefrier Kunden Melamin Servierartikel
9 Möbel Handl GmbH Einrichtung
3860
Heidenreichstein
moebelhandl.at
10 Desigano.com Möbel
5203
Köstendorf
Desigano.com steht für qualitativ hochwertige Designer Möbel und Leuchten aus Europa. Finden Sie im Onlineshop einzigartige Sofas, Stühle und Tische..
desigano.com/ Leuchten Barhocker Sessel Etagenbetten Tische Gartenmöbel Möbel Beistelltische Stühle Stehtische Teppiche Wandklappbetten Designer Sofa Hängeleuchten Blumentöpfe Bartheke Kissen
11 Die schnelle Teppichreinigung bei Teppichreinigung
1080
Wien
Sie haben Teppiche in Ihrem Eingangsbereich liegen? Dann sollten Sie sich um eine professionelle Teppichreinigung umsehen. Denn wenn Ihre Teppiche..
teppichreinigungen-wien.at/ Teppich Teppichreinigung Teppiche Polstermöbelreinigung Wien Professionelle Reinigung Qualität Orientteppiche Wert Teppichreinigungen Wienat Möbel Partners Termin Jahre
12 Umzugsservice in Salzburg von Umzug
4180
Zwettl a.d.Rodl
Österreichs erster Umzugsvergleich mit Sofortergebnis! Egal ob private Übersiedlung, Möbeltransport, oder Firmenumzug wir machen es ihnen leicht. Finden und Vergleichen Sie noch..
flottumzug.at Umzug Salzburg Entrümpelung Linz Umzugsservice Umzugsfirma Möbel Demontage Internationaler Umzugslift Gern Services Montage Umziehen Doch Komplettangebot Sodass Preisen Räumungen Unternehmen * Kostenlose
13 Hane Möbel Möbel
1100
Wien
Neueste modernste Möbel zum Tiefpreis mit prompter Lieferung inklusive Montage. Hoch qualitative Möbelstücke mit toller Beratung nur bei Hane Möbel...
hane.at Esszimmer Schlafzimmer Moderne Aktion Sitzgruppen Ecksitzgruppen Möbel Avantgarde Babyzimmer Hane Polstermöbel Betten Jugendzimmer Italienische Dekoration Matratzen Sitzgarnituren Federkernmatratzen
14 Hane Möbel Möbel
1100
Wien
Neueste, modernste Möbel zum Tiefpreis mit prompter Lieferung inklusive Montage. Hoch qualitative Möbelstücke mit toller Beratung nur bei Hane..
hane.at Schlafzimmer Esszimmer Sitzgruppen Aktion Ecksitzgruppen Moderne Möbel Babyzimmer Avantgarde Hane Betten Polstermöbel Jugendzimmer Italienische Wohnwände Sitzgarnituren Server
15 Zirbenbetten Einrichtung Möbel
9400
Wolfsberg
Natur Zirbenbetten von Schröcker aus rein luftgetrockneten Zirbenholz von den Nockbergen...
das-zirbenbett.com Zirbenbetten Zirbenbett Natur Nachtkästchen Schröcker Schlafen Zirbenmöbel Tischlerei Planung News Bettwaren Zirbennachtkästchen Schlafsysteme Zirbenholzbett Wirkung Weißenbachstraße Zirbenpolster Schrnke
16 Möbel aus Beton Betonmöbel

Betonmöbel individuell von Hand gefertigt. Jedes Möbel ist ein Einzelstück. ... möbel aus beton Home Möbel Kamin Holz Beton Möbel Sideboard Waschtisch Architektur Sichtbetonstiege
xn--beton-mbel-kcb.at Betonmöbel Beton Möbel Sichtbeton Möbel
17 Möbel Pillichshammer Herzlich Pillichshammer Möbel GmbH & Co. KG Möbel
4870
Vöcklamarkt
Möbel Pillichshammer Möbel Tischlerei Planung Möbelbau Vöcklamarkt ... . Pillichshammer Möbel GmbH Co. KG Gries Vöcklamarkt Diese -Adresse ist vor Spambots geschützt
moebel-pillichshammer.at Möbel Pillichshammer Möbel Tischlerei Planung
18 Antike Möbel Shop Antike
6252
Breitenbach am Inn Austria
Antike Moebel Shop Matthias Seidner ... aktivieren um alle Funktionen in diesem Shop nutzen zu können. Antike Moebel Shop - Matthias Seidner
antike-moebel-shop.at Antike Moebel Shop
19 Antik Möbel Antike Antik
4600
Wels
Antik möbel online. Alte Bauernmöbel. Landhausmöbel Weichholzmöbel Vintage Möbel. Antik Möbel aus verschiedenen ... Möbel Vintage Möbel Antik Möbel Antike Tische - Antik Möbel Antike Schränke - Antik Möbel Antike
antik-zone.at Antik Möbel Bauernmöbel Wiechholzmöbel
20 Home Erotische Möbel erotische

Individuell gefertigte erotische Möbel oder auch SM Möbel genannt für Privat und Business aus Österreich. ... Erotische Möbel Wir fertigen Träume und Fantasien Erotische Möbel Wir fertigen Träume und Fantasien
erotische-moebel.at Erotische Möbel Sm Möbel Günter Grasser
21 OK Möbel Home Schreiner
5340
Sankt Gilgen
OK Möbel Sankt Gilgen ... Home Leistungen Referenzen Aktuelles Unser Betrieb Kontakt Anfahrt Möbel nach Mass Möbel
ok-moebel.at Schreiner Schreinerei Tischler Möbel
22 Antik möbel antique furniture hlb.project

antik möbel sekretär antique furniture secretaire ... ANTIK MÖBEL MAP ANTIK MÖBEL GALERIE GEBRAUCHT MÖBEL GEBRAUCHT MÖBEL GALERIE ACCESSOIRES ACCESSOIRES
antik-ambiente.at Hlb.project Moebel Secretaire Sekretär
23 Möbel Innsbruck Tischlerei Möbel

Möbel Innsbruck ist das Spezialgebiet der Tischlerei Jenewein. Anfertigungen nach Maß und nach Ihren Vorstellungen. ... und gerichtl. beeid. Sachverständiger für Möbeltischlerei Möbel Innsbruck by www.tischlerei-jenewein
tischlerei-jenewein.at Möbel Innsbruck
24 ELLENSOHN. Handgemachte Möbel aus Möbel

Ellensohn Möbel Homepage handgemachte Massivholzmöbel Vollholz Massivholz Bauart und Design ... ELLENSOHN. Handgemachte Möbel aus Holz. Ein Baum wächst mehr als hundert Jahre bis das Holz
ellensohn.or.at Möbel Massivholz Vollholz Handwerk Bauart
25 Das Marken Möbel Outlet Kasper-Wohndesign-Outlet GmbH Möbel
76829
Landau
Das online Marken Möbel Outlet in Österreich | z.B. Rolf Benz KARE Design ... aktivieren um alle Funktionen in diesem Shop nutzen zu können. moebel-style Mein Warenkorb Zur Kasse
moebel-style.at Möbel Outlet Rolf Benz Ewald Schillig
26 Möbel See Möbel

Möbel See ihr Innenarchitekt in Haid. Möbel See Einfach schön leben ... Möbel See NUR FÜR KURZE ZEIT Besuchen Sie unseren Schauraum. NEU IM SORTIMENT Besuchen Sie unseren
moebelsee.at Möbel See Stilmöbel Inneneinrichtung Innenarchitekt
27 Die Möbel Sensation! Jetzt möbel

MöbelSensation.de Deutschlands großer Möbel OnlineShop. Bekannte Marken größte Vielfalt günstige Preise und ... Möbel Home Kontakt Beratung Warenkorb Ihre Vorteile Persönliche Beratung Best-Preis
stilbetten.at Möbel Günstig Onlineshop Bestellen
28 Möbel und Designermöbel günstig Möbel

llll? Hochwertige Möbel und Designermöbel im Shop günstig online kaufen. Kauf auf Rechnung ? Versandkostenfrei ... Garderoben Sets Tische Home Office Möbel Schlafen Kind Jugend Büro Gewerbe Stühle Sessel Tische
jenverso.at Möbel Shop
29 Günstig Möbel kaufen Schreibbüro und Lektorat OG Möbel
6380
St. Johann in Tirol
Dieser Shop bietet erstklassige Möbel zu Top Konditionen. Regelmäßiges Vorbeischauen lohnt sich. ... - Jugendzimmer Küche Schlafzimmer Wohnzimmer Lampen und Leuchten Programmpartner Kontakt günstig Möbel
guenstig-moebel-kaufen.at Möbel Möbelhaus Einrichtung Küche
30 Suppan Suppan suppan
1050
Wien
Einrichtungshaus für Indische und Chinesische Möbel massiven Esstischen und Landhausmöbel in Wien Österreich. ... Kommoden Sideboards TV-Möbel Nachtkästchen Schränke Regale Schränke Regale Truhen Licht Orientalische
suppanundsuppan.at Suppan Indische Möbel China Möbel
31 Fenster Türen Kaun GmbH Fenster
4490
St. Florian
TischlerQualität bei Fenster Türen Möbel MöbelRestauration und Antiquitäten von der Tischlerei Kaun ... Kastenstockfenstersanierung Wohnen Schlafen Kochen Baden Arbeiten Kastenfenster Restauration Türen Möbel/Fußböden
kaun.at Fenster Türen Möbel Antiquitäten
32 Objekteinrichtungen Stockbetten objekteinrichtung

Stranig Extrem starke Möbel Objekteinrichtungen Stockbetten Ihr Spezialist für stark ... Startseite Extrem starke Möbel Referenzen Unternehmen Aktuelles Objektinrichtungen
stranig.at Objekteinrichtungen Stockbetten Stranig Möbel
33 Möbel und Designermöbel online möbel

Der MöbelOnlineShop für Designermöbel. Große Auswahl tolles Design für alle Wohnbereiche bei avandeo: Hochwertige ... Passwort zugeschickt. Mein Warenkorb ? Möbel SOFAS SCHLAFSOFAS BETTEN ESSTISCHE COUCHTISCHE
avandeo.at Möbel Onlineshop Günstig Bestellen Online Kaufen Möbelshop Möbelhaus
34 URBA Ambiente | Willkommen URBA Ambiente GmbH Wohnwände
9020
Klagenfurt am Wörthersee
Wohnwände Wohnwand Möbel für Wohnzimmer Wohnzimmer Möbel Wohnzimmerschrank Wohnzimmer Set ... Lattenrost Sonstiges Attraktive Möbel zu günstigen Preisen! Wie wir das schaffen? Lesen Sie über uns - Link
topmoebel-shop.at Wohnwände Wohnwand Möbel Für Wohnzimmer
35 Home Möbel aus Möbel

Möbel aus Holz Marin Glawitsch Holz Kunst Handwerk ... Möbel aus Holz Martin Glawitsch Home Möbel Werkstatt Über mich Kontakt Links HOLZ + DESIGN
moebelausholz.at Möbel Aus Holz Marin Glawitsch Holz Kunst Handwerk
36 Royal Möbel royal

Möbel möbel moebel österreich möbel österreich
royalmoebel.at Royal Möbel Royal Navrkal Möbelstudio
37 1a Direktimport Möbel mexico

Mexico Möbel im Hacienda Stil und Vieles mehr für Liebhaber südlicher Wohnkultur. Direktimport aus Mexiko. ... Möbel Gartenartikel und Accessoires mit südlichem Flair. Unglaublich preiswert durch Direktimport
1a-direktimport.at Mexico Möbel Mexikanische Möbel Mexico
38 VCM24 | VCM Möbel vcm24

Bei VCM24 dem Möbel Onlineshop gibt es moderne Esszimmerstühle und Esszimmertische. VCM Möbel haben hohe ... ) Sie haben noch keine Artikel in Ihrem Warenkorb Sie sind hier Startseite Hifi- TV-Möbel CD-DVD-Möbel Hifi-Möbel TV-Möbel TV
vcm24.at Vcm24 Vcm Möbel Tv Moebel
39 LAGERHAUS 1900 1950 Möbel ArtDeco

Handel mit Möbel Kunst und Antiquitäten ... Möbel von - Lagerhaus Konkret Gemeinsam Planen Ona B. Aktuell Special Offer
art-deco.at ArtDeco Artdeco Art Nouveau Kunsthandel
40 TheObjects Möbel und Möbel

Hier entsteht ein Online Shop für Möbel und Wohnaccessoires. Wohnideen für anspruchsvolle Menschen ... TheObjects - Möbel und Wohnaccessoires Hier entsteht eine Einrichtungswelt für anspruchsvolle
theobjects.at Möbel Accessoires Wohnaccesoires Möbel Online
41 Möbel Interieur aus Salzburg

Living Lounge Möbel Interieur aus Salzburg ? hier erfahren Sie mehr über unsere Produkte ... Living Lounge Living Lounge Möbel Interieur Innsbrucker Bundesstraße a .Stock Salzburg
livinglounge.at Salzburg Möbel Salzburg Wohnzimmer Salzburg Interieur
42 Exklusive TV HIFIMöbel HifiMöbel

Seit 1999 die Adresse für HifiMöbel TVMöbel TVRack TVPhonomöbel LCDStänder ... Warenkorb Artikel Warenwert ? Warenkorb anzeigen HiFi-Möbel TV-Möbel TV
hifi-moebel.at HifiMöbel TVMöbel TVRack TVPhonomöbel
43 Homepage Möbel Laimer Möbel

Möbel Laimer bietet Beratung und Konzeption für anspruchsvolle Wohnungsideen Design und Handwerk. ... Telefon Map Unsere Leistungen Planung Beratung Möbel Tischlerei Produkte Übersicht Küche
einrichtungshaus-laimer.at Möbel Laimer Möbel Laimer Palting
44 Möbel Online Möbel

Möbel online kaufen
xn--onlinembel-kcb.at Möbel Einrichtung Indoor Outdoor
45 Tischlerei Herbert Reisinger GmbH Herbert Reisinger GmbH tischlerei
8966
Aich
Tischlerei Herbert Reisinger GmbH Möbel Fenster Türen Sanierung ... Home Möbel Kontakt und Copyright Herbert Reisinger GmbH.
tischlerei-reisinger.at Tischlerei Herbert Reisinger Gmbh Steiermark
46 Möbel auf moebelhaus24.at Möbel

... Moebelhaus.at Alles zum Thema MöBEL Startseite Angebote Beiträge Jetzt kostenlos anmelden
moebelhaus24.at Möbel
47 Home Möbel King nach

Nach Wunsch unserer SaunaKunden haben wir unsere neue Tätigkeit eingeführt: als Meisterbetrieb bieten wir professionelle ... Home Möbel Vorzimmermöbel Küchenmöbel Garderobenmöbel Kinderzimmermöbel Badezimmermöbel Büromöbel
mobelkonig.at Nach Mass Möble Möbel King Sauna
48 Homextra Möbel Zeit homextra

Homextra Möbel Zeit Für Schönes Wohnen ... Homextra Möbel Rotenhofgasse Wien + e-mail Diese -Adresse
homextra.at Homextra Türkisches Möbelhaus Wien; Möbel Moebel
49 Möbel günstig online kaufen Möbel
8132
Pernegg
Möbel Betten Sofas oder Tische für Ihre WohnungHausEinrichtung gesucht? Bestellen Sie Ihre WohnEinrichtung ... Möbel sicher einfach online kaufen bei Möbilia Artikel ? Zum Warenkorb » Möbel Badmöbel
moebilia.at Möbel Betten Sofas Tische
50 Gebraucht moebel second hand gebraucht

handlel mit gebraucht moebel second hand furniture arredamenti di secondo mano ... GEBRAUCHTE MOEBEL WOHNZIMMER ESSZIMMER SCHLAFZIMMER VORZIMMER ZIERGEGENSTÄNDE KÜCHE ANTIKES KUNST
gebraucht-moebel.at Gebraucht Moebel Bilig Polovno Neuwertig Ocuvan
51 Pirker Design Trafik Pirker

Pirker Design Trafik Shop Möbel und Interior Design f�r bessere Geschäfte und ... ... für bessere Geschäfte. Einzigartig wie das Leben - Ihre neue Einrichtung von Pirker Möbel und Interior Design
pirkerdesign.at Pirker Möbel Interior Design
52 OnlineMöbelhaus Karakter | Möbel Karakter
6800
Feldkirch
Karakter Möbel und Wohnaccesoires. Karakter bietet Möbel aus massivem Palisanderholz/Sheeshamholz im Kolonialstil und im ... Willkommen beim Online-Möbelhaus »Karakter« - Möbel im Kolonialstil und modernen Blockdesign Möbel
karakter.at Karakter Möbel Accessoires Möbelversand
53 TISCHLEREI PÖLZL STIEGEN Tischlerei

Tischlerei Pölzl: Stiegen Küchen Türen Möbel. 8083 St. Stefan im Rosental. ... Stiegen Türen Möbel Kontakt Wir bringen Leben in Ihre Wohnräume! Unsere Tischlerei bietet
tischlereipoelzl.at Tischlerei Pölzl Bezirk Feldbach St. Stefan
54 Exklusive Outdoor Möbel exklusives
6091
Neu Götzens
EXKLUSIVES DESIGN: Die Agentur für Design Outdoor Möbel Ihr Vertriebspartner von exklusiven Gartenmöbel ... by JoomlaVision.Com Katalog Homepage IMPRESSUM Möbelagentur - EXKLUSIVES DESIGN - Oudoor Möbel für Sie!
exklusivesdesign.at Exklusives Design Outdoor Möbel Garten Möbel
55 Willkommen bei Hochreiter Möbel Hochreiter GmbH Hochreiter
8644
Mürzhofen
Hochreiter Möbel wir planen und realisieren Ihr Projekt
hochreiter-moebel.at Hochreiter Möbel Tischler
56 Tischlerei Mayer: Möbel und Tischlerei

Tischlerei Mayer fertigt Möbel nach Ihren individuellen Wünschen. Unser Repertoire umfasst Treppen/Stiegen Küchen ... Tischlerei Mayer - Möbel und Stiegen/Treppen nach Mass
tischlerei-mayer.at Tischlerei Möbel Treppe Stiege
57 Home Ebenhofer Martin Martin

Martin Ebenhofer. Rechberg. Möbel Handel Montage Service. "Möbel für Ihre Sonnenseite"
ebenhofer-moebel.at Martin Ebenhofer. Rechberg. Möbel Handel Montage
58 Möbel Tischlerei in Aschau netwerk Kreidl GmbH & CO KG Schellhorn
6275
Stumm im Zillertal
Die Möbel Tischlerei Schellhorn bietet Ihnen höchste Qualität und meisterliche Verarbeitung Egal ob ein ... infoschellhorn Unsere Ausstellung Öffnungszeiten Mo - Fr - und -Uhr
schellhorn.at Schellhorn Möbel Gastronomie Franz
59 Mira Möbel

Möbel online bestellen! Mira Möbel bietet günstige Möbel für Ihr Zuhause. ... Wohnzimmer Schlafzimmer Arbeitszimmer Esszimmer Sessel Küchen Garderoben Möbel Kindersofas Kindrbetten Sofa
miramoebel.at
60 Pierburg Möbel und Mehr Gerhard Pierburg GmbH Möbel
5142
Eggelsberg
Handelsagentur Gerhard Pierburg Maßhemden Möbel Geweihe
pierburg.at Möbel Hemden Agentur Maßhemden
61 Möbel Pietschnig Willkommen Tischler
9360
Friesach
Ihr Partner für tolle Möbel schöne Küchen Wohnraumplanung mit bestem Preis persönlicher ... - Möbel Pietschnig Ing. Veronika Kotzent-Pietschnig St. Veiter - Friesach
pietschnig.at Tischler Möbel Einrichtung Friesach
62 Möbeldepot ? Vintage Möbel möbel

Vintage Design Möbel Accessoires und Antiquitäten aus Asien und dem Orient bei Möbeldepot in ... Möbeldepot ? Vintage asiatische Möbel Möbeldepot. Arts - Interiors - Exteriors. Newsletter
moebeldepot.at Möbel Möbeldepot Indisch Indische Möbel
63 Möbel Design Tischler Staller

Tischlerei Staller erfahrene fachmännische und individuelle Beratung sowie die Einzigartigkeit der gefertigten Möbel ... Möbel Design Tischler Staller Suchen HomeMöbel Design Tischler Staller WerkstätteHandwerk
tischlerei-staller.at Staller Tischlerei Staller Satller Siegfried
64 AKTION SITWELL MÖBEL Dekorartikel

AKTION SITWELL MÖBEL : Dekorartikel für Innen und Außen Stühle Barhocker Drehstühle Lounge ... Gartenmöbel Kurzfristig benutzt oder .Wahl Ledergarnituren Lounge Möbel und Fauteuil Polstermöbel Restposten
aktion-sitwell-moebel.at Dekorartikel Für Innen Und Außen Stühle Barhocker Drehstühle
65 FADA Industrie Möbel Fada

FADA Industrie Möbel Interieurdesign
fada.at Fada Stefan Rozic Möbel Möbeldesign
66 Tischlerei Hausleitner » Home Tischlerei Tischlerei
4882
Oberwang
Home Tischlerei Hausleitner Möbel Küche Tischler Oberwang Mondsee ... SA Home Leistungen Küchen Möbel Türen Ess- und Wohnzimmer Schlafzimmer Gewerbe Gastrononomie
tischlerei-hausleitner.at Tischlerei Oberwang Tischler Hausleitner Möbel
67 Möbel Meister moebelmeister

Möbel Meister ein Meisterbetrieb der steirischen TischlerWerkstätten mit hohen Anforderungen an Qualität und Leistung.
moebel-meister.at Moebelmeister Moebel Meister Tischler
68 QOQ Ein Lounge SUNSIGN GMBH Hocker
32514
Traiskirchen
Ein Lounge Möbel das begeistert! QOQ lässt Grenzen zwischen Land und Wasser außen und ... . Ein Lounge Möbel das begeistert! QOQ lässt Grenzen zwischen Land und Wasser außen und innen Design
sunsign-qoq.at Hocker Sessel Sitz Sitzgelegenheit
69 Möbel Shop Franz Franz König GmbH Möbel
6263
Fügen
Im Möbelshop der Franz König GmbH finden Sie geschmackvolle Accessoires Möbel Schmuckschatullen ... Startseite Kategorien Accessoires Gewürzmischungen Möbel Wanddekoration Uhren Licht Kinder Musik Marke
moebel-shop.at Möbel Shop Franz König
70 Wohnideen Möbel Lampen Gartenmöbel Design
40549
Düsseldorf
Onlineshop für moderne Einrichtung mit Wohnideen für Möbel Lampen Leuchten Gartenmöbel und ... designklassiker industrie look landhaus leuchtmöbel lloyd loom massivholz modernes wohnen skandinavische möbel
borono.at Design Möbel Lampen Leuchten PUK
71 Tischlerei Feuerstein ? Fenster Josef Feuerstein GmbH & Co KG Josef
6714
Nüziders
Die Tischlerei Feuerstein fertigt Fenster Türen Küchen Möbel Wintergärten Spezialanfertigungen ... Küchen Tischlerküche Möbel Möbel Handwerkliche Perfektion Emotion in Holz und eine Wohnumgebung
tischlereifeuerstein.at Josef Feuerstein Feuerstein Tischler Nüziders
72 Möbel Design design

Der Möbel Design Guide ein Reiseführer zur Wohnkultur in Österreich. Darüber hinaus führt der ... Registrieren Anmelden Über uns Kontakt News Vorjahres-Trends Newsletter Archiv Möbel Design
moebel-guide.at Design Guide Interior Guide Einrichtung Info
73 Hanli Möbel Ihr möbelmontage
5121
Ostermiething
Wir sind Ihr zuverlässiger Partner für Möbel aller Art jetzt unverbindlich nachfragen!
hanli.at Möbelmontage Möbelaufbau Böden Türen
74 Ihr Möbelhaus für Polstermöbel Ihr

Möbel Küchen Ingolstadt von der Planung bis zum Einbau. Ihr Möbelmarkt in Ingolstadt ... und Hocker Couchtische TV und HiFi Möbel Eck- und Beistelltische Sideboards und Kommoden Regale
wohnorama.at Ihr Möbelhaus Für Polstermöbel Planungs Küchen
75 MÖBEL KARBIENER Handwerk MÖBEL

MÖBEL KARBIENER steht für Handwerk mit Tradition Planung mit Zukunft. MÖBEL KARBIENER in Lambach ... Home Planung Designmöbel Werkstatt Kontakt Home MÖBEL KARBIENER JEDES MÖBELSTÜCK
moebel-karbiener.at MÖBEL KARBIENER Karbiener Thomas Thomas
76 MöbelTrans sijam

MöbelTrans fuer Oesterreich und Ausland ... FIRMA IN GRÜNDUNG! Möbel-Trans-Umzug - UMZUG Rufen Sie uns an wir machen Ihnen ein Spezialangebot
moebel-trans.at Sijam Montage Umzug Lkw
77 Janka Esterhazy Restauratorin janka

janka esterhazy restauratorin historische möbel holzobjekte hasnerstraße 64 1160 vienna ... Home Portrait Arbeitsweise Leidenschaften Atelier Kontakt Jedes historische Möbel
janka-esterhazy.at Janka Esterhazy  esterhazy  wien österreich Möbelrestaurator
78 Polster Möbel Polstermöbelerzeu
3251
St. Georgen
Polster Möbel Werkstatt FELLNER St. Georgen St. Pölten ... ? Polstermöbelrestaurierung ? Matratzenerzeugung ? Fahrzeugtapezierung ? Accessoires ? Antike Möbel ? Über uns Kontakt
polster-moebel-werkstatt.at Polstermöbelerzeugung Kenzo Mulberry Und Ralph Lauren
79 ::: Magnes Möbel ... Robert

Robert Magnes Möbel ... denn Ihr Tischlermeister macht's persönlich.
magnes.at Robert Magnes Möbel Tischler Tischlermeister
80 Mode Online Shop Universal

Universal Versand Ihr Shop um Mode Kleidung Schuhe und Möbel günstig online ... Online Shop - Kleidung - Schuhe - Möbel kaufen Universal Versand Hier finden Sie ein umfangreiches
universal.at Universal Versand Online Shop Mode
81 Khandmade alte Möbel Khandmade

Khandmade Möbel und Wohnaccessoires in Salzburg: Sitzmöbel Sessel Stühle shabby chic ... Khandmade aus alt wird neu Möbel und Wohnaccessoires in Salzburg alte restaurierte Möbel
khandmade.at Khandmade Möbel Und Wohnaccessoires In Salzburg: Alte
82 Franz König GmbH franz könig gmbH Franz
6263
Fügen
Franz König GmbH in Fügen im Zillertal Stuck Weinkeller Trockenbau Möbel ... Weinkeller Wand- Deckengestaltung Badrenovierung Möbel Accessoires Beleuchtung Shop Referenzen Kontakt
stuckateur.at Franz König GmbH Fügen
83 Möbel Fundgrube Home Handel

Möbel Fundgrube Margarethen am Moos ... Anfahrt Möbel Fundgrube Möbel Fundgrube Mit Möbel Fundgrube zum neuen Look! Optik ist immer
moebel-fundgrube.at Handel Großhandel Second Hand
84 Gastronomieeinrichtung Gastroeinrichtung sowie KASON GmbH & Co. KG Kason
94496
Ortenburg
KASON Hersteller von Gastronomieeinrichtung Objekteinrichtung und Hotelzimmereinrichtung. Fabrikverkauf – gebrauchte Gastro Einrichtung – ... - . Uhr +++ Vertriebspartner für DE AT und CH gesucht! +++ Besuchen Sie KASON auf folgenden Messen
kason.at Kason Möbel Moebel Stühle
85 Stefan Kohlbacher Moebel Raumdesign kohlbacher
8580
Koeflach
Stefan Kohlbacher Moebel Raumdesign ... Stefan Kohlbacher Moebel Raumdesign Alte Hauptstrasse Koeflach
kohlbacher-design.at Kohlbacher Möbel Raumdesign Tischler
86 MÖBELOnlineshop für Wohnen Möbel

Im Möbel Versand von nero Möbeloase finden Sie günstige Polstermöbel aus Leder Esszimmerstühle ... Couchtische Eck- Beistelltische Ordnung und Aufbewahrung Anbauwände Regale Raumteiler TV-Möbel Accessoires
nero-moebeloase.at Möbel Versand Polstermöbel Aus Leder Esszimmerstühle
87 Schmalnauer Treppen Tischlerei

Treppen Geländer Türen Möbel Montage Reparaturen 4632 Pichl/WelsLand ... Schmalnauer Treppen Türen Möbel Montage Reparaturen Startseite Projekte Kontakt Schmalnauer Harald
schmalnauer-t.at Tischlerei Treppen Geländer Türen
88 Wood.at: Möbel online planen möbel

Plattform zur OnlinePlanung von Möbeln ... wood Möbel online planen wood ist ein Projekt der Lumplecker Holzindustrieberatung GmbH
wood.at Möbel Planen Internet
89 KÖLBL PROFIMONTAGEN Möbel kölbl
8511
St. Stefan ob Stainz
KÖLBL PROFIMONTAGEN Möbel Türen Parkettböden
profi-montagen.at Kölbl Profimontagen Profi Montagen
90 Altholzdesign Möbel
9131
Grafenstein
Möbel aus Alzholz ... sthon Möbel aus Altholz Startseite Projekte Kontakt Altes Holz neues Design Glashaus
sthon.at Möbel Aus Altholz ; Möbel Aus Holz
91 Schreinerei Wirth | Bucher wb
88339
bad waldsee
wb* schreinerei wirth|bucher bad waldsee objekteinrichtungen innenausbau möbel ... verbindung von form und funktion? mehr schreinerei wirth-bucher innenausbau objekteinrichtungen möbel
wirth-bucher.at Wb Schreinerei Wirthbucher Schreiner
92 Einrichtungen Möbel

Möbel Rantschl ? Küchen Fenster Türen Möbel 3DPlanung Übersiedlungen ... Möbel Rantschl Produkte Küchen Esszimmer Wohnzimmer Schlafzimmer Jugendzimmer Begehbare Schränke
moebel-rantschl.at
93 Eventausstatter EMSON Möbel emson

Eventausstatter EMSON Möbel und Technik für jede Veranstaltung: Barhocker Stehtische Hussen ... der VIP-Lounge der Kleinen Zeitung auf der Grazer Ferien-Messe. Lounge-Möbel und Technik von Emson.
emson.at Emson Mietmöbel Möbel Mieten Veranstaltung
94 Möbel Klein Möbel

Das Möbelhaus mit Herz und Stil ... . Viel Spaß wünscht Ihnen Ihr Team von Möbel Klein. Möbel Klein Wien Landstraßer Hauptstraße
moebel-klein.at Möbel Küchen Wohnzimmer Polstermöbel
95 Rattan möbel rattan

Hier finden Sie qualitativ hochwertige Design und die Gartenmöbel von künstlichen Rattan die die ... im Warenkorb € inkl. MwSt Komfort Rattan Möbel nur für Sie Call + Hängematte Aventura
rattanmobel.at Rattan Mobel Garten Rattanmobel
96 Möbel Ludwig Ludwig
1220
Wien
Möbel Ludwig 4 x in Wien. Wiens größtes Möbelhaus mit 40.000m² Ausstellungssfläche. Der Spezialist
moebel-ludwig.at Ludwig Einrichtung Möbel Küche
97 MayrSchulmöbel | Schuleinrichtung | Mayr Schulmöbel GmbH schulmöbel
4644
Scharnstein
Schulmöbel von Mayr bewahren Lernende vor Haltungsschäden. Entdecken Sie jetzt unsere moderne und ergonomische Schuleinrichtung: ... Möbel für den komfortablen und in jeder Hinsicht gesunden Schulbetrieb. In unserem Portfolio finden
mayrschulmoebel.at Schulmöbel Schuleinrichtung Ergonomische Möbel
98 Tischlerei Künzler Bizau | Tischlerei Künzler GmbH & Co KG Tischlerei
6874
Bizau
Tischlerei Künzler Bizau | Bregenzerwald | Vorarlberg Bezau Küchen Türen ... Küchen Küchen Küchen Küchen Schlafzimmer Bad Möbel Tische + Bänke Kleinmöbel Garderoben Türen
kuenzler.at Tischlerei Künzler In Bizau/Bregenzerwald. Küchen Türen
99 Möbelonline.at Informationen zum

möbelonline.at ist Ihre erste und beste Informationsquelle über möbelonline Hier finden Sie auch weitere ... möbel-online Weitere Links Der Inhaber dieser Domain parkt diese beim Domain-Parking-Programm
xn--mbel-online-rfb.at
100 Home Max Leitner OHG Möbel
4020
Linz
Möbel Leitner Der Einrichter Ihres Vertrauens! ... Beleuchtung Bilder Schauraum Aktuelles Aktuelles Möbel Leitner Newsletter Nanai Fronten Design Noteborn
moebel-leitner.at Möbel Leitner Einrichter Individuelles Einrichten
101 Willkommen in der Kinderstrasse Kindermöbel
1160
Wien
Mode Möbel für selbstbewußte Kinder ... Home Shop Mein Warenkorb Mein Konto AGB´s Widerrufsrecht Versand-Informationen Möbel Materialien
kinderstrasse.at Kindermöbel Kinderbekleidung Kinderkleider Möbel Kinderzimmer
102 Tischlerei Spatzenegger ~ Möbel Tischlerei

Tischlerei Spatzenegger Spatzenegger Tischler Tischlerei Möbeldesign Türendesign Möbel ... Tischlerei Spatzenegger Johann Spatzenegger - Möbel und Türendesign News Design Wohnen Türen
spatzenegger.at Tischlerei Spatzenegger Spatzenegger Tischler Bau
103 Tischlerei OBERASCHER Mondsee :: Tischlerei Oberascher GmbH & Co KG Tischlerei
5310
Mondsee
Tischlerei Oberascher Möbel zum Wohnen und Arbeiten
oberascher.at Tischlerei Tischler Möbel Türen Fenster Küchen Innentüren Hautüren
104 Moebelgoll.at  Diese Website steht zum

Diese Website steht zum Verkauf! moebelgoll.at ist die beste Quelle für alle Informationen die ... moebel-goll Domain erwerben This domain is FOR SALE - Diese Domain steht ZUM VERKAUF Weitere
moebel-goll.at
105 Pure Velvet Möbel Online

Stilvolle und besondere Möbel Dekorationsartikel zu tollen Preisen auch online! Lassen Sie sich ... New In Get the Look! Möbel Beleuchtung Accessoires Dekokissen Kinderzimmer Stoffe Tapeten Sale
purevelvet.at
106 Moebelarchitektur.at Blumberger

Menschen mit Liebe und Freude am Weg. Wir von Blumberger begleiten Sie mit Möbelarchitektur in ... moebel-architektur - Möbel-Architektur ÖFFNUNGSZEITEN MO - DO bis Uhr und
moebel-architektur.at Blumberger Reinhart Waidhofen Waidhofen/Th. Waidhofen/Thaya
107 Tischlerei Ernst Küchen Möbel Tischlerei Ing. Ernst Gmbh & Co. KG Tischlerei
9330
Althofen
Tischlerei Ernst Küchen Möbel Fenster Türen Klagenfurt Althofen Kärnten. Die Tischlerei Ernst steht für Tradition ... Tischlerei Ernst Althofen Klagenfurt Kärnten Küchen - Möbel - Fenster - Türen Die Tischlerei Ernst
tischlerei-ernst.at Tischlerei Fenster Möbel Türen
108 Sanierung Renovierung Fenster Türen Sanierung

RUBUS Rund um Bau Sanierung Wir sind Ihr starker Partner bei Sanierungen
rubus.at Sanierung Sanierungen Fenster Türen Möbel Renovierung Renovierungen Wien
109 Möbel einfach Online bestellen

Moebella24 Möbel Onlineshop Möbel einfach Online bestellen Sofas Betten Essgruppen ... Reggio ? In den Warenkorb Essgruppe Rustico Vintage Style Landhaus Esszimmer Möbel von
moebella24.at
110 Easy Möbel Shop Steiner Shopping GmbH Möbel
3383
Hürm
... Kontakt Steiner Shopping GmbH Easy Möbel® Hainberg Hürm - Mail
easymoebel.at Möbel Wohnen Schlafen Einrichtung
111 Kastlwerkstatt Home Kastl
1130
Wien
Möbelunikate Recycled Wohnaccessoires Möbel Workshops ... Home Möbel Wohnaccessoires Plätzchen gesucht Recycled Accessoires Schon vergeben Making of
kastlwerkstatt.at Kastl Möbel Accessoires Recycled
112 Möbel und Bautischlerei Schösser

Qualität steht bei uns an erster Stelle ! Diese beginnt schon bei der fachkundigen Beratung ... Möbel- und Bautischlerei Schösser - Lanersbach - A Tux
tischlerei-schoesser.at Schösser Thomas Kreativ In Holz
113 Farkas Moebel Tischlerei

Ihr Meistertischler Wohndesign Bau und Möbeltischlerei Bau und Möbeltischlerei · Farkas Alois ... ÜBER UNS BERATUNG PLANUNG AUSFÜHRUNG KONTAKT Einrichtung-Möbel RAUMGESTALTUNG Küche Esszimmer
farkas-moebel.at Tischlerei Möbeltischlerei Bautischler Alois
114 Suche Möbel Home CONST

Suche Möbel Marktplatz zum Suchen und Finden Ausstellen und Verkaufen neuer und ... Finden Ausstellen Verkaufen neuer neuwertiger sowie gebrauchter Möbel. Suchemoebel bietet
suchemoebel.at CONST IT CONSULTING
115 IdeaForDesign.at Interieur auf Interieur

Wir erstellen den Vorschlag und die Visualisierung. Darüber hinaus bieten wir eine rasche Montage und
ideafordesign.at Interieur Auf Massenfertigung Böden Türen
116 HOME | ConverTTable iPhonetable

Der High End Autosimulator / Fahrsimulator inkl. RECARO Sitz als Design Möbel für home ... und Sie habenkeinen Platzverlust! Vielmehr ist dieses Möbel eine Skulptur die Ihrem Raum mehr Atmosphäre verleiht
coffeetable.at IPhonetable Tableconnect Multitouch Simulator
117 Traditionelle Möbel handwerklich Möbel

Traditionelle Möbel fügen sich in keine schnelllebigen Trends sondern überdauern Mode und bleiben sich
moebel-romantik.at Möbel Holz Natur Landhaus
118 Möbel günstig online kaufen
2431
Enzersdorf an der Fischa
KM Handel ist der günstigste Möbel online shop mit unschlagbaren Preisen bei km möbel . ... Shop über uns Kontakt Shop Österreichs bester Online-Shop für Möbel Jetzt NEU Bezahlen
km-handel.at
119 Filzer Möbel Willkommen tischlerei

Kreativmöbel Tischlerei Filzer ... stefanmoebel-filzer
moebel-filzer.at Tischlerei Filzer Holz Leogang
120 Schloss Grubhof – Wohnen Schloss

Schloss Grubhof wurde 1325 erbaut und war die ehemalige Residenz des Königs von Bayern
schloss-grubhof.at Schloss Schlosshotel Möbel Betten
121 Möbel austria – Tage Möbel

Österreichische Möbelfachmesse vom 7. – 8. Mai 2013 im Messezentrum Salzburg ... Besucherinfos Aussteller News Presse Kontakt Registrierung möbel austria
moebel-austria.at Möbel Austria Messe Fachmesse
122 Moebelmarkt.at Informationen zum

moebelmarkt.at ist Ihre erste und beste Informationsquelle über moebelmarkt Hier finden Sie auch weitere ... moebel-markt Domain erwerben This domain is FOR SALE - Diese Domain steht ZUM VERKAUF Domain
moebel-markt.at
123 Wunderbar durchdachte Möbel LIVING SIEDENDORF KG
3400
Klosterneuburg
DesignerMöbel mit einer besonderen Funktionalität handgefertigte Wohnaccessoires und hochwertige Wollteppiche mit geometrischen Mustern. ... Start Produkte Magnetwände Magnete Teppiche Möbel Über uns Service Kontakt Start Produkte
living-siedendorf.at
124 GLAFO MÖBEL Wohnzimmer

Möbel aus Österreich
ninimax.at Wohnzimmer Wohnmöbel Schlafzimmer Schränke
125 Best Möbel

Best Möbel
bestmoebel.at
126 Modl.at :: Modl GmbH Modl Ges.m.b.H. Modl
5202
Neumarkt am Wallersee
Modl GmbH Tischlerei Möbel Objekteinrichtung Küchen ... Produkte Jobs Kontakt MODL - kreativ einrichten die Tischlerei für Ihre Möbel Copyright Modl
modl.at Modl GmbH Tischlerei Möbel Objekteinrichtung
127 Tischlerei Pfister: Möbel nach Möbel
6721
Thüringerberg
Tischlerei Pfister Walter ... Küchen Wohnzimmer Schlafzimmer Verschiedene Möbel Fenster Türen Altbausanierung Kontakt
pfister-holz.at Möbel Fenster Schlafzimmer Walls Türen Betten Garderoben Tischlerarbeiten
128 Möbelshop.at Informationen zum

möbelshop.at ist Ihre erste und beste Informationsquelle über Möbel shop Hier finden Sie auch ... Domain erwerben infodomcollect DE US möbel
xn--mbel-shop-07a.at
129 BöhmMitsch: Möbel nach Maß Böhm-Mitsch GmbH Böhm
2244
Spannberg
Die Tischlerei BöhmMitsch im Weinviertel fertigt Ihre Möbel nach Maß: Küchen Wohn Schlafzimmer
boehm-mitsch.at Böhm Mitsch Möbel Möbel Nach
130 Bambusmöbel Möbel aus Bambus Bambusmöbel

... ... ...sich Ihren Wohnraum mit Möbel aus Bambus einrichten? ...in einem Bambusbett ein neues Schlafgefühl erleben
bambus.co.at Bambusmöbel Bambusmoebel Möbel Aus Bambus Bambusbett Bambusbetten Gelbett
131 Das Online Möbelhaus XXXLutz KG
4600
Wels
Möbel online kaufen bei XXXLutz ? Möbel Leuchten Wohnaccessoires ? Das Online Möbelhaus ... abonnieren XXXL Preisepass alles über den XXXL Preisepass Möbel Wohnzimmer Polstermöbel Wohnwände
xxxlutz.at
132 Möbel Computer Kleinanzeige

Kleinanzeigen kostenlos inserieren verkaufe kaufe suche Gebrauchtwaren Secondhand Computer ... Inserate Diverses Fahrrad Mountainbike TV Hifi Elektro gebraucht Inserate Musik Möbel Sitzgarnitur
haustiermarkt.at Kleinanzeige Kostenlos Inserieren Verkaufe Kaufe
133 Möbel und Raum Asiamöbel
8020
Graz
Exclusive Möbel und Accessoires aus Asien mit Einmaligkeit Lebendigkeit und individuellem Ausdruck ... Vermietung und Sonstiges Newsletter AGB Telefon Adresse Anfahrstplan Herzlich Willkommen bei Möbel
moebelundraum.at Asiamöbel Chinamöbel Hochzeitsschrank Asien
134 CityAntik Jugendstil Wien Jugendstil

CityAntik Jugendstil Wien bietet Jugendstil Moebel Thonet Glas Keramik Schmuck
city-antik.at Jugendstil Wien Goldscheider Meissen Jugendstil
135 Möbel nach Maß

Tischlerei Erwin Kalischko in Neustift / Pühret. Qualitative hochwertige Möbel aller Art termintreu ... Qualitative hochwertige Möbel und Einrichtungen nach Maß aller Art. Termintreu und mit optimalem Preis
kalischko.co.at
136 Moebeltransport.at Informationen zum

moebeltransport.at ist Ihre erste und beste Informationsquelle über moebeltransport Hier finden Sie auch weitere ... + moebel-transport Weitere Links Der Inhaber dieser Domain parkt diese beim Domain
moebel-transport.at
137 Gebrauchte Möbel: Gebrauchtmöbel Kleinanzeigen

Der kostenlose Anzeigenmarkt für gebrauchte Möbel! Gebrauchtmöbel kaufen und verkaufen! Unbegrenzt inserieren und gratis für ... Sofagarnitur Designer Eckbank Couchtisch Möbel für Gastronomie Neue
moebelanzeigen.at
138 Tischlerei Feldkirch Kurt Tischlerei

Tischlerei Feldkirch Möbel Küche Bad Wohnzimmer Esszimmer Schlafzimmer
moebelmeier.at Tischlerei Feldkirch Möbel Küche
139 Air Style Designer
8010
Graz
Bei AIRandSTYLE finden Sie aufblasbare Design Möbel für den indoor und outdoor Bereich. Unsere aufblasbaren ... -Adresse Passwort Passwort vergessen? Registrieren aufblasbare Designer Möbel erweiterte Suche
airandstyle.at Designer Möbel Eventmöbel Möbel Für Events Möbel Für
140 Möbel nach Maß Flewid Media GmbH möbel
29227
Celle
... Individuelle Möbel nach Mass online konfigurieren und bestellen. Moderne Designmöbel aus Massivholz
damao.at Möbel Nach Mass Designmöbel Möbel Online Konfigurieren Möbeldesign
141 Joha Türen Baumart

Joha Türen. Baumart Wohnraumdesign Möbel nach Maß Spezialanfertigung. Qualität besteht! ... officejoha-team » Nachricht schliessen! Joha Türen Möbel by Joha Türmodelle Service Bilder Kontakt
joha-team.at
142 Smart Living ? Möbel SMART LIVING GmbH
1070
Wien
Smart Living in 1070 Wien sind Ihre Ansprechpartner für Wohnkonzepte aus modernen Möbel Beleuchtungssysteme ... für Einrichtung. Unser Spektrum umfasst exquisite Möbel Raumplanung und Inneneinrichtung. Egal ob Möbel
smartliving.co.at
143 Moebel hochwertige Möbel SOLEUM GmbH bambusmöbel
4230
Pregarten
... neue Wohlfühlbereiche schaffen! Sie möchten... ...sich Ihren Wohnraum mit Möbel aus Bambus einrichten
moebel.or.at Bambusmöbel Bambusmöbel Babmusmöbel Bambusmöbel Bambus Möbel Bambusmöbel Möbel
144 Home C. Fank Plattenzuschnitt
8250
Vorau
Plattenzuschnitt Fank Qualität für Heimwerker und Profitischler. Plattenzuschnitte Bekantungen Tischlereizubehör Beschläge ... Willkommen bei C. Fank Möbel! Wir fertigen für Tischler und Möbelhändler Möbel für den gesamten Wohnbereich
c-fank.at Plattenzuschnitt Selbstbaumöbel Platten Arbeitsplatten
145 Tischlerei Josef Kranzl kranzl

Tischlerei Josef Kranzl Niederösterreich Massivholzmöbel Einzelanfertigungen Vintagemöbel Klassische Möbel
tischlerei-kranzl.at Kranzl Tischlerei Holz Design
146 Toscana Möbel

Toscana Möbel
toscanamoebel.at Möbel Massivholz
147 Spechtenhauser :: Fenster Holz- und Glasbau GmbH
6020
Innsbruck
?? Unser Familienunternehmen wird höchsten Qualitätsansprüchen im Bereich Möbel Küchen Glas Fenster ... Erfahrung handwerkliche Präzision und Fenster in Meister-Qualität. Möbelbau Möbel und Innenausbauten
spechtenhauser-moebel.at
148 Vintage and Contemporary Möbel

Shop Antiquitäten Vintage MidCentury und Contemporary Möbel und Lampen von den besten Händlern ... aus dem . Jahrhundert und früher Neues in Vintage Möbel Möbel Alle Möbel Sitzmöbel Tische Aufbewahrung
pamono.at
149 Tischlerei INHolz Schladming Winkler Steiner OG Tischlerei
8970
Schladming
Tischlerei InHolz in Schladming: Individuelle Möbel für Ihren individuellen Geschmack. Wir nehmen uns Zeit für ... und vor allem mit Verlässlichkeit unsere Kunden überzeugen. Individuelle Möbel für Ihren individuellen Geschmack. Wir nehmen
in-holz.at Tischlerei InHolz Schladming Steiermark Österreich
150 Gartenmöbel Exclusive Möbel IHP - Ihr HandelsPartner GmbH & Co. KG Gartenmöbel
6020
Innsbruck
Ihr Spezialist für Gartenmöbel Rattanmöbel in Österreich. Exclsuive Möbel für Garten und Terasse. Tirol ... Kaufabwicklung Schauraum Sicher Einkaufen Empfehlung fritz-Sitzsack moebel-rattan ihp.at the-green-pot Garino
moebel-garten.at Gartenmöbel Rattanmöbel Polyrattanmöbel Online Shop
151 Möbel Messestand und Möbel

Tischlerei und MassMöbelHerstellung sowie Objekteinrichtung FranekEibl GmbH in Adnet beei Salzburg Österreich Tel +43(0)624585074
passt.at Möbel Einrichtung Möbelbau Einrichtungen
152 KWAT :: Nina Habe
8160
Weiz
KWAT :: Nina Habe :: Weiz Steiermark Österreich Produktdesign Design Malerie ... KWAT DESIGN SOLUTIONS Home About Raumgestaltung Möbel Accessoires Brett KH Schuhblock VE
kwat.at
153 Polsterprofi Einrichten Wohnen Markenmoebel

Markenmoebel Inneneinrichtung Innenausbau Hoteleinrichtung Designermoebel Landhausküchen Schreinerei Innenarchitektur
polsterprofi.at Markenmoebel Inneneinrichtung Innenausbau Hoteleinrichtung
154 Startseite Putz Möbel Putz Möbel GmbH logo
8230
Hartberg
Ihr Einrichtungspartner in Hartberg. Erhalten Sie bei uns viele neue Wohnideen und Tipps vom Profi. ... Dekoideen Putz Möbel bei Facebook Besuchen Sie uns auf unserer Facebook-Seite. mehr lesen Küche planen
putzmoebel.at Logo Moebel Wohnen Wohnideen Abholmarkt
155 MÖBEL NACH MASSINNENAUSBAUGESCHÄFTSEINRICHTUNGFENSTERTÜRENTORE TISCHLEREI
1090
Wien
Tischler 1090 Wien Maßanfertigung Holzdesign ... So finden Sie uns Produkte Küchenmöbel Inneneinrichtung Möbel nach Maß Einzelmöbel Individuelle
tischlerei-wolfram.at TISCHLEREI 1090 Wien Möbel Nach Mass
156 WebTischler Natur Möbel Tischler

Hier erfahren Sie alles über individuelle persönliche und passgenaue Einrichtungen ... webTischler - Natur Möbel Design Schauptmayr Herzlich Willkommen Man kann einen Menschen
webtischler.at Tischler Tischler Webtischler Webtischler
157 Küchenstudio Bergheim mit Tischlerei

In Bergheim nahe Salzburg finden Sie das Küchenstudio Bergheim und die Tischlerei Klein. ... in Bergheim erzählen Sie uns von Ihren Vorstellungen und wir erstellen individuelle und handgefertigte Möbel
tischlerei-klein.at
158 GRABNER MÖBEL Baden Wien  Hochrainer GmbH
2500
Baden
Seit 1969 entscheiden sich Kunden für GRABNER MÖBEL in Baden bei Wien. Verwirklichen Sie gemeinsam ... GRABNER MÖBEL Baden Wien Aktuelles Unternehmen Service von A-Z -D Online Küchenplaner Wohnen
grabnermoebel.at
159 Sofa Shop online Designer

Sofashop24 ist der online Shop für exklusive Sofas Ledersofas und schönen Wohnlandschaften. Kaufen Sie ... und Betten aus dem Designer Möbel Onlineshop von Sofashop Hotline Menü Home Wohnzimmer
sofa-dreams.at
160 Teak Gartenmöbel und Vollholzmöbel terrassenmöbel
8042
Graz
Als der grösste Teak und VollholzMöbelAnbieter in Österreich haben wir ständig grössere Mengen von Teakholz ... Teak Gartenmöbel - Vollholzmöbel - Massivholzmöbel - Möbel nach Mass online kaufen AGB Kontakt
fantasteak.at Terrassenmöbel Teakholz Teak Gartenmöbel Gartenmöbel
161 AnaZard Shabby Chic keywords
1230
Wien
Onlineshop für Shabby Chic Vintage Landhausstil Homedecoration Accessoires Möbel Leuchten ... für ? Home Decoration ? Wohnaccessoires ? Möbel ? Modeschmuck ? ? Shabby Chic ? Vintage ? Landhausstil
anazard.at Keywords Kommagetrennt
162 Planungsbüro Hermann Lammerhuber planungsbüro

Das Planungsbüro Lammerhuber ist spezialisiert auf Innenraumplanung die Erstellung von Rohplänen und Innenplänen ... Start Planung Möbel Samina Referenzen Kontakt You need to upgrade your Flash Player Wir setzen
planung-lammerhuber.at Planungsbüro Lammerhuber Innenplanung Raumplanung Innenarchitektur
163 Weißenbek Der energetische

Weißenbek Möbel Design Montage Energetik Feng Shui Radiästhesie ... officeweissenbek - Website www.weissenbek Möbel - Design - Montage - Energetik - Feng Shui
weissenbek.at
164 Amtmann: Tischlerei Innenausbau Möbel
5450
Werfen
Amtmann baut Möbel mit höchster individueller Funktionalität. Funktionalität verstehen wir als das Zusammenspiel von ... Amtmann baut Möbel mit höchster individueller Funktionalität. Funktionalität verstehen
amtmann.co.at
165 Joha Baumart

Joha Türen. Spezialist Inneneinrichtung Wohnraumdesign Möbel nach Maß Spezialanfertigung Tischlerei ... Joha Türen Baumart Joha Möbel Joha-Türen Baumart Möbel by Joha Kontakt Home Willkommen bei Joha
joha.at
166 Ergonomie: Ergonomische Büromöbel

Ergonomie! Infos über ergonomische Möbel für Büro Wohnung Arbeitsplatz. » Bürostuhl » Schreibtisch ... Übersicht Ergon Tischgestell Spine² iMove Vital-Office Ergonomie Vital-Office Bambus Möbel Vital-Office
ergonomie-katalog.at
167 Thalia möbel wohnform löffler möbel

Thalia Möbel im 16. Bezirk in Wien fuehrt Planungen EinrichtungsPlanung Einrichtungsplanung von Qualitätsmöbel in edle
moebel-thalia.at Möbel Wien Planungen Thalia
168 Apuria Glas

einzigartige Möbel
apuria.at Glas Handwerk Holz Möbel
169 Mode Online Shop | Otto GmbH
8020
Graz
OTTO Versand: Der ?????OnlineShop für Mode Lifestyle Schuhe Möbel und mehr. Bequem ... . Möbel Möbel . Heimtextilien Heimtextilien . Baumarkt Baumarkt . Spielzeug Spielzeug . Marken Marken
ottoversand.at
170 M24austria.at M24 GmbH M24austria.at
96482
Ahorn - Triebsdorf
Professionelle und preiswerte Möbel für Gastronomie Gewerbe und Handel bei m24austria.at. Hier finden Sie ... von Einzelteilen und Ersatzteilen für unsere Möbel über Stoffe in verschiedenen Materialien und Farben
m24austria.at M24austria.at Möbel Inneneinrichtung Stühle
171 Möbelcorner Germ GmbH in

Bei Möbelcorner Germ GmbH in 1050 Wien Margareten finden Sie Möbel nach Maß für Küche ... Wir sind Ihr freundliches und kompetentes Fachgeschäft in Sachen Möbel nach Maß Küchen/Einbauküchen Küchenumbau
moebel-germ.at
172 Tischlerei Neunkirchen

Tischlerei Wolfgang Schaller ? Ihr Tischler für Möbel Fußböden Türen Einrichtungen ... Möbel nach Mass Fußböden Türen Einrichtungen Reparaturen und Änderungen Übersiedelungen Herzlich
tischlerei-schaller.at
173 Home Klinar2 Handels Klinar2 Handels OG fenster
9872
Millstatt
Der Spezialist für Fenster Türen In OutdoorMöbel Physiotherm Tischlerarbeiten ... Referenzen Lage Karl Klinar In- Outdoor-Möbel Schauraum Thomas Morgenstern Platz Seeboden
klinar2.at Fenster Türen Möbel Physiotherm
174 Startseite Logo Möbel Putz Möbel GmbH logo
8230
Hartberg
Ihr Einrichtungspartner in Hartberg. Erhalten Sie bei uns viele neue Wohnideen und Tipps vom Profi. ... Sie jetzt unsere Online-Gutscheine -Einfach und sicher direkt online! mehr lesen Logo Möbel bei Facebook Besuchen
logo-moebel.at Logo Moebel Wohnen Wohnideen Abholmarkt
175 Greiner Möbel
2304
Orth an der Donau
Greiner Möbel www.greinermoebel.at Objekteinrichtung Hoteleinrichtung TürenSonderanfertigungen Tischlerei www.judithkeles.com
greinermoebel.at
176 Mothergoose Klassisch zeitlose mothergoose

Klassischzeitlose Möbel Interior Textilien und Spielsachen für Mädchen und Buben von 08 ... Klassisch zeitlose Möbel Textilien und Spielsachen für Mädchen und Buben von bis Produkte
mothergoose.at Mothergoose Calice Trauttmansdorff Wallner
177 Möbel online günstig kaufen
10623
Berlin
Mehr als 2000 Möbel günstig im Online Shop bei KaufUnique.at. Dauertiefpreise bei allen Möbeln ... quadratisch Sideboard Kommoden TV-Möbel Wohnwand LED-Möbel Wandkonsole Konsolentisch Elektrokamin
kauf-unique.at
178 Henders Hazel Henders

Henders Hazel kreiert Möbelmode. Möbel aus eigenem Atelier angefertigt von Fachkräften. ... Schränke Buffetschränke Bücherregale Highboards Lagerschränke Sideboards TV-Möbel Vitrinen Sofas -sitzer
hendersandhazel.at Henders Hazel Kreiert Möbelmode. Möbel Aus Eigenem
179 Home: alles im griff GRIFF

PRODUKTION UND VERTRIEB VON GRIFFEN ALLER ART IM SPEZIELLEN FUER MOEBEL UND EINRICHTUNG ... für Möbel verbunden sind. Von . bis . Februar sind wir wieder auf der ZOW vertreten und freuen uns schon
allesimgriff.co.at GRIFF GRIFFE ALUMINIUMGRIFFE EDELSTAHLGRIFFE HOLZGRIFFE MOEBELFUESSE DESIGN MOEB
180 WohnARTStudio MÖBEL HALTER wohnart

... MÖBEL HALTER Garant für gutes Wohnen Terminvereinbarungen unter ab ..
wohnart-studio.at Wohnart Möbel Halter Bruck Halter
181 Günstiger Baby OnlineShop | Kinderwagen
01665
Käbschütztal
Günstige Babyausstattung in unserem Baby Familienportal mit Kaufempfehlungen und Tipps rund um Baby ... Möbel Kinderzimmer-Ausstattung Die Einrichtung des Babyzimmers bzw. Kinderzimmers richtet sich ganz
baby-und-kind.at Kinderwagen Baby Shop Kindermode Kinderzimmer Möbel Still BH
182 In Baden bei Wien Hochrainer GmbH
2500
Baden
Seit 1969 entscheiden sich Kunden für GRABNER MÖBEL in Baden bei Wien. Verwirklichen Sie gemeinsam ... Wohlfühlen Kochschule Rezepte Kontakt Grabner Möbel im neuen Gewand Neuer Name ? gleiche Qualität
derwohnraumgestalter.at
183 Brege Möbel Sitzmöbel Stuhl

Familienbetrieb Brege Möble aus Wenns im Pitztal stellt Sitzmöbel und Tische aus eigener Produktion her. ... Brege Möbel Wir sind ein professionelles Unternehmen aus Wenns im Pitztal spezialisiert auf Fertigung
brege-moebel.at Stuhl Sessel Hocker Barhocker
184 Hase Kramer | Tischler
6850
Dornbirn
Tischler aus Vorarlberg. Neue Küchenideen im Küchenstudio Dornbirn.Wir sind im hochwertigen Möbel und Innenausbau tätig. ... in Dornbirn. Küchen und Möbel nach Maß. Schauraum Vorarlberg Dornbirn Innenstadt Eisengasse a. Tel
hase-kramer.at Tischler Aus Vorarlber Dornbirn Kuechen
185 Home Tischlerei Weber Tischlerei
8672
St. Kathrein a. H.
Tischlerei Weber Ihre Tischlerei in St. Kathrein a. H. im Bezirk Weiz. Beratung und Planung ... Leistungen Referenzen Unternehmen Aktuelles Kontakt Möbel mit Geschmack Einfach wohlfühlen Küchen nach Mass
tischlerei-weber.at Tischlerei Weber St. Kathrein Am Hauenstein
186 Hochwertige gebrauchte Büromöbel Gebrauchte

Gebrauchte Büromöbel billig günstig preiswert mieten kaufen Wien Niederösterreich ... Gebrauchte Büromöbel günstig - mieten - kaufen - Bene Möbel - Hali Möbel - Neudörfler - Sitzmöbel
moebelmieten.at Gebrauchte Büromöbel Billig Günstig Preiswert
187 Altholz Tischlerei Antikholz altholz

Der auf Altholz spezialisierte Tischler in Salzburg informiert über Möbel aus Antikholz wie z.B. Türen
antikholzwerkstatt.at Altholz Möbel Tischlerei Altholzmöbel Tischler Antikholz Antikholzmöbel Antiquit
188 Tischlerei Thaler Tischlerei
9842
Mörtschach
Wir erzeugen Ihre Möbel nach Maß und Wünschen. So wird Ihr Traum von schöner Wohnen ... Meisterbetrieb hochwertige Möbel die Ihren Wünschen und Bedürfnissen entsprechen. Ausgewählte natürliche
tischlerei-thaler.at Tischlerei Möbel Stiegen Mörtschach
189 Willkommen bei GEA GEA

GEA MÖbel und Schuhe und mehr
gea.at GEA MÖbel Schuhe
190 Tischlerei Freudenthaler GmbH Wohncharakter Altenberg

Tischler Altenberg Freudenthaler Möbel
wohncharakter.at Altenberg Freudenthaler Möbel Tischler
191 Friedrich Otto Schmidt FOS
1090
Wien
Spezialist für Planung und Anfertigung von Inneneinrichtung sowohl als auch auf fachgerechte Restaurierung und ... Restaurierung und Kopie alter Möbel spezialisiert ist. Entsprechend der Tradition des Unternehmens werden seit
fos.at FOS Möbel Restaurierung Innenarchitektur
192 Möbel nach Maß
4451
Garsten
... möbel-dimitrov officemoebel-dimitrov Home Unsere Firma Projekte - Galerie Lieferanten
moebel-dimitrov.at
193 Privileg Technik Möbel Online QUELLE

QUELLE Versand 300.000 Artikel | Möbel Technik Privileg günstig online kaufen | ... Monitore NF Mailing KW Rühren Mixen Notebooks QUELLE - Möbel Privileg Garten und Baumarkt kaufen
quelle.at QUELLE Online Shop Österreich
194 FEHLENDE ÜBERSCHRIFT CoolesHandwerk

CoolesHandwerk Tischlerei Schallert Schallert Mario Cooles Handwerk Tischlerei Mario Schallert Möbelbau Küchen Sonderanfertigung Design Möbel ... FEHLENDE ÜBERSCHRIFT Küchen Bad Möbel Sonderanfertigung Kontakt Links Gästebuch FEHLENDE
cooles-handwerk.at CoolesHandwerk Tischlerei Schallert Schallert Mario Cooles Handwerk Tischlerei
195 AWEST Shop AWEST

AWEST Shop Ladenbau Ladeneinrichtung Geschaeftseinrichtung Ladenbedarf Displays POS
awest.at AWEST Shop Ladenbau Ladeneinrichtung
196 Designermöbel online kaufen im Designermöbel

Designermöbel Möbel namhafter Marken Online kaufen und inspirieren lassen. ?Qualität ?Große Auswahl ?100% ... Registrieren + HOME - DESIGN - LIFESTYLE % sicher einkaufen Toggle navigation MENU Möbel
nunido.at Designermöbel Möbel Einrichtung Sofas
197 Wiesner Möbel .:. Home Einrichtung

Wiesner Möbel | Individuelle Erzeugung von Gästezimmer Hotelzimmern und Einrichtungsobjekten
wiesner-moebel.at Einrichtung Objektgestaltung Möbelerzeugung Handel
198 Tischlerei Walter Trattner..........Möbel aus Tischler
8162
Passail
Tischlerei Walter Trattner Möbel aus Meisterhand
trattner.at Tischler Tischlerei Tischlermeister Meisterbetrieb
199 Tischlerei Lehner Möbel
4611
Buchkirchen
Tischlerei Lehner Möbel und Türen nach Maß
tischler-lehner.at
200 Möbel mit zeitlosem Klang Symphonic GmbH symphonic
8184
Anger
Möbel mit zeitlosem Klang Symphonic GmbH
symphonic.at Symphonic Objektausstatter Hotelausstatter Möbelhersteller
201 Deisl Möbel

... Javascript Menu by Deluxe-Menu Deisl Möbel
deisl-moebel.at
202 Andreas Leibnitz Möbelrestaurator Restaurator

Restaurator Andreas Leibnitz. Reversible Restaurierung von Holzobjekten wie Möbel Kunstgegenständen ... Alte Möbel zu besitzen und mit ihnen zu leben bedeutet eine emotionale Bindung zu bleibenden
andreasleibnitz.at Restaurator Restaurierung Kunst Tischler Antik Antiquitaeten Moebel Polstermoebe
203 Tischlerei Walter Haberl Tischlerei

Tischlerei Walter Haberl Ihr Meisterbetrieb Möbel Fenster Türen Stiegenbau ... Möbel Fenster Türen Stiegenbau Parkett und Blindbodenverlegung Inneneinrichtungen
tischlerei-haberl.at Tischlerei Haberl Möbel Fenster
204 Tischlerei Technisches Buero Ing. Tischlerei
4551
Ried im Traunkreis
Wir fühlen uns verpflichtet umweltkonforme Produkte zu produzieren umweltverträgliche Materialien zu verwenden und ... zu verwenden und garantieren ein optimiertes Design und Alltagstauglichkeit unserer Möbel. Langlebige
mistlberger.at Tischlerei Technisches Büro Möbel Aussengestaltung
205 Moebelfink.at

... moebel-fink Unsere Seiten befinden sich im Aufbau. Besuchen Sie uns wieder. Fragen postmaster
moebel-fink.at
206 Willkommen auf der Startseite Restaurator

Restaurator Andreas Scheinast. Reversible Restaurierung von Holzobjekten wie Möbel Polstermöbel Kunstgegenständen und Vergoldungen. ... Referenzenliste Angebot Möbel Das Berufsbild des Restaurators Neueste Nachrichten Bericht Bawag Filiale Bericht
scheinast.at Restaurator Restaurierung Kunst Tischler Antik Antiquitaeten Moebel Polstermoebe
207 Atelier Majestic Tiger Individuelle
1140
Wien
Individualität für deine Möbel! Kunstmöbel Wohnen Design Lifestyle WIEN Vintage ... Atelier online shop Möbel Wohnaccessoires Zubehör möbelwerkstatt Workshops Neue Seite Inspiration
majestictiger.at
208 Aumeier Möbel aumeier


aumeier.at Aumeier Schönau Schoenau Tischler
209 Tischler Unternehmen Krzeptowski KG tischler

Wir sind ein Tischler Unternehmen mit viel praktischer Erfahrung Tradition ... vor dem Tischlerhandwerk. PROJEKTE Planung und Erzeugung Möbel Privatkunden Firmenkunden Klein und große Objekten
krzeptowski-kg.at Tischler Krzeptowski Tischlerei Tischlermeister
210 La Maison d'Elisa Möbel
1070
Wien
Im französischen WohndekoShop La Maison d'Elisa finden Sie Möbel und Wohnaccessoires im französischen Landhausstil. ... schönen Farben und schlichten Materialien. In meinem Shop finden Sie Möbel und Wohnaccessoires
maison-elisa.at Möbel Wohnaccessoires Französischer Landhausstil Shabby
211 Tischlerei Schober aus Lofer Tischlerei
5090
Lofer
Tischlerei Schober aus Lofer Handwerk mit Idee und Verstand. Traditionelles Handwerk moderne Wohnkonzepte ... der Tischlerei Schober in Lofer. In unserer Werkstatt fertigen wir aus besten Rohstoffen besondere Möbel
tischlerei-schober.at Tischlerei Schober Lofer Planung Möbel Wohnen Küche Bautischlerei
212 Möbel Pommer | Es Pommer

... Service Aktuelle Projekte Über Möbel Pommer Jobs Großhandel Wegweiser Kontakt Eigene Erzeugung
pommer.at Pommer Möbel Schlafzimmer Küche
213 Alles für ein schönes möbel

Mit LionsHome findest du neue Wohnideen exklusive Tipps von unseren Einrichtungsexperten und günstige Möbel ... Million Angeboten. Möbel Badmöbel ? Bar-Möbel ? Betten ? Garderoben ? Hängematten ? Hocker ? Kaminöfen
lionshome.at Möbel Wohnen Garten Shopping Produktsuche Preisvergleich Suchmaschine Für
214 Kunstschmiede | Kunstschmiede Ukovmi Schmiede
2405
Bad Deutsch Altenburg
Ukovmi Kunstschmiede bei Prešov. Schmiedeeiserne Möbel nach Maß Geländer Zäune Tore ... Schmiedeeiserne Geländer Schmiedeeiserne Geländer für Innen- und Außenbereich. Geländer Schmiedeeiserne Möbel
ukovmi.at Schmiede Kunstschmiede Schmiedeeiserne Tore Schmiedeeiserne
215 Home Massiv
8983
Bad Mitterndorf
Massiv Möbel Klassische Möbel Sondermöbel Holz Art Skulptur Büste Holzschnitzerei ... werden zur Umsetzung sowohl eigens gefertigte Kunstgegenständen als auch individuell entworfene Möbel
holzwerke.at Massiv Möbel Klassische Möbel Sondermöbel
216 Tischlerei GRÖMMER – Einrichtung Tischlerei

Tischlerei Grömmer produziert Möbel nach Maß für Krankenhäuser die Hotellerie Gastronomie und den ... Die Tischlerei Grömmer fertigt innovative designorientierte Möbel zum stilvollen Leben
groemmer.at Tischlerei Grömmer St. Roman Oberösterreich
217 F.Z. Möbelmontagen · flott Montage

Wir montieren Ihre Traummöbel in Tischlerqualität beraten aber auch gerne bei Einrichtungsproblemen jeglicher Art ... Art und planen auf Wunsch Ihr neues Möbel sogar millimetergenau und computerunterstützt! Dazu bieten
fz-montagen.at Montage Montagen Möbel Möbel
218 Agentur objekt direkt Andreu

Moebel Agentur fuer Oesterreich der Hersteller Andreu World Bla Station Indecasa Nanimarquina ... Indecasa Sellex Möbel Moebel Teppiche Stuehle Stuhl Stühle Sessel. Barhocker Gastronomiemöbel
objektdirekt.at Andreu World Bla Station Indecasa
219 Tischlerei Bucher GmbH tischlerei

F.Bucher Tischlerei Möbel für Wohnbereich Geschäft und Büro. Bauteile für Industrie Gewerbe ... von Zweckmäßigkeit und Gestaltung ist unsere oberste Maxime. Einzelmöbel Unsere Möbel sind Maßarbeit
fbucher-tischlerei.at Tischlerei Bucher F.bucher Fbucher
220 Home Antikbeimwasserturm antik

antikbeimwasserturm.de antike Möbel restaurationen abbeizen flechten 60siger Jahre Möbel Klassiker der 60 entwurmen polstern sandstrahlen ... machen zu können. Zur Zeit findet ein Räumungsverkauf statt. Auf m² bieten wir alle Möbel zu Sonderpreisen
antik-beim-wasserturm.at Antik Möbel Schrank Kommode Sekretär Tönisvorst Restauration
221 Eichenholz / Betten

Betten und Möbel in Eichenholz von Ihrem Tischler Profi geplant und realisiert
tischlerei-hutterer.at
222 Homestyle4u eShop | Wohnen Paravent

Alles zum Thema Möbel Einrichtung und Wohnaccessoires. Blitzschneller Versand.
homestyle4u.at Paravent Raumteiler Bambusbett Hochbett
223 Aktionen Javahouse Bradach Einrichtungs KG Javahouse
9081
Reifnitz am Wörthersee
Javahouse hochwertige Möbel aus Indonesien
javahouse.at Javahouse Java Indonesien Indonesia
224 Willkommen bei Tischlermeister Himmelstoss! Tischlermeister
9123
St. Primus
Tischlermeister Himmelstoss Tischlerei Möbel
tischlermeister-himmelstoss.at Tischlermeister Himmelstoss Tischlermeister Himmelstoss Tischler
225 Aktionen Javahouse Bradach Einrichtungs KG Javahouse
9081
Reifnitz am Wörthersee
Javahouse hochwertige Möbel aus Indonesien
baligazebo.at Javahouse Java Indonesien Indonesia
226 Home Tischlerei Kapsammer Home

Home. Tischlerei Kapsammer Tischlerei Kapsammer Möbel Moderne Möbel
kapsammer.at Home Tischlerei Kapsammer
227 Home Schmiede

geschmiedeter Stahl Niro Kupfer Messing und Corten traditionell und zeitgemäß am und ... Bildergalerie StartEinrichtungen - Möbel - Gitter - Tore - Grabzeichen - Treppen - Lichtobjekte
metallgestalter.at Schmiede Kunstschmiede Stahl Design Einrichtung Gestaltung Möbel Gitter
228 Moebeldesigner.at

... Thomas Fleihaus Möbel-Designer Home Services PARTNER Küchen Wohnen Bad Jugend Stiegen Schlafen
moebel-designer.at
229 Dental Service Wien Dentaleinheiten
2380
Perchtoldsdorf bei Wien
Dentaleinheiten Möbel Einrichtung für Zahnarztpraxis und Zahntechnikerpraxis Wien Dental Reparatur Service Wien
dental-service.at Dentaleinheiten Möbel Einrichtung Für Zahnarztpraxis Und Zahntechnikerpraxis
230 Beauty Gesundheit Artikel allaround

Finden Sie allaround shopArtikel in den eBay Shops sowie Beauty Gesundheit Möbel ... ) Handy Computer? Foto HiFi Heimwerker Garten Möbel Wohnen Party und Feiern (
all-around.at Allaround Shop Beauty Gesundheit Möbel
231 WERKSTUECK.AT Lampen

Werkstueck.at bietet Objektlösungen in den Bereichen Möbel Lampen und Accesoires.
werkstueck.at Lampen Möbel Accesoires
232 Fenster Türen Tischlerei Krismer GmbH & Co KG Schautischlerei
6460
Imst
Schautischler Krismer Imst Fenster Türen Küche Bad Maßmöbel Zimmer ... Unternehmen Team Kontakt Fenster Fenster nach Mass Türen Die Visitenkarte Möbel Wohnträume Küchen
krismer-imst.at Schautischlerei Krismer Imst Tirol
233 Www.tischlerhandwerk.at | Tischlerei Mathias Tischlerei

Tischlerei Mathias Fellner. Hochqualitative Möbel Design Möbel und mehr von Mathias Fellner.
handwerksregion.at Tischlerei Fellner Mathias Fellner Matthias Fellner
234 Möbel nach Maß dewitt
1110
Wien
The description of my page
xn--mbelnachmass-4ib.at Dewitt Maßmöbel Massmoebel Küche Kueche Wohnzimmer Badezimmer Büroeinrichtung
235 Tischlerei/SchreinereiMöbelKüchen Hamminger St.Johann a. Tischler

... Flash Tischlerei Schreiner Tischler Möbel Braunau Innviertel St.Johann Ried St.Johann Schlafzimmer
tischlerei-hamminger.at Tischler Oberösterreich Braunau St.Johann Tischlerei Schreinerei Tischlerei Schr
236 Startseite Möbi Wohndiskont Möbi Wohndiskont GmbH moebi
5020
Salzburg
Ihr günstiger Möbelabholmarkt in Salzburg und Lamprechtshausen! Möbel für alle Wohnbereiche auf über 3000 m². ... Haben Sie Lust in unseren aktuellen Prospekten zu blättern? Kein Problem. mehr lesen Onlineshop Möbel
moebi.at Moebi Wohnen Wohnideen Abholmarkt
237 Home IDEEN AUS Ideen

Ideen aus Holz Klaus Schallmeiner Ihr Tischler im Bezirk Gmunden. Möbel Stiegen ... und Möbel. INDIVIDUALITÄT Holz ist schon allein durch die Natur individuell. Kein Teil gleicht vollständig
ideenausholz.at Ideen Aus Holu Klaus Schallmeiner;Tischler Tischlerei
238 Startseite urbanek

Möbel für Dein Zuhause! Rund um Wohnen und Einrichten viele inspirierende Wohnideen. ... Verband. Die GARANT-MÖBEL-GRUPPE schafft ein enorm großes Einkaufsvolumen und damit Preisvorteile
moebel-urbanek.at Urbanek Urbanekmöbel Möbel Urbanek Moebel
239 Schnaeppchenhalle Möbel und Gartenmöbel Gartenmöbel

Im Lagerverkauf der Schnaeppchenhalle ist jeden Tag SALE! Moebel Restposten Konkurswaren und Gartenmoebel
xn--mbel-outlet-zentrum-q6b.at Gartenmöbel Billig Abverkauf Sienagarden
240 Startseite Hofmobiliendepot | Möbelmuseum
1070
Wien
Das Hofmobiliendepot. Möbel Museum Wien ist eine Rarität unter den Sehenswürdigkeiten Wiens und ein Geheimtipp: ... Hofmobiliendepot ? Möbel Museum Wien Öffnungszeiten Veranstaltungen im Hofmobiliendepot ? Möbel Museum Wien
hofmobiliendepot.at Möbelmuseum Biedermeier Möbeldepot Wiener Moderne
241 Tischleria /// Tischlermeister Jakober Holz
6133
Weerberg
Iht Tischlermeister in Tirol Holzmöbel nach Maß Designer Möbel Planung und Beratung ... Garderoben Kontakt Handwerksqualität auf höchstem Niveau ... Deine Vorteile! Persönliche Beratung Möbel
tischleria.at Holz Tischler Handarbeit Beratung
242 Meinkasten.at Möbel nach Heinz Stark GmbH Kasten
8502
Lannach
Möbel nach Maß. Made in Austria. Planen Sie Ihren Kasten nach Belieben und Bestellen Sie
meinkasten.at Kasten Küche Maßanfertigung Bestellen
243 Urlaubtipps für Ossiacher See Urlaub

Urlaubtipps Ossiachersee und Faakersee Einkauftipps Möbel und mehr.
bio-bauer.at Urlaub Ossiacher See Faaker See
244 HOME Antiquitäten
9220
Velden am Wörthersee
Antiquitäten Velden am Wörthersee Velden Geschenke Möbel Schmuck Skulpturen ... HOME STANDORT Postazione ANGEBOT Offerta MÖBEL Mobili SKULPTUREN Sculture BILDER Quadri
antiquitaeten-tsantilas.at Antiquitäten Antiques Renaissance Gotik
245 Premium Moebel

... Herzlich Willkommen bei Premium Möbel Ihr Partner für Exquisiten Möbelbau Restaurierungen
premiummoebel.at
246 Willkommen auf der Startseite Küche

Wir planen und fertigen für Sie: Möbel für den Wohnbereich Gaststätten Büros Haus ... und fertigen für Sie Möbel für den Wohnbereich Gaststätten Büros Haus- und Wohnungstüren. Außerdem verlegen
tischlerei-ecker.at Küche Wohnzimmer Esszimmer Schlafzimmer
247 Hutle Möbel | Tischlerei

Hutle Möbel | Tischlerei. Tischlerei mit Planungsbüro Werkstatt und Ausstellungshalle. Standord Dornbirn
hutle-moebel.at
248 Möbel vom Tischler

... Möbel vom Tischler - Paul Hanzlovic - Moosgasse - Zistersdorf - -
moebelvomtischler.at
249 :: trend:schrank | Günter trendschrank

trendschrank Möbel Koller
trendschrank.at Trendschrank Trendchrank.at Möbel Koller Moebel Koller Günter Koller
250 Start :: Bau und Tischlerwerkstätt
8010
Graz
Die Tischlerwerkstätte Vogl wird seit 60 Jahren nun in dritter Generation geführt. Unser Tätigkeitsbereich erstreckt ... bis hin zum Webshop für Möbel und Accesoires." Unsere Philosophie Der Kunde definiert durch seine Bedürfnisse
tischlereivogl.at Tischlerwerkstätte Ernst Vogl Renovierung
251 Rauscher Möbel Möbel


r-rauscher.at Möbel Wohnen Messen Dekor
252 Freund Naturholz Tischlerei Freund Naturholz Tischlerei GmbH & Co KG Freund
5771
Leogang
Nach dem Vorbild der Natur jedes unserer Möbel ist ein wertbeständiges Unikat. Fachmännische Meisterhände ... Nach dem Vorbild der Natur - jedes unserer Möbel ist ein wert-beständiges Unikat. Fachmännische Meisterhände
freund-naturholz.at Freund Tischlerei Möbelhandel Leogang
253 Rootpage Silz
6424
Silz
Strolz Tischlerei Silz Tirol Ihr Tischler Ing. Roman Strolz fertigt Ihre Möbel (Küche ... Tischlerei Strolz News Planung Referenzen Stellenangebote Ing. Roman Strolz Möbel
strolz-tischlerei.at Silz Tischlerei Silz Tischlerei Strolz Strolz Silz Tischlerei
254 Geschirr Gläser Mobiliar schokobrunnen
5020
Salzburg
Nonfood Catering Partyverleih Gläserverleih Salzburg Österreich Leihequipment Leihgeschirr Geschirrvermietung Mietgeschirr ... ... SpülmaschinenGeschirrspüler und Waschbecken MobiliarStühle - Tische - Lounge Möbel Hussen Mietwäsche Kaffeemaschinen
gastrostaff.at Schokobrunnen Champagnerbrunnen Partyverleihsalzburg Hussen Stehtischhussen Gläs
255 Paradis Küchen Paradis

Paradis Küchen möbel nach maß
paradiskuechen.at Paradis Paradis Paradisküchen Paradiskuechen Küchen
256 FOTOMOEBEL FotoMöbel

Möbel aus Österreich ... schnell fotographiert werden. Hier bedarf es vorab einer kompletten Montage. Einmal werden die Möbel
fotomoebel.at FotoMöbel Wohnmöbel Wohnzimmer Schränke
257 Baumkind Möbel aus Recyclingmaterialien

Möbel aus Recyclingmaterialien Möbelstücke aus Altpapier und Holz.. Sustainable Design aus Graz Upcycling
baumkind.at
258 Garten Möbel Home Mexiko 4 U, e.U. Mexiko
1070
Wien
Mexiko 4 U Wohn.der.Ware aus Mexiko! Wir wollen Ihnen unser geliebtes Mexiko näher bringen ... Fliesen Zubehör Geschirr Gläser Glaskrüge Lampen Möbel Holz Möbel Equipales Acapulco Sessel Stuhl
mexiko4u.at Mexiko Mexico Mex Mexiko 4
259 Alfred Dobnig Möbeldesign Alfred
8075
Hart bei Graz
Für Ihren individuellen Wohnstil bietet Ihnen Alfred Dobnig Möbeldesign handgefertigte Produkte und Möbel mit individuellem
alfred-dobnig-moebeldesign.at Alfred Dobnig Möbeldesign Handgefertigte Möbel Möbel
260 Tischlerei Karnische Massivmöbel Stuben Tischlerei

Ihr Profi für massive SchreinerQualität. Tischlerei Karnische Massiv Möbel Stuben Wohnzimmer Schlafzimmer Küchen Landhausküchen. ... massive Möbel Bei Stube Schlafzimmer Wohnzimmer Küche ist die Firma Karnische Massivmöbel GmbH
km-moebel.at Tischlerei Karnische Massivmöbel Stuben
261 MaasCenter Wien maas

Möbel | Haushaltswaren | Heimtextilen | Teppich ... ) + Wohnwand = Setpreis ?. Sitzgruppe ++ Sitzgruppe ++ ? MÖBEL
maas-center.at Maas Center Wien Möbel Sitzgruppen
262 Tischlerei Herbert Lorenz Möbel
8075
Hart bei Graz
Tischlerei Lorenz Möbel..Carports..Stiegen..Decken..
h-lorenz.at Möbel Stiegen Decken Carports
263 A E C Webverzeichnis

A E C LINKVERZEICHNIS ist ein redaktionell geführtes Verzeichnis mit Themen wie Kunst ... A E C - L I N K V E R Z E I C H N I S Surftipps Antiquitäten - Antike Möbel
aec-fallmann.at Webverzeichnis Linkverzeichnis Pagerank Linktausch Verzeichnisse Webkataloge Kun
264 Dekoverleih Wien/Österreich Deko

Verleih von Dekorationsartikeln wie z.B: Sesselhussen Kerzenständer Empfangsdekoration Geschirr Möbel ... Mein Konto Anmelden Möbel Vasen Geschirr Kerzenständer Empfangsdeko Dekomodelle Sesselhussen Säulen
dekoverleih.at Deko Dekor Dekoration Deko Wien Deko Österreich Deko
265 Möbelpolsterei Kneidinger aus Enns Möbel
4470
Enns
Möbelpolsterei Kneidinger in Enns bietet Leistungen im Bereich Möbel neu beziehen reparieren tapezieren ... Kneidinger in Enns bei Linz Wir polstern Ihr Möbel nach Ihren Wünschen auf und beziehen es neu
moebelpolsterei.at Möbel Neu Polstern Polstermöbel Tapezieren
266 WOHNEN nach MASS | Innenarchitektur

Ideen pro Quadratmeter Innenarchitektur und Handwerk | Interior Design Kantner Möbel und Innenausbau
wohnmass.at Innenarchitektur Wohnraumgestaltung Objektgestaltung Möbel Und
267 Heimat Gatto Möbel cms
1050
Wien
Content Management System ... Gatto Heimat . zur Möbel/Taschenaustellung . Online-Shop . Über Uns . Kontakt Gatto sagt hallo
gatto-moebel.at Cms Publish Ecommerce Content Management
268 Haider Möbel und Montagen
3300
Greinsfurth
... Startseite Firmenstruktur Projekte Partner Kontakt Haider Möbel Montagen HaiderMöbel Montagen
t-haider.at
269 DST möbel mobil |

... Sie werden gleich automatisch weitergeleitet zur Website von DST möbel mobil .
dst-moebel-mobil.at
270 Chesterfield leder sitzgarnitur sitzgarniur

Chesterfield möbel ... Ecksofa Schlafzimmer Möbel Stühlen Hocker Tisch Informationen Unsere AGB's ... Liefer- und Versandkosten
chesterfields.at Sitzgarniur Leder Sitzgarnitur Sofa Sessel
271 Lagerfäche.at Lagerflächen von Lagerfläche


lagerflaeche.at Lagerfläche Lagerflächen Lagerflaeche Lagerflaechen
272 LANDHAUSMÖBEL ACHAU Moebel

landhausmoebel achau moebel und accessoires rund ums wohnen
interantik.at Moebel Landhaus Achau Accessoires
273 Werkzeug zum Erfolg Gewerbe

Gradauer GmbH Lösungen für Sie: Im Werkzeug Formen und Maschinenbau in der ... - Formen- und Maschinenbau in der Möbel- Fenster- Türen und Küchenherstellung Papier- und Sägeindustrie
gradauer.at Gewerbe Industrie Metall Holz
274 MOEBEL KOLONIE Kolonialmöbel

... ... Sie werden weitergeleitet auf die Hauptseite der MOEBEL KOLONIE ... Alle Möbel Accessoires
moebelkolonie.at
275 Designerin ? ein Traumberuf? Designerin

Der Beruf der Designerin oder des Designers gilt für viele Menschen als Traumberuf kann ... verantwortlich Fotografien Filme und Webseiten aber auch Bekleidung Möbel Automobile Werkzeuge Schmuck
designerin.at Designerin Designer Design Gestalter
276 Möbel und Skulpturen |

... Direkt zum Inhalt Möbel Skulptur Projekte Kurt Foit News Links Kontakt
kurtfoit.at
277 Willkommen FZMoebel Moebel

Totalabverkauf von Möbel
fz-moebel.at Moebel Möbel Stuhl Stühle Tisch Kommoden Vitrinen Anrichten
278 Hybridmöbel online
3393
Matzleinsdorf
viole sind Hybridmöbel aus Stoff die bunt und individuelle gestaltete werden können. ... was das Besondere an viole ist Wohnen ist viel mehr als das bloße Aufstellen verschiedener Möbel
viole.at Online Möbel Onlinemöbel Möbel Online
279 Willkommen bei Möbel Manzl

... Willkommen bei Möbel Manzl Über Uns Seit der Firmengründung bietet Möbel Manzl eine perfekte
moebel-manzl.at
280 Kunsthandel Antiquitäten Rudolf Mahringer Kunsthandel

Kunsthandel Antiquitäten Mahringer Wien. Möbel Gemälde Skulpturen und Kunstgewerbe aus allen ... HOME NEWS MÖBEL GEMÄLDE KLEINKUNST SKULPTUREN VERKAUFS- U. SCHAURÄUME MESSEN KONTAKT english LEA
kunsthandel-mahringer.at Kunsthandel Antiquitäten Wien Österreich
281 Auflagen.at Stuhl

auflagen.at ... auflagen Please contact us for more information. Search the Web Stuhl Moebel Tisch Chairs
auflagen.at Stuhl Moebel Tisch Chairs
282 GRIESSENBERGER Kultur in Möbel

Kultur in Holz getreu dieser Firmenphilosophie wird jedes Möbel von Hand gefertigt...
griessenberger.at Möbel Design Designmöbel Tischlerei
283 Möbelservice Pfister Ihr moebel

Möbelservice aus Meisterhand Planung Ihrer Einrichtung fachgerechte und rasche Montage Ihrer Moebel ... Fachgerechte und rasche Montage Ihrer Möbel Bei mir erhältlich Garagentore · Dienstleistungen Zustellung
moebelservice.at Moebel Möbel Tischler Schreiner
284 Antiquitäten Figl Home Antiquitäten
1010
Wien
Familie Figl betreibt in dritter Generation den Antiquitätenhandel auf 3000 m² im Denkmalgeschützten Meierhof Plankenberg ... Sie in Ihrem Browser JavaScript aktivieren.> Home Plankenberg Wien Möbel Objekte Ankauf Ausstellung Vergangene
antikhof-figl.at Antiquitäten Handel Altwaren Verlassenschaften
285 Innenarchitekt für wohnen Innenarchitekt

Ideenpavillon ist der Innenarchitekt für alles rund ums Wohnen und Leben. Wir gestalten Büros
ideenpavillon.at Innenarchitekt Innenarchitektur Innenarchitekt Für Villen
286 Helmmoebel.at Informationen zum

helmmoebel.at ist Ihre erste und beste Informationsquelle über helmmoebel Hier finden Sie auch weitere
helm-moebel.at
287 Holzmöbel.at Informationen zum

holzmöbel.at ist Ihre erste und beste Informationsquelle über Möbel Hier finden Sie auch weitere
ww1.xn--holzmbel-r4a.at
288 Moebelshop.at Informationen zum

moebelshop.at ist Ihre erste und beste Informationsquelle über Möbel Hier finden Sie auch weitere
moebelshop.at
289 Wohnzimmermöbel.at Informationen zum

wohnzimmermöbel.at ist Ihre erste und beste Informationsquelle über Möbel Hier finden Sie auch weitere
ww1.xn--wohnzimmermbel-5pb.at
290 QUINTESSENCE Interior Design quintessence

quintessence interior design wien einrichtungsfachhandel quintessence interior design wien einrichtungsfachhandel geschmack schön tapeten einrichtung lampen ... CONSTRUCTION Ground Floor Britannia Rd. London PLANUNG DESIGN AUSFÜHRUNG SHOP BERATUNG STOFFE TAPETEN MÖBEL
quintessence.co.at Quintessence Interior Design Wien Einrichtungsfachhandel Geschmack Schön Tapeten
291 Tischlerei Johann Hengsberger
8543
St. Martin i.S.
Wir schaffen Möbel fürs Leben ... Startseite Betrieb Bereiche Besonderheiten Bildergalerie Kontakt Wir schaffen Möbel fürs Leben
tischlerei-hengsberger.at
292 Hauser möbel design

... Die Firma Hauser-Möbel-Design wurde gegründet. Das Ziel war schon damals hochwertige Möbel
hauserdesign.at
293 Szapacs Design

... =>> Hier geht es zu den Seiten von Szapacs - Design - Möbel =>> Gerhard Szapacs Schulstraße
s-d-m.at
294 EVA Energetisch Veredelte Zirbe
5452
Pfarrwerfen
Energetisch Veredelte Artikel Energetisch Verarbeitetes Arvenholz Energetische Möbel Energetische Arbeit
eva-shop.at Zirbe Zirbenholz Möbel Zirbenmöbel
295 Schlafwelt24.at Informationen zum

schlafwelt24.at ist Ihre erste und beste Informationsquelle über Moebel Möbel Einrichtung home Sessel Sofa ... schlafwelt.at Weitere Links Der Inhaber dieser Domain parkt diese beim Domain-Parking-Programm
schlafwelt24.at
296 Wohnexperte24.at Informationen zum

wohnexperte24.at ist Ihre erste und beste Informationsquelle über Moebel Möbel Einrichtung home Sessel Sofa ... Domain erwerben Sie können die Domain wohnexperte.at kaufen! wohnexperte.at Weitere Links
wohnexperte24.at
297 Antik Möbel Markt (Gerhard

... Antik Möbel Markt Gerhard Mayrhofer Oberwolfern Wolfern + +
antikmoebelmarkt.at
298 Möbel Innenausbau

... Möbel Mitter - design and more Wohnung - Einrichtung Bambus Stühle Barhocker
moebel.co.at
299 Möbel und Accessoires /

... Die Liste der Produkte von A bis Z Möbel Mitter Übersicht alphabetisch geordnet Accessoires
xn--mbel-5qa.or.at
300 Holzmedia_Möbel und Medientechnik_© 2005 Holzmedia

Holzmedia verbindet Möbel und Medientechnik. Zwei Komponenten die zusammen in der Synergie ganz neue ... Holzmedia verbindet Möbel und Medientechnik. Zwei Komponenten die zusammen in der Synergie ganz
holzmedia.at Holzmedia Holzmedia GmbH Manuel Holz
301 Startseite

Altmoebel.at die Lösung für die Möbel ... Startseite Auspolsterung Moderne Möbel Antike und alte Möbel Tischler Werke Küchenmöbel Büromöbel
altmoebel.at
302 Steiner Möbel | Kindergarten Steiner Möbel GmbH
4644
Scharnstein
... Workshop Raumgestaltung "Angelika von der Beek" ... Steiner Möbel GmbH Badstraße Scharnstein tel
steiner-moebel.at
303 Dirnbauer Möbel /

... und Partner Referenzen Dirnbauer GmbH Möbel und Design seit Studenzen Steiermark T + (
dirnbauermoebel.at
304 Chicantiques vintage möbel

... chicantiques vintage living möbel accessoires zur freude was bieten wir? gelebtes
chicantiques.at
305 Dirnbauer Möbel /

... und Partner Referenzen Dirnbauer GmbH Möbel und Design seit Studenzen Steiermark T + (
studiof.at
306 Modul Möbel: Home

... Bildergalerie Anfrage Kontakt Bereit für Veränderungen Modul Möbel Wolfschwenger .-Oktober-
modul-moebel.at
307 Rauchenzauner Möbel GmbH Rauchenzauner Möbel GmbH
4890
Frankenmarkt
... Rauchenzauner Möbel GmbH Mühlberg Frankenmarkt Austria officerauchenzauner
rauchenzauner.at
308 Bambusshop 24 bambus
1100
Wien
Möbel Dekoration und Accessoires aus Bambus und Rattan. Riesige Auswahl im Online Shop. Exklusive ... bei Bambusshop.at Wohnaccessories Gartenaccessories Schutzanstrich Stein im Garten Mehr
bambusshop24.at Bambus Shop Onlineshop Möbel
309 Tischlerei Zeibich Home tischler
1160
Wien
Die Tischlerei Zeibich GmbH ist ein moderner Produktionsbetrieb für Möbel Ladenbau und Messebau. CAD ... zählen wir zu den führenden österreichischen Produzenten im Möbel- Laden- und Messebau
zeibich.at Tischler Wien Burgenland Neutal
310 Stilwerkstatt Tischlerei Leberbauer Restauration

Stilwerkstatt Alte Möbel neu entdecken | Tischlerei Leberbauer
stilwerkstatt.at Restauration Ergänzungen Neuanfertigungen Schellack
311 BiogasTraktor Leberbauer David Restauration

Stilwerkstatt Alte Möbel neu entdecken | Tischlerei Leberbauer
biogastraktor.at Restauration Ergänzungen Neuanfertigungen Schellack
312 Bau und MöbelTischlerei Mühlbacher Eckbank

Bau und Möbeltischlerei Mühlbacher OEG in Weyregg am Attersee ist Ihr Ansprechpartner für maßgefertigte Möbelstücke
tischlerei-muehlbacher.at Eckbank Kasten Türen Fenster
313 KSart.at Metallkunst Metalldesign KSart
3051
St. Christophen
Auf unserer Homepage sehen Sie einen Querschnitt unserer Produkte. Wir fertigen unter anderem Möbel ... darf. Ich fertige unter anderem Möbel Brunnen Feuerstellen Skulpturen Trophäen Pokale Tore
ksart.at KSart Metallkunst Metalldesign Wienerwald Kinastberger Metal Art Kunsthandwerk
314 ULRICH sitzen.schlafen.wohnen Hüsler Hüsler

Seit 1989 fertigen wir in unserer eigenen Holzwerkstatt formschöne schlichte Möbel aus dem Urmaterial ... Unternehmen Team Kontakt T + www.dasbett Startseite Möbel Schlafen Sitzen Aktuelles
das-bett.at Hüsler Nest Möbel Ulrich Viktor Ulrich
315 LAMA MOEBEL | Holzmanufaktur

... LAMA MOEBEL Holzmanufaktur MARTIN LACKNER Schwarzensee A- Neuhaus tel +
lamamoebel.at
316 Möbel Garschall Home

... Rutsch ins Neue Jahr! design by joomladress About joomladress Möbel Garschall Joomla! is
moebel-garschall.at
317 Ambiente Romana Dürner accessories

Hochwertige Stoffe für Möbel Vorhänge und Dekoration sowie Polstermöbel Kleinmöbel und Accessories.
duerner.at Accessories Ambiente Duerner Dürner
318 TISCHLERARBEITEN UND MÖBEL AUS

... wirtschaftlich sein müssen. Fenster Fussböden Treppen TISCHLERARBEITEN UND MÖBEL AUS MEISTERHAND HERZLICH
ihr-tischler.at
319 Möbel für Terrasse und Teakmöbel

Gartenmöbel aus Dänemark sind bekannt für edles Design und Witterungbeständigkeit teakgartenmoebel ... zu teakgartenmoebel Möbel für Terrasse und Garten Infos zu teakgartenmoebel Teakmöbel Gartenmöbel aus Dänemark
gartenmoebel-onlineshop.at Teakmöbel Terrasse Gartenstuhl Gartentisch
320 BOTZ // AGENTUR FÜR LICHT UND MÖBEL
1080
Wien
... botzagentur für licht und möbel Ihr Browser kann leider
botz.at
321 CASA Möbel mehr

... Bettenkollektion bei CASA Coole Möbel für alle Anlässe freistil Kollektion bei CASA HAY - About A Lounge Chair CASA
casamoebel.at
322 Bueromoebel.at Informationen zum

bueromoebel.at ist Ihre erste und beste Informationsquelle über bueromoebel Hier finden Sie auch weitere
buero-moebel.at
323 Gebrauchtemoebel.at Informationen zum

gebrauchtemoebel.at ist Ihre erste und beste Informationsquelle über gebrauchtemoebel Hier finden Sie auch weitere
gebrauchte-moebel.at
324 Sitzmoebel.at Informationen zum

sitzmoebel.at ist Ihre erste und beste Informationsquelle über sitzmoebel Hier finden Sie auch weitere
sitz-moebel.at
325 Massivmöbel.at Informationen zum

massivmöbel.at ist Ihre erste und beste Informationsquelle über massivmöbel Hier finden Sie auch weitere
xn--massiv-mbel-yfb.at
326 Designermöbel.at Informationen zum

designermöbel.at ist Ihre erste und beste Informationsquelle über Design möbel Hier finden Sie auch
xn--designer-mbel-rmb.at
327 Euromontage.at Herzlich willkommen Euromontage

Euromontage Herbert Battlogg Fachkundige Möbel u. KüchenMontage Herstellung u. Montage von Treppengeländer
euromontage.at Euromontage Herbert Battlogg Fachkundige Möbel U. KüchenMontage Herstellung
328 Up.ART.ig by ma|ma GmbH up.ART.ig

up.ART.ig by ma|ma GmbH Das virtuelle Kunstressort Möbel Wandskulpturen Skulpturen
upartig.at Up.ART.ig Upartig Kunstressort Möbel
329 Hotelmöbelgruppe Home | Hotel
6300
Wörgl
Hotel Möbel HMG Hotelmöbelgruppe Hotelzimmer Hoteleinrichtung Hotelmöbelgruppe Die Objekt Hoteleinrichter in Tirol
hotelmoebelgruppe.at Hotel Möbel HMG Hotelmöbelgruppe Hotelzimmer Hoteleinrichtung
330 Ferrocom Möbel in Biedermannsdorf

... Sonderangebote Messetermine Bezugstoffe Downloads Anfahrt Kontakt Herzlich willkommen bei Ferrocom - Möbel! Seit
ferrocom.at
331 Holzmugl Möbel und Holzmöbel
8605
Pogier
Wir bauen ganz eigene Möbelstücke als Unikate aus Holz für wertorientierte Kunden. ... Sie sich ein neues Lebensgefühl dank hochwertiger Echtholzmöbel. Individuelle und maßgefertigte Möbel- bzw
holzmugl.at Holzmöbel Möbelstücke Wunschmöbel Individuelle Kunststücke
332 Clemens moshammer | raum+möbel

clemens moshammer | ingenieur für möbeldisigntischlermeister | wir beraten sie gerne unverbindlich und planen auf ... führen wir u. a. küchen möbel und accessoires folgender marken next küchen next line küchen
raumplusmoebel.at
333 Home flowolf Montage
6552
Tobadill
... meine vielfalt - ihr vorteil Home Über Florian Wolf Hausmeister Möbel Montage Kontakt Partner
flowolf.at
334 Home ocean wood

... ocean wood ? möbel aus booten home shop alle produkte tische und sessel wohnmöbel boot kollektion
oceanwood.at
335 Dagmar Fezzi |Innenarchitektur Dagmar
8010
Graz
Innenarchitektur Inneneinrichtung Raumgestaltung Büromöbel Objekteinrichtungen Einrichtungskonzepte Wohnideen Innenausbau DesignMöbel Planungsbüro MöbelDesign Einrichtungen Raumausstattung Raumplanung Wohnidee
dagmarfezzi.at Dagmar Fezzi Ist Ihr Partner In Sachen Wohnen
336 Designleuchten Designmöbel schöner wohnen beluga
9020
Klagenfurt
Design Leuchten Kartell Möbel TimeoutGraf Shop Graf Licht Kartell Möbel
i-punkt.at Beluga Cubetto Designlampen Designmoebel
337 Gastronomie Möbel / Möbel

... Gastronomie Möbel Möbel für die Gastronomie Möbel für die Gastronomie bzw. Gastronomiemöbel
gastronomie-moebel.at
338 Design Sottsass Colombo Mendini Design

italienisches Design Möbel Glas Keramik Lampen und Objekte Stücke von: ... ." Diese Seite informiert vor allem über die Klassiker des italienischen Designs Möbel
designklassiker.at Design Möbel Verkauf Shop
339 Home
6444
Längenfeld
Fenster und Möbel nach Maß ... MÖBEL UND FENSTER NACH MASS Willkommen in der Fachwerkstätte für Massarbeit und exklusiven Innenausbau
industrieinfo.at
340 Wohnkram Salzburg Gnigl
5023
Salzburg Gnigl
... Geöffnet ist jeden Dienstag und Freitag von . bis . Uhr. wohnkram Salzburg - Gnigl Möbel
wohnkram.at
341 Antike Fundgrube Antikstube: Antik Antik

Die Website der Antiken Fundgrube in Gronau. Hier finden Sie Antiquitäten aller Art. Ob Antike
antikstube.at Antik Antikmöbel Packmor Antike Fundgrube
342 Bauund Möbeltischler Klaudius Tischler

Bau und Möbeltischler in der 3. Generation Spezialist für Hotelerie und Gastgewerbe Design und
klaudius.at Tischler Tischlermeister Schreiner Schreinereibetieb Möbel Einrichtung Spezialmö
343 Walli Gartenmöbel Pavillon Garten Gartenmöbel
2832
Thernberg NÖ
Walli natürlich Holz Gartenmöbel Wohn und Freizeitmöbel für Haus und Garten
walli.co.at Gartenmöbel Walli Holz Möbel
344 Möbel Infos Einrichtungsgegenstände

... Möbel Infos Informationen zum schöneren Wohnen Möbel Infos Einrichtungsgegenstände können mehr
moebel-infos.at
345 Farbenfachmarkt Hinterholzer Farben Farbenfachmarkt

Farbenfachmarkt Hinterholzer Farben Lacke Innenbereich Aussenbereich Holzveredelung Wohnraum Möbel Holzbodenversiegelung Silikat Wohnraumfarben Feuchtigkeit
farben-hinterholzer.at Farbenfachmarkt Hinterholzer Farben Lacke
346 FlügelPianotransporte Startseite Piano

Transporte von Klavier Pianos Möbel Trsoren Flügel usw.
pianotransporte.at Piano Pianino Flügel Stutzflügel Konzertflügel Cembolo EPiano Möbel
347 Tischlerei Gansger tischlereigansger
5440
Golling
Nach eigenen Wünschen gestaltete Möbel spiegeln die Persönlichkeit des Nutzers wieder und sind genauso unverwechselbar ... gestaltete Möbel spiegeln die Persönlichkeit des Nutzers wieder und sind genauso unverwechselbar
tischlerei-gansger.at Tischlereigansger Tischlereigansger.at Tischler Gansger Günther
348 Möbel Pienz | Wir

... Kindermöbelprogramm Fenster Türen Referenzen Galerie Anfahrt Lage Kontakt Möbel Pienz Wir geben Ihren Visionen
meistertischler-pienz.at
349 Stefanik GmbH Stefanik

Stefanik Bau und Möbeltischlerei ... Neuverlegung Möbel Montage Demontage Reparatur Einzelanfertigung
stefanik.at Stefanik Tischlerei Bau Möbel
350 Schrotttec Spatz

Spatz Reindesign Schrotty Trash Möbel Design Tonne Aliens Furniture
spatz-reindesign.at Spatz Reindesign Schrotty Trash Möbel
351 Tischlerei Mayerhofer Holz

Bau und Möbeltischlerei. Handgefertigte Möbel kreativ und kompetent nach Ihren Wünschen umgesetzt.
tischlerei-mayerhofer.at Holz Möbeltischler Möbeltischlerei Josef MAYERHOFER Bautischler Bautischlerei Mö
352 Www.reichelwohndesign.at Wohndesign

Reichel Wohndesign ... Hauptmenü Startseite Unternehmen Produkte Möbel Referenzen Anfragen Kontakt News Neuheiten Login
reichel-wohndesign.at Wohndesign Reichel Raumkonzept Möbel
353 Holzwerkstatt Sarleinsbach GmbH Bad

hochwertige Möbel Planung und Bau individueller Inneneinrichtung Wohnzimmer Küche Schlafzimmer
holzwerkstatt.at Bad Büro Esszimmer Jugendzimmer
354 Tischlerei Kalhamer Tischlerei Kalham

Website der Tischlerei Kalhamer Mattsee Spezialist in der Herstellung von Fenstern und Türen sowie diverser
kalhamer.at Tischlerei Kalhamer Mattsee Türen Fenster Möbel Holz HolzAlu Alu
355 AW Pfeffer Herzlich A&W Pfeffer GmbH Bibliothekseinric
2371
Hinterbrühl
Die AW Pfeffer GmbH bietet Ihnen Möbel für Ihre Büroeinrichtung sowie ergonomische Sitzmöbel für Ihre
awpfeffer.at Bibliothekseinrichtung Nichtraucherschutz Büroeinrichtung Heizsysteme
356 Tischlerei Krumphuber Unternehmen Krumphuber

Die Tischlerei Krumphuber fertigt seit 1997 Inneneinrichtungen und Einzelmöbel nach Maß an. Individuell und funktionell gleichermaßen. ... die Gestaltung unserer Möbel den persönlichen Stil des Kunden unterstreicht. Um auf die verschiedensten
krumphuber.at Krumphuber Johann Tischlerei Tischler Grossendorf
357 Jugendstil Art Deco Jugendstil

 Jugendstil Art Deco | Amstetten. Erstklassig restaurierte Möbel und Lampen von 1900 bis 1930.
jugendstil-artdeco.at Jugendstil Art Deco Jugendstil Art Deco
358 Tischlerei Murauer Möbeltischlerei Tischlerei

Wir fertigen nicht nur hochwertige und einzigartige Möbel an sondern sorgen für die komplette
tischler-murauer.at Tischlerei Tischlereien Möbel Wohnraum
359 Gastronomiemöbel Gastromöbel Polsterbank

Wir bieten Gastronomieeinrichtung Polsterbank Stehtisch Holztisch Gastronomie Bank Gastronomie Möbel ... willkommen bei -GASTRO Ihrem Gastronomie Möbel Shop. Polsterstühle Holzstühle Finden
bankett-outdoor-moebel.at Polsterbank Polsterbank Günstig Kaufen Gastronomie Möbel
360 Möbel polt – Einrichtungshaus

... Unternehmensgeschichte Tischlerei Kontakt Kontakt Anfahrt Ansprechpartner Einrichtungshaus Tischlerei möbel
moebelpolt.at
361 Lesky : Tischler Graz Tischler
8042
Graz
Die Lesky Stiegen Wohnwerkstatt ist Ihre innovative Tischlerei Graz Voitsberg und baut auch
lesky.at Tischler Graz Voitsberg Möbel Stiegen
362 Antiquitaeten Moebel antiquitaeten

Kunsthandel Antiquitäten Möbel aller Stilepochen antike Kachelöfen Bilder Lampen
antiquitaeten-kral.at Antiquitaeten Antik Antiquitaeten Mobel
363 Bauernsessel Bauernstühle
6070
Ampass
... Bauernvitrinen VERSCHIEDENE MÖBEL HISTORISCHE BAUSTOFFE bemalte Bauernmöbel Schützenscheiben Geschäftsbedingungen
rustikal.at
364 Umzug Wien Umzüege umzugsunternehmen

umzug umzug nach umzugshilfe internationaler umzug kosten umzug möbel umzug ... . Möbel n die passenden Verpackung smaterialien. Das Müll das beim Umziehen auftaucht ist leider
umzug4you.at Umzugsunternehmen Umzugshilfe Umzug Umziehen
365 Exklusives Intereieur Exterieur

... ??????? ?? ANTIK-MÖBEL-HESZ LUXUS DER WERTE SCHAFFT. Erlesen Mondän. Exquisite Objekte
hesz.at
366 JOHAN Möbel Natur.
1070
Wien
JOHAN ist zeitloses Design in charismatischer Farb und Formensprache. Authentisch funktionell und natürlich bringt ... Möbel- und Innenausbau vertieft er über Jahre seine Kenntnisse in Planung Abwicklung
johan-wohnen.at
367 Betont. betont
8010
Graz
Das steirische Künstlerkollektiv BETONT widmet sich der Gestaltung von Möbeln und Inneneinrichtungen aus Beton. ... werden. Durch innovativen Formenbau Variationen der Rezeptur und präzise Oberflächenbehandlung entstehen Möbel mit Charme
betont.at Betont Möbel Inneneinrichtung Beton
368 Firma Wolfgang Ungerank Handwerk
6143
Mühlbachl
Einer für (fast) alles ... ich ihnen noch Komplettprogramme von der Demontage der alten Möbel über Trockenbau Malerarbeiten Laminat-Parkettbodenverlegung
zirbenstueberl.at Handwerk Tischler Zirbe Möbel
369 Tischlerei Dreier Bludenz Bürs cad

tischlerei dreier ihr partner für moebel fester küchen innenausbau stiegen
dreier-tischlerei.at Cad Cad Planung Tischlerei Tischler Schreinerei
370 Galanterie_loft21_meineLieblingssachen galanterie

Sabine Zellinger Mode Möbel Schmuck Accessoires Online Präsentation
galanterie.at Galanterie Loft21 Loft 21
371 Derwohndesigner Home Wohnberatung
5230
Mattighofen
Der Wohndesigner ist eine online Wohnberatung und Einrichtungsberatung. Erfahren sie hier wie sie mit einfachen ... Neuanschaffungen einfach nur durch Umdekorieren ihrer eigenen Möbel. Hier und da eine kleine Veränderung eventuell
der-wohndesigner.at Wohnberatung OnlineWohnberatung Innenarchitekt Einrichtungsberatung Einricht
372 Offlimit Storage Lagerboxen in Offlimit

Offlimit Storage Lagerboxen in Deutschwagram Self Storage Lager zu mieten Lagerraum selfstorage self storage wien ... möbellagerung archiv deutsch wagram umzug lager wien zwischenlager storage aktenlagerung möbel einlagern Home
offlimit-storage.at Offlimit Storage Lagerboxen In Deutschwagram Self Storage Lager
373 Diamant's Aktionshalle Wetten Joka

In der Aktionshalle erhalten Sie preisgünstige Einrichtungsgegenstände MöbelRestposten und MöbelAusstellungsstücke für den kompletten Wohnbereich
aktionshalle.at Joka Hasag Optimo Ada
374 DIOGENES NEW LINE

... des ganz Besonderen. ...eben Möbel wie guter Wein
helmut-pramstaller.at
375 Abitare · Design
5020
Salzburg
... Möbel Design Handwerk Technisches Büro Service Suchbegriff Möbel Küche Wohnen Essbereich Wohnbereich
abitare.at
376 Andreas Jagersberger ? Küchenplanung
2733
Schrattenbach
... Andreas Jagersberger Startseite Partner Referenzen Möbel Fenster Türen Tore Sonnen
jagersberger.co.at
377 Lifestyle Design panoptima

... SAUNABAU > Modernes und individuelles Design ZIRBENHOLZ MÖBEL > Betten > Schlafzimmer Möbel
lifestyle-and-design.at Panoptima Dubovy Zirbenholz Möbel
378 Gupfinger Möbelwerkstätte und Einrichtungsstudio Gupfinger

Gupfinger Möbelwerkstätte und Einrichtungsstudio ... Möbel Gupfinger Ges.m.b.H Wiesenharterstraße St. Marienkirchen ++ - -
gupfinger.at Gupfinger Möbel Möbelwerkstätte Einrichtungsstudio
379 Jetlag Salzburg Vintage

Das Jetlag in der Salzburger Herrengasse ist ein VintageLaden kombiniert mit einem Cafe in
jetlag.at
380 Migora Bambusparkett Michelitsch
8020
Graz
... Neu im Programm - Möbel aus Bambus! Überzeugen Sie sich von unseren neuen Bambus Möbel
migora.at
381 Tischler Fritz Tischlerei Tischler

Tischler Fritz Montageservice entwirft baut und montiert Möbel aller Art. Küchen Anrichten
tischlerfritz.at Tischler Tischler Fritz Montageservice Möbel
382 Selfstorage Lagerraum mieten selfstorage

Bei Safe Self Storage finden Sie Ihren günstigen Lagerraum in Wien um Ihre Möbel einzulagern ... labore et dolore magna aliquyam erat sed diam voluptua. At vero eos et accusam et justo duo dolores et
safeselfstorage.at Selfstorage Wien Self Storage Wien Selfstorage
383 Hagen Möbel |Tischlerei |TischlereiMeisterbetrieb|Küchenherstellung|
6890
Lustenau
... hagen möbel tischlereimeisterbetrieb Web Buttons Maker by Vista-Buttons v. NEWSBEREICH .
hagen-kuechen.at
384 Wohnskulptur Wolfgang Wallner Möbel
6060
Hall in Tirol
Wohnskulpturen ... Wolfgang Wallner Wohnskulpturen Licht Möbel Kunst Wolfgang Wallner Anmelden Jimdo-Logout
wolfgang-wallner.at Möbel Lichtobjekt Vintage Skulptur
385 Glaserei Dobie glasklare Dobie Innenbau OG Glaserei
2320
Schwechat
Glaserei Schwechat Wien Reparatur Dusche Türe Notdienst Möbel
dobieglas.at Glaserei Schwechat Wien Reparatur
386 DieTischlerei bei uns Tischler

Wir möchten Ihnen gerne einen Überblick über unser Schaffen geben. Wir lieben Holz und machen
dietischlerei.at Tischler Tischlerei Holzverarbeitung Möbel
387 Tischlerei Waibl: Einrichtung wie Tischlerei
6460
Imst - AUSTRIA
Tischlerei Waibl Ihr Tischler in Imst / Tirol. Gründe warum auch Sie sich für ... dass man zur Verfügung hat. Theodor Storm Warum Möbel und Türen vom Tischler? Tischlerei Waibl aus Imst
harald-waibl.at Tischlerei Tirol Tischlerei Imst Türen
388 Wsdesign Startseite Möbel

Möbelhandel und Tischlerei ... Wolfgang Sturany Möbel für Ihr Zuhause Startseite Galerie Philosophie Leistungen Kontakt
ws-design.at Möbel Designmöbel Wolfgang Sturany Tischlerei
389 Tischlerei Moebel Scheiber GmbH

... Möbel Scheiber GmbH Co KG Leogang Nr. -
moebel-scheiber.at
390 Antike Möbel liebevoll aufbereitet

Die Antikmöbel Spezialisten Gölles Valda in Riegersburg hauchen Antiquitäten liebevoll und professionell neues Leben ein. ... Ihr Spezialist für antike Möbel Mein Konto Sitemap Toggle navigation Home Antikshop
ablaugen-abbeizen-restaurieren.at
391 Wohndesign Preissl Inovatives möbel

Möbel die Begeistern von Ihrem Einrichtungsspezialisten. Persönliche Beratung wird von uns grossgeschrieben. Wir erstellen für
preissl-moebel.at Möbel Moebel Einrichtung Einrichtungsmöbel
392 Einrichtungspartnerring Sofas Einrichtungspartnerring VME GmbH & Co. KG Möbel
33699
Bielefeld
Ob Wohn oder Esszimmer Schlafraum Kinderzimmer oder Küche: Beim Einrichtungspartnerring finden Sie aktuelle
comfortmaster.at Möbel Wohnmöbel Polster Esszimmer Garderoben Kleinmöbel Kinder Und
393 Kröner Scholz Concept Austria

Bregenz Shopping Kröner Scholz Furniture Lifestyle Shopping Beauty Accessoires Möbel Einrichtung Glas Porzellan Bregenz
kroener-scholz.at Austria Bodensee Bregenz Einkaufen
394 Einrichtungspartnerring Sofas Einrichtungspartnerring VME GmbH & Co. KG Möbel
33699
Bielefeld
Ob Wohn oder Esszimmer Schlafraum Kinderzimmer oder Küche: Beim Einrichtungspartnerring finden Sie aktuelle
clever-clean.at Möbel Wohnmöbel Polster Esszimmer Garderoben Kleinmöbel Kinder Und
395 Kopfstand mobiliar: designmoebel kopfstand

kopfstandmobiliar gmbh ausstattungsservice fuer messen: designmoebel mieten und kaufen fuer messen events ... OF EVENTS · visit us at BEST OF EVENTS zuständig für möbelkultur auf messen und events info
design-moebel.at Kopfstand Mobiliar Design Moebel Mieten
396 Einrichtungspartnerring Sofas Einrichtungspartnerring VME GmbH & Co. KG Möbel
33699
Bielefeld
Ob Wohn oder Esszimmer Schlafraum Kinderzimmer oder Küche: Beim Einrichtungspartnerring finden Sie aktuelle
enzo-baresi.at Möbel Wohnmöbel Polster Esszimmer Garderoben Kleinmöbel Kinder Und
397 HW Büro Design GmbH hochwertige

hochwertige Möbel Büromöbel Büroeinrichtung Bürostühle Drehstühle Chefsessel Drehstuhl
buero-design.at Hochwertige Möbel Büromöbel Büroeinrichtung Bürostühle
398 Einrichtungspartnerring Sofas Einrichtungspartnerring VME GmbH & Co. KG Möbel
33699
Bielefeld
Ob Wohn oder Esszimmer Schlafraum Kinderzimmer oder Küche: Beim Einrichtungspartnerring finden Sie aktuelle
cleverclean.at Möbel Wohnmöbel Polster Esszimmer Garderoben Kleinmöbel Kinder Und
399 Tischlerei Schwingenschlögl :: HOME Bau
3874
Litschau
Bau und Möbeltischlerei Tischler Innenausbau Maßmöbel Tischlerei Möbel Einzelanfertigung Vollholzmöbel Echtholzmöbel Niederösterreich Waldviertel
schwingenschloegl.at Bau Und Möbeltischlerei Tischler Innenausbau
400 Kopfstand mobiliar: designmoebel kopfstand

kopfstandmobiliar gmbh ausstattungsservice fuer messen: designmoebel mieten und kaufen fuer messen events ... OF EVENTS · visit us at BEST OF EVENTS zuständig für möbelkultur auf messen und events info
kopfstandmoebel.at Kopfstand Mobiliar Design Moebel Mieten
401 Einrichtungspartnerring Sofas Einrichtungspartnerring VME GmbH & Co. KG Möbel
33699
Bielefeld
Ob Wohn oder Esszimmer Schlafraum Kinderzimmer oder Küche: Beim Einrichtungspartnerring finden Sie aktuelle
lavie-moebel.at Möbel Wohnmöbel Polster Esszimmer Garderoben Kleinmöbel Kinder Und
402 Kopfstand mobiliar: designmoebel kopfstand

kopfstandmobiliar gmbh ausstattungsservice fuer messen: designmoebel mieten und kaufen fuer messen events ... OF EVENTS · visit us at BEST OF EVENTS zuständig für möbelkultur auf messen und events info
xn--kopfstand-mbel-5pb.at Kopfstand Mobiliar Design Moebel Mieten
403 Einrichtungspartnerring Sofas Einrichtungspartnerring VME GmbH & Co. KG Möbel
33699
Bielefeld
Ob Wohn oder Esszimmer Schlafraum Kinderzimmer oder Küche: Beim Einrichtungspartnerring finden Sie aktuelle
young-citizen.at Möbel Wohnmöbel Polster Esszimmer Garderoben Kleinmöbel Kinder Und
404 Kopfstand mobiliar: designmoebel kopfstand

kopfstandmobiliar gmbh ausstattungsservice fuer messen: designmoebel mieten und kaufen fuer messen events ... OF EVENTS · visit us at BEST OF EVENTS zuständig für möbelkultur auf messen und events info
miet-moebel.at Kopfstand Mobiliar Design Moebel Mieten
405 Einrichtungspartnerring Sofas Einrichtungspartnerring VME GmbH & Co. KG Möbel
33699
Bielefeld
Ob Wohn oder Esszimmer Schlafraum Kinderzimmer oder Küche: Beim Einrichtungspartnerring finden Sie aktuelle
moebel-partner-ring.at Möbel Wohnmöbel Polster Esszimmer Garderoben Kleinmöbel Kinder Und
406 Kopfstand mobiliar: designmoebel kopfstand

kopfstandmobiliar gmbh ausstattungsservice fuer messen: designmoebel mieten und kaufen fuer messen events ... OF EVENTS · visit us at BEST OF EVENTS zuständig für möbelkultur auf messen und events info
xn--design-mbel-yfb.at Kopfstand Mobiliar Design Moebel Mieten
407 Einrichtungspartnerring Sofas Einrichtungspartnerring VME GmbH & Co. KG Möbel
33699
Bielefeld
Ob Wohn oder Esszimmer Schlafraum Kinderzimmer oder Küche: Beim Einrichtungspartnerring finden Sie aktuelle
youngcitizen.at Möbel Wohnmöbel Polster Esszimmer Garderoben Kleinmöbel Kinder Und
408 Sodemann rihacek: moöbel design sodemann

sodemann rihacek: möbel design Tischlerei Wien Benjamin Sodemann Emanuel Rihacek Grüntorgasse
sodemann.at Sodemann Rihacek Möbel Design Tischlerei
409 Bau und Möbeltischlerei Mattle Bautischlerei

Die Bau und Möbeltischlerei in Galtür Firma Mattle ist der Profi rund um Möbel
tischlerei-mattle.at Bautischlerei Möbeltischlerei Küchenstudio Fenster
410 Andreas huelber Furniture

Single pieces and small series of socalled furniture; usable sometimes practical primarily powerful. ... geb. Möbel- Grafik- Webdesigner; derzeit hauptsächlich in der Agentur orange moon tätig
huelber.at Furniture Möbel Interior Einrichtung
411 LIDAUER Tischlerei GmbH Scharnstein

... LIDAUER Tischlerei GmbH Scharnstein - Exklusive Möbel Ladenbau Oberösterreich Österreich Unsere
lidauer.at
412 Einrichtung Raumaustatter Raffetseder Raumaustatter

Ein Komplettausstatter für alle Wohnbereiche? Raffetseder wird´s einrichten. ... ? Raffetseder wird´s einrichten Möbel fürs Leben. Die passende Gestaltung des Eigenheims schafft Lebensfreude
raffetseder-moebel.at Raumaustatter Möbel Accessoires Wohnen Möbel Einrichtung Planung Pöchlarn
413 Home | Helmut Walter

... Tischler Walgau Tischler Vorarlberg Schreiner Walgau Schreiner Vorarlberg Möbel Walgau Möbel Vorarlberg
helmut-walter.at
414 Home | Tischlerei Kilzer EBS Smart Solutions Software GmbH kilzer
9900
Lienz
  Jetzt neu bei Tischlerei Kilzer: Die Tischlerei Kilzer GmbH Co. KG ist ein ... Innentüren Haustüren Möbel nach Maß Projekte Startseite Kontakt Sitemap Herzlich willkommen
kilzer-tueren.at Kilzer Tischlerei Unternehmen Freude
415 Start Guido Zotti
5020
Salzburg
... Sie uns in die Welt von Guido Zotti! Wir zeigen Ihnen eine Auswahl aus der Fülle unseres Angebots antike Möbel
guidozotti.at
416 Küchenstudio Wohnideen Küchenstudio

Entdecken Sie traumhafte Wohnideen im Küchenstudio bzw. Wohnstudio. Ihr Innenarchitekt hilft Ihnen bei der Verwirklichung ... Share Europa Möbel Verwaltungs GmbH Co KG Salzburger Linz + -
europamoebel.at Küchenstudio Wohnideen Innenarchitekt Wohnstudio
417 Design Hütte Möbel Vakantie

Design Hütte Trend Lifestyle Holiday Urlaub Vakantie ... -Ausstellung! DeSign Hütte Wo den sonst.... Über uns Möbel Studio Kollektionen Modern Relax Blofield Trones
design-hutte.at Vakantie Urlaub Holiday Verhuur For Rent Vermietung Verkauf
418 Herzlich Willkommen Fenster

Tischlerei Schöpp Faistenau ... Bau- und Möbeltischlerei Schöpp Familienbetrieb seit Informationen Willkommen Über uns Möbel
tischlerei-schoepp.at Fenster Türen Möbel Tischlerei Bödn Alt Möbelverkauf
419 Calligaris moderne Möbel: Italienisches

Calligaris: arredamento casa moderno e funzionale design italiano. Oltre 800 modelli: sedie tavoli ... Couchtische Wohnzimmer - möbel TV- HiFi-Möbel Wandregale Sleeping Doppelbetten Schlafzimmer - möbel Zubehör
calligaris.at
420 Einrichtung Möbel und

... Willkommen! Attachè Inneneinrichtung - Ihr persönlicher Berater für Einrichtung Möbel und Design Aktuelles
attache.at
421 Elmecker Einrichtungsstudio für DAN
4193
Reichenthal
Einrichtungsstudio Elmecker für alle Ihre Wohnträume ... Ing. Werner Elmecker Geschäftsführer Küchen Möbel Projekte Über uns Links Ortsplan Kontakt Küchen Erst
ee-studio.at DAN DANKüchen DAN Freistadt
422 Designklassiker 20stes Jahrhundert Möbel
6850
Dornbirn
Alexandra Alge Möbelagentur
moebelagentur-alge.at Möbel Sessel Tisch Stuhl Teppich Eternit Lampen Accessoir
423 Zeitlhofer mehr als nur

... und Möbelfachhandel ZEITLHOFER! Ich verspreche Ihnen ?mehr als nur Möbel?. Einzigartige und umsetzbare Ideen
zeitlhofer-moebel.at
424 BENLEVI  MANUFAKTUR 
6020
Innbsruck
Unsere Möbel erzählen Geschichten. In ihnen bleibt Vergangenes lebendig. Sie spiegeln wider woher wir ... BENLEVI - MANUFAKTUR PHILOSOPHIE BENLEVI KLEIDUNG TASCHEN MÖBEL KONTAKT
benlevi.at
425 :: Tischlerei Huber Peter Huber Peter GmbH Tischlerei
6460
Imst
Tischlerei Huber Peter Möbel aus Zirbenholz Individueller Innenausbau Tischlerei in Tirol. Auch
tischlerei-huber-peter.at Tischlerei Tischler Imst Komplettausstatter Böden
426 :: Tischlerei Huber Peter Tischlerei

Tischlerei Huber Peter Möbel aus Zirbenholz Individueller Innenausbau Tischlerei in Tirol. Auch
wellness-huber.at Tischlerei Tischler Imst Komplettausstatter Böden
427 :: Tischlerei Huber Peter Huber Peter GmbH Tischlerei
6460
Imst
Tischlerei Huber Peter Möbel aus Zirbenholz Individueller Innenausbau Tischlerei in Tirol. Auch
treppen-huber.at Tischlerei Tischler Imst Komplettausstatter Böden
428 Www.lechnerfranc.at Fair

Lechner Franc Import von Fair Trade Produkten Kunsthandwerk Leder Korbwaren
lechner-franc.at Fair Trade Kunsthandwerk Leder Korbwaren
429 Willkommenbei der Tischlerei MEISTER möbel

Tischlerei Meister. Keine Billigmöbel aber hochwertige individuelle Einrichtung zu günstigen Preisen; Maßarbeit
tischlerei-meister.at Möbel Einrichtung Tischler Tischlerei
430 KITZ LINE Möbel Kitz
6370
Kitzbühel
Handwerk Pur und unvergleichlich! Toni Ober KITZ LINE in Kitzbühel in Tirol. ? Vitrinen ... Interpretiert. Die neuen Kitz Line Möbel aus der Tischlerei Ober überzeugen mit Geradlinigkeit und klaren Formen
kitzline.at Kitz Line Toni Ober Online
431 Antikmöbel Ewald Hainberger antik
4150
Berg bei Rohrbach
Antikmöbel Ewald Hainberger ... Home Stilkunde Restaurierte Möbel Restaurierung Vorher/Nachher Sonstiges Gartenholz
antikmoebel-eh.at Antik Moebel Ewald Hainberger
432 StilGewohnt Möbelhandel GmbH StilGewohnt

... Start Webshop Möbel Lampen Kamine Über uns Adresse Gästebuch Sie benoetigen Javascript
stilgewohnt.at StilGewohnt Landhausmöbel Landhausstil Landhaus
433 Manninger Möbel GmbH  Manninger Möbel GmbH
8261
Sinabelkirchen
Wohnen Handwerk Manninger in Sinabelkirchen ist ein Familienbetrieb und vereint Handwerk und Einrichtungshaus. ... Manninger Möbel GmbH Aktuelles Unternehmen Küchenausstellung Wohnen Essen Schlafen Referenzen
manninger.co.at
434 Startseite Country Classics country

Was das Herz begehrt! Unter diesem Motto kombiniert Country Classics in Kitzbühel Möbel und Accessoires.
countryclassics.at Country Classics Kitzbühel Michaela Schulze
435 Gerhard Höckner Designeria Gerhard

Planung + Design für Wohn und Geschäftsobjekte mit Fokus auf Massivholz vom Einzelmöbel bis zur
werkstatthoeckner.at Gerhard Höckner Massivholz Vollholz Naturholz
436 Tischlerei Hacker Krusdorf Anton
8345
Straden ... in Google Maps anzeigen
Tischlerei Hacker Ihr Tischler macht´s persönlich! Tischlerei Hacker Krusdorf 54 8345 Straden ... ist Wohltuend Möbel aus Holz sind eine ganz sinnliche Erfahrung! Einrichtungen werden gesehen gehört begriffen
tischlerei-hacker.at Anton Hacker Tischler Tischlerei Möbel
437 Möbel Rieder Möbelhaus Möbel Rieder KG
5282
Ranshofen
... tischler tischlerei möbel möbelhaus einrichtungshaus möbelrieder moebelrieder möbel rieder stuhl
moebelrieder.at
438 Kilim Mobilya Viyana

... Viyana - Kilim Möbel Wien - Stilev GmbH.
stilev.at
439 MStudio Reiter Altenmarkt mstudio
5541
Altenmarkt i.P.
Moebel und Mehr Gefuehle und Emotionen MStudio Reiter Altenmark im Pongau
tischlerei-reiter.at Mstudio M Studio Reiter Altenmarkt Pongau Brunn Bauer
440 G.Oberndorfer Geplantes Einrichten oberndorfer

G.Oberndorfer Geplantes Einrichten ... Startseite Über mich Planung Leistung Projekte Böden Esszimmer Küche Möbel Schlafzimmer Treppen
go-einrichten.at Oberndorfer Tischler Einrichten Möbel
441 Georg Brandstetter Tischlerei Georg

Tischlerei Georg Brandstetter Wohnen zum Wohlfuehlen mit Ideen und kreativem Design Einrichten
tischlereibrandstetter.at Georg Brandstetter Tischlerei Einrichten
442 DeWitt Nußdorf dewitt
1190
Wien
Auch als Selbstbaumöbel sind de Witt Möbel nach Maß mit zinsenfreier Teilzahlung in der
dewittwien.at Dewitt De Witt Möbel Nach Maß
443 Wohnsinnspreise: Wohnschnäppchen zu Wahnsinnspreisen wohnsinnspreise

Wohnsinnspreise bietet Wohnschnäppchen zu Wahnsinnspreisen. Hier finden Sie hochwertige Ausstellungsstücke und Restposten von Markenmöbeln zu ... -Angeboten Designer-Möbel für Ihr Wohnzimmer zu unschlagbaren Wahnsinnspreisen! Top-Schnäppchen
wohnsinnspreise.at Wohnsinnspreise Wohnsinnspreis Möbel Schnäppchen Möbel Günstig Kaufen Günstige
444 HUBER: INTRO tischler

Tischlerei und Wohnstudio Ing. Huber KG; Fenster Türen Möbel Planungen
huber-ybbs.at Tischler Huber Huber Ybbs Huberybbs
445 Exclusive Geschenkideen: Kunsthandwerk aus Pavillon

Gazebo Statuen aus Holz und Stein Windspiele Räucherwerk und Zubehör Amuletten
kunsthandwerk-bali.at Pavillon Bali Kunsthandwerk Räucherwerk Buddha Masken Wandmasken
446 Mimis Home Collektion Deco

Deco Altholz Möbel Teelichte Geschirr Blumen Vogelhäuser Bludenz Mimis Polster Zirbenkissen Schnäpse Mimis Home
mimis.at Deco Altholz Möbel Teelichte Geschirr Blumen Vogelhäuser Bludenz Mimis
447 Esstische Tische

... und in verschiedenen Farbvariationen. Wir stellen Möbel nach unseren eigenen Entwürfen her
massivmassmoebel.at
448 Treppenbau Möschl Stiegen bauen Treppenbau

Treppenbau Möschl Konzeption und Ausführung: Gelebte Wohnkultur formschön und ästhetisch. Treppenbau Stiegen
treppenbau-moeschl.at Treppenbau Stiegen Treppen Treppenplanung
449 LeskyTischlereiStiegenbau Stallhofen Tischlerei

Tischlerei Stiegenbau Möbel Fenster Böden Türen Steiermark Graz
wohnmeister-stiege.at Tischlerei Stiegenbau Möbel Fenster
450 Vinval ? Lifestyle Shop Chur

Lifestyle shop in der Schweiz mit nachaltigen DesignerMöbel und EBikes / EMopeds.
vintageelectricbikes.at Chur EBike EBikes Schweiz
451 Tirolstein Tiere
6020
Innsbruck
In der Altstadt von Innsbruck finden Sie Europas umfangreichstes Fachgeschäft für exclusiven Schmuck einzigartige ... Kontakt Schmuck Asiatika Wellness Moebel Skulpturen Mineralien Fossilien Exklusives
tirol-stein.at Tiere Mineralien Schmuck Fossilien
452 Gebrauchte Büromöbel kaufen mieten Gebrauchte

Gebrauchte Büromöbel günstig mieten kaufen Wien gebrauchte Drehstühle gebrauchte Aktenschränke Wien
gebraucht-bueromoebel.at Gebrauchte Büromöbel Günstig Mieten Kaufen Wien
453 +++++ Willkommen bei Planit Architektur

Architektur Innenarchitektur Planung Möbel Sanieren Sanierung Salzburg Einrichten
planit.at Architektur Innenarchitektur Planung Möbel Sanieren
454 Startseite Kunsthandwerk Alois Zirbenholz
9981
Kals am Großglockner
Zirbenkunst aus Osttirol ... TPLBEEZSEARCH Startseite Über mich Umgebung Uhren Schüsseln Möbel Kontakt ZIRBEN KUNST GRATZ Das Besondere
kunsthandwerk-gratz.at Zirbenholz Schnitzerei Alois Gratz
455 Startseite: Reibenbacher Naturholztischler Reibenbacher

Reibenbacher Naturholztischler: Der Mensch wohnt in der Natur. Möbel aus Vollholz und Keramik. ... Individuelle Möbel für einzigartige Menschen Willkommen beim Naturholztischler Reibenbacher Gottfried
reibenbacher.at Reibenbacher Naturholztischler Tischlerei Möbeltischler Naturverbunden Massivhol
456 New shabby style by shabby

Shabby chic Shabby style Landhaus country alte Möbel ... Navigation aufklappen/zuklappen Startseite Über uns World of Heart`s Accessoires Möbel Gästebuch
new-shabby-style.at Shabby Chic Shabby Style Landhaus
457 CLAIRE LIGNE Lettenmayr Akazie

Claire Ligne Wir bringen die Welt in Ihr Zuhause Online Shop für besondere
claire-ligne.at Akazie Akazien Sonnenliege Akazienbank Akazienliege
458 AKTUELLES Tischlerei Möbelwerkstätte

... ? Althaussanierung OBJEKT-EINRICHTUNG ? Möbel ? Bau TEILE- PRODUKTION ? Zuschnitt ? Bekantung ? CNC ? Produkte
kernbichler.at
459 Peko Tischlerei Handel

... /Gartengestaltung Wood Plastic-Composite Designermöbel Teak Möbel Gartenmöbel Zäune... mehr Green Symphony
peko.co.at
460 POSCH Antiquitäten
8190
Birkfeld
... sowie Baumaterialien. Wir restaurieren antike Möbel in unserer eigenen Werkstatt und übernehmen
posch-antiquitaeten.at
461 Treitner Wohndesign | Wohnträume Treitner GmbH Küche
1100
Wien
Treitner Wohndesign in Wien ist Ihr Partner wenn es um Ihre Wohnungseinrichtung geht. Ob ... bis zum Schlafzimmer planen wir mit der modernsten Computersoftware. MEHR ÜBER PLANUNG Tischlerei - exklusive Möbel
treitner.at Küche Wohnzimmer Schlafzimmer Vorzimmer Möbel Schrank Wohnen
462 Stuchly die Tischlermeister: Stuchly GmbH & CO KG Fenster
6712
Thüringen
Stuchly ... stuchly die Startseite Fenster Rahmensysteme Förderungen Referenzen Türen Möbel News Betrieb
stuchly.at Fenster Türen Möbel Verglasungen
463 LIEBLICHKEITEN LIEBLICHKEITEN

LIEBLICHKEITEN LIEBLICHKEITEN ist immer auf der Suche nach Besonderheiten. Viele unserer Produkte kommen aus ... Geschenke Accessoires Schmuck Möbel - einfach LIEBLICHKEITEN Home About Contact Basket NEU
lieblichkeiten.at LIEBLICHKEITEN Geschenke Accessoires Schmuck Möbel
464 Wohnen ist leben .... Wohnkultur KILGA GmbH Wohnkultur
6020
Innsbruck
Wohnkultur Kilga Seilergasse 15 6020 Innsbruck Tel.: +43 512 57 61 83 ... PROJEKTE BETTENDESIGN Schramm TEXTILIEN accessories OUTDOOR möbel INFOCORNER NEUHEITEN PARTNER wohnen
kilga.at Wohnkultur Möbel Tirol Kilga
465 Tpdesign | wohnraumgestaltung TPDesign

Machen Sie Raum für neue Ideen. Geben Sie Ihren eigenen vier Wänden mehr und neue ... Wohnraumgestaltung mit Möbel-Design für Ihr Zuhause "Architektur ist im Idealfall immer direkte Auseinandersetzung
onlinemoebel.at TPDesign Einrichtungstraum
466 > > > JENNINGS

Kindermode Kinderwagen Möbel Kinderzimmer Babyausstattung Taufe Kinderbekleidung Jennings ... Babys Bekleidung Kinderwagen Möbel Stofftiere Kids Teenies Contact Babys Bekleidung Kinderwagen
jennings.at
467 Büromöbel versandfrei bestellen Büromöbel

Ihr Experte wenn es um Büromöbel geht! MarkenBüromöbel versandfrei mit Sofortprogramm und Rechnungskauf ? TrustedShops zertifiziert ... Bisley Gera-Möbel Leuwico Dauphin und Bejot hergestellt. Diese Marken sind für Ihre hohen
bueromoebel-experte.at Büromöbel Büro Möbel Büroeinrichtung Bueromoebel
468 Möbelvisionen Schleinzer tvmöbel

... at - officemoebelvisionen at - konzept moebel design design by schleinzer möbelvisionen - konzept
moebelvisionen.at Tvmöbel Tv Möbel Funktionsmöbel Fernsehschrank
469 Alpenkid Startseite

Alpenkid aus Österreich bietet Möbel für Kindergarten Hort Krippe Krabbelstuben aus Massivholz ... HORTMÖBEL MÖBEL FÜR TAGESBETREUUNG KINDERGARTENEINRICHUNG KRABBELSTUBENEINRICHTUNG KRIPPENEINRICHTUNG
alpenkid.at
470 Home Denk Holz GmbH holz

Denk Holz GmbH ... mit. Wir bieten Ihnen Möbel für den gesamten Wohnbereich Büro- und Geschäftseinrichtungen Eingangs
denkholz.at Holz Tischler Möbel Moebel
471 3d Möbelplanung Plan

Professionelle Einrichtungsplanung für Kunden Händler und Tischler! ... - Service Möbel KOSZ Clever Einrichten
kosz.at Plan Planung Einrichtung Küche
472 ... besonderes aus Holz koermer

tischlerei kunsthandwerk koermer ... Tischlerei und Kunsthandwerk Körmer bietet Ihnen aus einer Hand Tischlerei Kunsthandwerk Möbel
koermer.at Koermer Körmer Tischlerei Tischler
473 NTWDesign Tischlerei Neunteufl Oberstrahlbach ntw

NTWDesign Tischlerei Willibald Neunteufl Oberstrahlbach 3910 Zwettl Waldviertel Holz Möbel
ntw-design.at Ntw Ntw Design NtwDesign Neunteufl
474 Art Deco Furniture Art Polsterei

TOGO DESIGN™ manufacture of upholstered furniture for home Gartronomie restaurant cafe
coffeehouse.at Polsterei Polstermöbel Art Deco Möbel Art Deco
475 MDESIGN MANFRED AFFENZELLER MDesign

MDESIGN KATSDORF MANFRED AFFENZELLER Artikel: Polstermöbel Sofa Couch Barhocker TV Möbel
m-design-wohnen.at MDesign MDesign Katsdorf Affenzeller
476 Wohnaccessoires Schöner Wohnen Möbel

Schöner wohnen mit Designermöbel Wohnideen und Wohnaccessoires von Casanello. Online kaufen und bestellen in ... casanello - wohnen in schönster form bleiben sie gespannt moebel Wohnaccessoires mit Geschmack
casanello.at Möbel Wohnideen Schöner Wohnen Online
477 Fürstenfelder Messetage Startseite Meister Möbel Unger GmbH & Co KG Messetage
8280
Fürstenfeld
Fürstenfelder Messetage. Vom 9.11. November 2012 finden die Fürstenfelder Messetage unter dem Motto "Feuer ... Startseite Meister Möbel Meister Möbel Homepage SPIRIT OF FIRE Kachelöfen und Kamine SPIRIT OF FIRE
messetage.at Messetage Hausmesse Fürstenfeld Meister Möbel
478 HomepageTitel Home Schreiner
8053
GRAZ
HomepageTitel Graz ... und qualitätsvoller Handwerksarbeit übernehmen wir gerne die Fertigung Ihrer Wunsch-Möbel und Einrichtungsgegenstände
tischlerposch.at Schreiner Schreinerei Tischler Möbel
479 Massivholz Tischlerei Josef Holzner Tischlerei

Tischlerei wir fertigen aus Massivholz: Küchen Türen Haustüren Treppen ... BAUTISCHLEREI KÜCHEN MÖBEL u. INNENAUSBAU OBJEKTBEREICH SONDERLÖSUNGEN KONTAKT SO FINDEN
joholzner.at Tischlerei Schreinerei Massivholztischlerei Biotischlerei
480 Mietmöbel Loungemöbel und ORGATECH AG Mietmöbel
71277
Rutesheim
Die Orgatech AG bietet ein sehr großes Angebot günstiger Mietmöbel für jede Veranstaltung. Loungemöbel ... eröffnet. mehr .. Möbel Mieten für Baselworld Edles Geschmeide und funkelnde
orgatech-austria.at Mietmöbel Möbel Mieten Loungemöbel Mieten
481 Objekt Wohneinrichtungen

... für die Lieferung von Möbel für Hotels Büros Seminarräume öffentliche Gebäude Industriebetriebe. Wir bieten
wirth-online.at
482 Handwerkholz Anton Bereuter Handwerkholz

Handwerkholz – Anton Bereuter: Tischlerei Möbel Treppen Stiegen Rodelhersteller Rodelerzeuger
handwerkholz.at Handwerkholz Anton Bereuter Tischlerei Tischler
483 Andreas Czipin Design.ACLine Edelstahl

Wir helfen Ihnen bei der fachmännischen Umsetzung. Vom Prototypenbau bis zu Spezial Anfertigungen wir nehmen
ac-line.at Edelstahl Geländer Quarantäneboxen Rohrschleiffen Vordächer Treppen Toiletenpapi
484 Mamatreff.at Die Seite mamatreff

Auf mamatreff treffen sich Mamis und Papis um Kleidung Möbel oder Spielzeug zu verkaufen ... Mädchen - Größe - Mädchen - Schuhe Umstandsmode Mehr Kategorien anzeigen Möbel in Betten
mamatreff.at Mamatreff Mama Börse Forum
485 Massivholzküchen zu günstigen Preise
12435
Berlin
Exklusive klassische und moderne Massivholzküchen Ihr Profi für Küchen Möbel Küchenplanung ... sich in Form- Farb- und Materialart ihrer Möbel wieder. Dabei spielt Massivholz eine ganz entscheidende Rolle
massivholzkuechen.at
486 Startseite Tischlerei Martin Tischlerei Martin Tritscher GmbH tischler
8970
Schladming
Küchenplanung und montage Sauna Infrarotkabinen und Wellnessbereiche in Holz Objektmöbel und Gastronomieeinrichtungen. ... Werkstatt unsere Arbeiten Wohnen Küchen Wohnräume Badezimmer Schlafräume Möbel Objektmöbel Tische Sitzecken
martin-tritscher.at Tischler Tischlerei Schladming Holz
487 Luis Scheicher Antiquit�en Luis

Luis Alois Scheicher Antiquit�en M�el Moebel Antiquitaeten alte Tische Kasten Kaesten K�ten Einrichtung alt Rarit�
luis-scheicher.at Luis Alois Scheicher Antiquit�en M�el Moebel Antiquitaeten Alte
488 TischlereiPale KG Fiss TischlereiPale

TischlereiPale KG Fiss ein Handwerksbetrieb mit Tradition im gehobenen Innenausbau erfüllen wir
tischlerei-pale.at TischlereiPale Lebensräume Tischler Innenausbau
489 DieGUTEMÖBELwerkstatt | MARTIN STREITFELD

Möbelwerkstatt | Tischlerei | Schreinerei Martin Streitfeld entwirft und baut für Sie Möbel ... home philosophie gute möbel wohnzimmer küche schlafzimmer badezimmer vorzimmer sonstiges universal
gutemoebel.co.at
490 Joko Individueller Möbelbau möbel

Willkommen bei der Tischlerei Josef Kothbauer in Niederwaldkirchen. Ihr Tischler für individuellen Möbelbau. ... Accessoires News von Joko-Möbel -- Weihnachtsmarkt Reichenthal » Mehr -- Weihnachtsmarkt
joko-moebel.at Möbel Möbelbau Josef Kothbauer
491 Schwarzott Einrichtungshaus Werkstätte schwarzott
2500
Baden
Möbel von Wittmann de Sede Cor interlübke Poliform bulthaup und ... Baden ? are-einrichtungshaus-xyaddks-schwarzott Presse ? AGB ?
schwarzott.at Schwarzott Möbel Tischler Wittmann
492 FunderMax FunderMax

FunderMax for people who create. Egal ob Möbel Fassade oder Innenausbau: An der ... für Möbel- und Innenraumgestaltung. Bild Doimo Cityline Werden Sie FunderMax Insider! Erhalten
fundermax.at FunderMax Compactplatten Schichtstoffplatten Beschichtete Spanplatten
493 Gesund wohnen | biologisch zirbelholz

Gesund wohnen. Biologisch wohnen. barrierefrei wohnen ein traumhaftes Gefühl. Mit Relax@Home dem neuen ... . Metallfreie Möbel Schlafsysteme Betten Kissen . Barrierefrei wohnen . . D Planungsstudio
relaxathome.at Zirbelholz Gesund Barrierefrei Wohnen Betten Schlafsysteme Möbel Schreinerei
494 Zeitreise 4.5 Home Altwaren

Platz für Ihren Slogan ... ! Bei mir finden Sie Möbel Glas Porzellan Bücher uvm. aus den verschiedensten Epochen. Lassen
zeitreise45.at Altwaren Gebrauchtwaren Räumungen Verlassenschaft
495 Tischlerei Haas GmbH Haas

Tischlerei Haas in Grödig bei Salzburg produziert Möbel und Einrichtung und ist Spezialist für Raumgestaltung
tischlereihaas.at Haas Tischlerei Grödig Salzburg
496 HOLZSIGI: Home HolzSigi

Handgemachte maßgerfertigte Möbel aus Massivholz aus der Oberpfalz im Herzen Bayerns. HOLZSigi fertigt Ihre ... Skip to navigation Skip to content HOLZ-SIGI Datenschutz Home Möbel Gartenhaus Saunen
holz-sigi.at HolzSigi Massivholz Schreinerei Massivholz Schreinerei
497 Serecom SEsselREanimationCOMpany

Möbel mit faszinierender Austrahlung aus einzigartigen Stilepochen f?r die Wohnräume der Gegenwart wiederbelebt. Vintage ... Glanz zurückzugeben. Möbel mit faszinierender Austrahlung aus einzigartigen Stilepochen f?r
serecom.at
498 Naturkosmetik Naturprodukte für

Naturkosmetik Möbel Nahrungsergänzungsmittel günstig bestellen Tipps für Allergie Neurodermitis gesunde ... Atemschutz Bücher und Notfallhelfer Möbel Bett Nach Kategorie Wohnaccessoires Ordnung Auflagen/Unterbett
purenature.at
499 ARTELIA AT | Rattan Paket 24 GmbH Gartenmöbel
12527
Berlin
Wir ? Gartenmöbel aus Polyrattan. Egal ob Loungemöbel Terrassenmöbel oder Rattanmöbel wir bieten ... Artelia Lounge Möbel Mein Warenkorb Zur Kasse Angebote Rattanmöbel Loungemöbel Esstisch Sets Sofas
artelia.at Gartenmöbel Polyrattan Gartenmöbel Rattan Gartenmöbel
500 Tischlerei Baumgarnter Bautischlerei

Wir sind eine Bau und Möbeltischlerei in 1150 Wien mit eigener CNCAnlage. Wir erzeugen Kastenfenster ... Ladenbau Möbelprogramm Restaurierung Materialkunde Häufig gestellte Fragen CNC Möbel Kinderzimmer
tischlerei-baumgartner.at Bautischlerei Möbeltischlerei CNCAnlage Möbelrestaurierung
501 Www.artigo.at Mein Wohndesign Lampen

Große Auswahl an Gartenmöbeln Stühlen Sesseln Tischen Couchtischen sowie Küchenutensilien ... und lassen Sie sich inspirieren. Finden Sie Ihre Traum-Möbel und überzeugen Sie sich selbst von bester
artigo.at Lampen Liegen Küchenutensilien Möbel Online
502 Rattan Dreams Ihr Burger & Degroute Rattan Dreams GmbH Rattan
4061
Pasching
Besuchen Sie unseren Showroom in Linz Pasching und genießen Sie Momente der Ruhe und ... Ihnen ein exklusives Sortiment an hochwertigen und stilvollen Rattan-Möbel. Verleihen Sie Ihrem Garten Ihrer Terrasse
rattan-dreams.at Rattan Möbel Moebel Garten Design Wellness Oase Sauna
503 Hopfer Siegfried Haus Reparaturen

Hopfer Siegfried für Haus und Garten Reparatur und das Aufstellen bzw. Einbau Ihrer ... ! Die Reparatur und das Aufstellen bzw. Einbau Ihrer Möbel bis hin zum Verlegen Ihrer Fertigparkettböden biete
hopfer-sigi.at Reparaturen Haus Garten Hecke
504 Sitzmöbel Bär Home Sitzmöbel

Unsere Möbel sind robust zeitgemäß individuell in der Farbgebung und mit viel Liebe ... über unser reichhaltiges Angebot an Sitzmöbeln zu verschaffen. Unsere Möbel sind robust zeitgemäß individuell
sitzmoebel-baer.at Sitzmöbel Bär Baer Sitzmoebel
505 Das Ideenreich Fieberbrunn

Das Ideenreich Fieberbrunn ist ein kleiner Laden. Hier findest Du Annie SloanProdukte wie Chalk Paint ... Gründe um alte Möbel aufzupeppen Die Qualität und das Handwerk von früher Erinnerungsstücke
dasideenreich.at
506 Mode Schuhe

Schuhe Mode Möbel und vieles mehr online kaufen. Große Auswahl ? Top Marken ... Kinder Babies Trachtenmode Accessoires Taschen Schmuck Uhren Brillen Möbel Heimtextilien Sport
ladenzeile.at
507 Potocnik Home Schreiner
8572
Bärnbach
Potocnik Bärnbach ... ist die Technik des Drechselns wieder in die Gestaltung unserer Möbel und Bauwerke zu integrieren
drechslerei-potocnik.at Schreiner Schreinerei Tischler Möbel
508 Home Schreiner
8223
Stubenberg
Tischlerei Bausch Stubenberg ... aus. Mit viel Liebe zum Detail und mit sauberer Handwerksarbeit fertigen wir Ihre Wunsch-Möbel
tischlerei-bausch.at Schreiner Schreinerei Tischler Möbel
509 Home Plainer Großhandel

Herzlich willkommen beim Spezialisten für Sicht und Sonnenschutz. Leben und Wohnen Sie Ihren persönlichen Traum ... Möbel. Bei uns profitieren Sie von maßgefertigten Produkten. Wirwissen worauf es ankommt ? gutes Design
plainer-innendesign.at Großhandel Für Innendesign Innendesign Franz Plainer
510 MEISTER MÖBEL


meister-moebel.at
511 ::: ROSSMANN MÖBEL :::


rossmann-gmbh.at
512 Möbel Haselbauer


haselbauer.at
513 Möbel Leitgeb


moebel-leitgeb.at
514 DB möbel


db-moebel.at
515 Möbel nach mass


massmoebel4you.at
516 Tischlermeister Uwe Heymann in Möbelwünsche
12101
Berlin Tempelhof-Schöneberg
Tischlermeister Heymann in Berlin Tempelhof Schöneberg realisiert seid über 25 Jahren nahezu all Ihre Möbelwünsche. ... Form follows function Aktuell haben wir Möbel im Sonderverkauf siehe unten Planungsmöbel Regal
moebelwunsch.at Möbelwünsche Möbelwunsch Heymann Uwe Heymann
517 TISCHLEREI SCHWAB A5205 tischler
5205
Schleedorf
TISCHLEREI SCHWAB A5205 SCHLEEDORF DIE TISCHLEREI IHRES VERTRAUENS ... Tischlerei Schwab - Munten - A- Schleedorf - Möbel nach Maß - Wohnen - Küche - Bad
tischlerei-schwab.at Tischler Tischlerei Schwab Schleedorf
518 Tischlerei Kases GmbH Tischler


kases.at Tischler Tischlerei Waldviertel Kunst
519 Home  Einrichtungen Eilmannsberger EILMANNSBERGER GmbH Ulrichsberg
4150
Rohrbach
EILMANNSBERGER MHK Küchenpartner Fenster Türen Innenraum Individuell geplant und in
eilmannsberger.at Ulrichsberg Rohrbach Meisterbetrieb Küche
520 System8X regalsystem

system8X ist ein indiviuell gestaltbares Regalsystem oder auch Möbelsystem/Möbelbausystem bestehend aus massiven Komponenten.
system8x.at Regalsystem Regalsysteme Ordnerregale Büroschrank
521 Equip 4 Event GmbH equip4event GmbH miet
1120
Wien
Verleih von Mietmöbel für alle Arten von Veranstaltungen ... Das ideale Mietmöbel Sortiment Wir haben die Möbel Sessel Tische Hussen Zelte
equip4event.at Miet Möbel Sessel Tisch Husse Verleih Event Messe
522 Iser Antik Antikmöbel

Die Firma Iser Antik bietet alles rund um die antike Möbel an: Restauration An ... Substanz wieder zur Geltung bringen. Überlieferte Möbel sind ein Dokument ihrer Zeit und das jeweilige
josefiser.at Antikmöbel An Und Verkauf Antikmöbel Restaurierung
523 Übersiedlung Räumung übersiedlung

wir machen Übersiedlungen EU weit Räumungen in ganz Österreich entsorgungen alter Möbel ... Demontage von Möbel Küche usw. Verpackungsmaterial Verpackung Kleintransport Lieferung usw
ubsumzug.at übersiedlung Räumung Umzug Entrümpelung
524 Karasek Gartenmöbel hochwertige St. Karasek & Co Ges.m.b.H & Co KG Gartenmöbel
1230
Wien
Karasek Gartenmöbel bietet hochwertige Möbel für Garten und Terrasse wie Gartentische Gartenstühle ... Outdoor-Möbel für Gastronomie und Hotellerie. Wellnessmöbel Wellnessliegen Saunaliegen Kippliegen Profi
karasek-gartenmoebel.at Gartenmöbel Gartenstühle Gartenliege Gartentisch
525 Tischlerei in Kirchberg /

Unsere Tischlerei in 3204 Kirchberg an der Pielach Niederösterreich fertigt Maßmöbel und hochwertige Sitzmöbel. ... Anfahrt Möbel von KA-GA bedeuten Möbel nach Ihren Ansprüchen mit hoher Qualität und sehr guter
ka-ga.at
526 Home tischlereihauserbernhard.at Ein

Bereits seit Generationen fertigen wir in unserer Werkstätte ... Werkstätte Möbel. Mit Liebe zum Detail - kein Stück ähnelt dem Anderen. Unser Team begleitet
tischlerei-hauser-bernhard.at Ein Lebendiges Atmendes Material
527 Karasek Gartenmöbel hochwertige St. Karasek & Co Ges.m.b.H & Co KG Gartenmöbel
1230
Wien
Karasek Gartenmöbel bietet hochwertige Möbel für Garten und Terrasse wie Gartentische Gartenstühle ... Outdoor-Möbel für Gastronomie und Hotellerie. Wellnessmöbel Wellnessliegen Saunaliegen Kippliegen Profi
xn--objektmbel-kcb.at Gartenmöbel Gartenstühle Gartenliege Gartentisch
528 Ainhirnholz

Tischlerei Ainhirnholz: Möbel von Tischlermeister Raphael Ainhirn aus Graz; gefertigt in Kumberg (Graz Umgebung); Markenzeichen: ... auf den Kopf und gibt dem massiven Möbel seine Leichtigkeit zurück. Details zum Projekt ? Rubiko Wenn Würfel
ainhirnholz.at
529 Firma Bracha Home Möbel
1140
Wien
Firma Bracha Wien ... Ihre Vorteile im Überblick Individuelle Planung und Gestaltung Ihrer Möbel Flexible Beratung im Möbelstudio
bracha.at Möbel Holz Möbelhaus Einrichtung
530 Home Tischlerei Spanner Tischlerei Spanner GmbH Tischler
8271
Großhart
Seite der Tischlerei Spanner Großhart ... Wir fertigen mit viel Liebe zum Detail und qualitativ hochwertiger Handwerksarbeit Ihre Wunsch-Möbel
tischlerei-spanner.at Tischler Tischlerei Möbel Holz
531 TISCHLEREI STEPPAN . BAU Bau- und Möbeltischlerei Steppan GmbH keywords
2340
Mödling
Die Tischlerei Steppan hat sich in über 80 Jahren zum Spezialisten für hochwertige Möblierungen und ... für jeden Einrichtungswunsch vom einzelnen Möbel bis zur Komplettausstattung Ihrer Wohn- und Geschäftsräume. Unsere
tischlerei-steppan.at Keywords
532 Gastrobedarf VEGA VEGA Vertriebs GmbH & Co. KG
4470
Enns
Bei VEGA finden Sie eine große Auswahl an Gastrobedarf wie Porzellan Besteck Gläser ... Besteck Tafeln Porzellan Speisekarten Exclusive by VEGA Gastronomie-Möbel Porzellan/Geschirr Besteck Glas
vega-direct.at
533 MoebelSpot.at Der günstige online

Top Angebeote für Büromöbel wie Drehsessel Chefsessel Stühle wie auch für Gartenmöbel ... Newsletterregistrierung Moebel Spot - Günstige Möbel für das Büro für den Wohnbereich oder Garten Startseite Bürosessel
moebelspot.at
534 Antiquitäten Holzrestaurator :: möbel

Restauration von Möbeln aller Stilrichtungen speziell alte Oberflächen Polituren Marmorierungen Bauernmalereien und ... Bauernmalereien und Schnitzereien. Nachbau alter Möbel Entwurmung und Beratung zurück nach oben Home
holzrestaurator.at Möbel Holz Restaurierung Restauration Reparatur Konservierung Holzobjekte Restau
535 Tischlerei Mild Sinabelkirchen/Steiermark tischlerei

Tischlerei Mild seit 1905. Ein Familienunternehmen mit Spezialisierung auf zwei besondere Formensprachen: kompromisslose Moderne ... Herzlich willkommen bei Mild der Spezialist für besondere Möbel. Diese Seite benötigt Flash
mild1905.at Tischlerei Architektur Design Moderne Tradition Handwerk Handwerlich Handwerke
536 Home Die Wohnwerkstatt GmbH wohnwerkstatt
5020
Salzburg
Holztisch Zirbenbett Vollholzkueche Leiterstuhl Kinderzimmer aus Holz Ahorn Esche ... tadelloser Produktion zu verbinden. WKO wohnwerkstatt diewohnwerkstatt möbel massivholz vollholz
wohnwerkstatt.at Wohnwerkstatt Diewohnwerkstatt Moebel Massivholz
537 Jugendstil Lampen Antiquitäten

...  Jugendstil Lampen - Antiquitäten Wien - Art Deco - Jugendstilmöbel - Möbel - Möbelhersteller
galerieholzer.at
538 Kleinanzeigen für Österreich
8582
Rosental
? 10.000 kostenlose private Kleinanzeigen ? Auto Motor ? Immobilien ? Haushalt Möbel ... Benutzername Passwort Vergessen Alle Kategorien Haushalt Möbel TV - Hi-Fi - PC Immobilien
12kleinanzeigen.at
539 Antiquitäten Altwaren Antiquitäten

Ankauf und Verkauf von Antiquitäten Altwaren Verlassenschaften Antike Möbel via Experte ... Gegenstände und bieten damit umfassende Möglichkeiten für alle die alte Teppiche und antike Möbel Ölgemälde
antik-experte.at Antiquitäten Antiquitäten Ankauf Altwaren Altwaren
540 Antiquitäten Edith Edler
1010
Wien
Biedermeier Jugendstil Barock Gotik Schmuck Wien Wiener Gemälde Silber Porzellan Restaurierungen Möbel Antik ... Ankauf Möbel Antiker Schmuck Silber Skulpturen Porzellan Gemälde Kontakt Anfahrt Hier finden
antiquitaeten-edler.at
541 Tapezierer Raumausstatter Bodenleger Polsterer Raumgestaltung Leitner e.U. Raumausstatter
4261
Rainbach
Tapezierer Raumausstatter Tapezierer Bodenleger Polsterer Vorhänge Bodenbeläge OÖ Raumausstatter Leitner ist Tapezierer Polsterer
raumgestaltung-leitner.at Raumausstatter Tapezierer Bodenleger Polsterer Vorhänge Bodenbeläge OÖ Raumausst
542 Tischlerei ? Ausstellungshaus Griessner Silverius

Graz Leicht Küchen Tischlerei Griessner Neumarkt Steiermark Planer Generalunternehmer Wohnkultur und bietet als solche eine ... /Wintergarten/Außenanlage Möbel Wohnzimmer Küche Küchen-Modelle Innenausstattung High Glass Innenausstattung
morsoe.at Silverius Cornelia Austellungshaus Möbel Fenster Leim Hobel Bretter
543 Teak Gartenmöbel Vorarlberg Teak

Wir sind Direkt Importeur! PREMIUM QUALITÄT und PREMIUM PREISE ? Über 200 Modelle ab Lager ... Vorarlberg Teak in HARD Garnitur Teakbank Teaktisch garten möbel TEAKHOLZ by Ländle Teak Gartenmöbel
laendleteak.at
544 Freissling KG || Gestaltung

... freissling Herzlich willkommen GESTALTUNG MÖBEL RAUM OBJEKT Wohnen im Stil der Zeit mit Möbeln aus Holz
freissling.at
545 Außergewöhnliche Shopartikel fürs Wohnen Evtravagante
5026
Salzburg
Sinnliches Wohnen mit 15 Joys Girls like Red Männerspielzeug für Segler Golfer ... In Ihrem Warenkorb Artikel EUR Navigation Einrichtungsberatung Salzburg - Wien Von A - Z STILE MÖBEL
15joys.at Evtravagante Wohnaccessoires 15joys Sinnlich
546 Tapezierer in Perchtoldsdorf bei
2380
Perchtoldsdorf
Bereits in 3. Generation bin ich Manfred Scheuer als Tapezierer in Perchtoldsdorf tätig. ... Terminabsprache + Willkommen Meine Leistungen Möbel aufpolstern Tapetenarbeiten
tapezierer-scheuer.at
547 GaragenContainer Mieten Vermietung Garagen
1130
Wien
Garagen und Container zu vermieten Einlagern von Auto Motorrad Möbel usw. ... wie Möbel selten Gebrauchtes oder sonstige Utensilien ect. kurzfristig oder auch für länger einlagern
garagen-container.at Garagen Mieten Container Mieten Wien Süd
548 Allnatura natürlich schlafen allnatura Vertriebs GmbH & Co. KG allnatura
73540
Heubach
Hier finden Sie alles für das natürliche Wohnen und den gesunden Schlaf. Massivholzbetten mit orthopädisch ... Wandregale TV-Möbel Entscheidungshilfe Allgemeine Infos Nach Holzart TV-Möbel Kiefer TV-Möbel Buche TV-Möbel
allnatura.at Allnatura Matratzen Naturmatratzen Latexmatratzen
549 Tafel Folien Kreidetafel KaRo Products GmbH Tafelfolie
60385
Frankfurt
Kreidetafel Tafel Folie Selbstklebefolien Dekor Klebefolie Wandfolien magnetische selbstklebende Tafelfolien für Wände und Möbel
tafelfolie.at Tafelfolie Möbel Wand Tür KlebeFolien Tafel TafelFolie Kindertafel
550 Completesolutions küchen

complete solutions Ihr Ansprechpartner für Küchen Renovierung Möbel Fronten Arbeitspatte Scharniere ... und Reparaturen Küchen renovieren Arbeitspaltten und Fronten tauschen Möbel Reparatur. Vermittlung
completesolutions.at Küchen Renovierung In 1220 Wien
551 Home Tischlerei
9601
Arnoldstein
Der Tischlermeister Betrieb in Kärnten Tischlerei Mikula Gesamtanbieter im Holzbaubereich ... Eindruck zählt! Weiterlesen Möbelstücke Was wäre ein Raum ohne Möbel? Weiterlesen Beratung Sie schätzen
tischlerei-mikula.at Tischlerei Mikula Mikula Andi Mikula
552 Kontakt möbel

AK Raum und Möbeldesign
raum-moebeldesign.at Möbel Moebel Ak
553 Boxspringbetten Salzburg Egon Boxspringbetten

Sie suchen Boxspringbetten Salzburg? Bei www.stapelstuhl.at finden Sie günstig Boxspringbetten für Ihren Gebrauch. Möbel ... Hier finden Sie Möbel und Einrichtungsgegenstände für Büros und Konferenzräume Universitäten Schulen
heinzscheurer.at Boxspringbetten Salzburg Egon Eiermann Salzburg
554 Zottler Tischlerei aus Passail M. Zottler Tischlerei GmbH
8162
Passail
Die Zottler Tischlerei aus Passail fertigt für Sie Holztüren Möbel uvm. an. Bei Fragen ... . So sind wir eben! Hochwertige Möbel aus dem traditionellen Werkstoff Holz in harmonische abgestimmter Kombination
zottler-tischlerei.at
555 Alex Montagen Montagetischler alex

Ob Parkettboden verlegen Stiegen belegen Türen setzen oder Möbel montieren Alexander Nagel ... oder Möbel montieren ? Wenn Sie einen Parkettboden verlegen lassen wollen oder ein altes Parkett sanieren mÃ
alexmontagen.at Alex Montagen Montagetischler Alexander Nagel
556 Balidesign AsienLifestyle für
4470
Enns
Asiatisches Lebensgefühl für Zuhause. Gartendesign und Wohndesign. Moebel und Figuren aus Stein Lavastein ... Petrified Wood Möbel Steinwaschbecken Palmvasen Holzbuddha Holzfiguren Holzfiguren >cm Tische Dekoartikel
balidesign.at
557 Startseite Kaiserkinder | Kinder

Hier finden Sie das gesamte Kinderprogramm vom Kindermuseum 'Schloss Schönbrunn erleben' von Schloß Schönbrunn ... Mediathek Neuigkeiten Am . Dezember im Hofmobiliendepot - Möbel Museum Wien Kinderprogramm
kaiserkinder.at Kinder Museum Programm Geburtstag
558 Home Haka
8530
Deutschlandsberg
IDEEN PLANUNG BAUBETREUUNG FERTIGUNG MONTAGE SERVICE Haka hat nicht ... oder + Mail officebelawohnkultur TYPO Webseite von abaton GmbH
belawohnkultur.at Haka Küchen Modulnova Gorenje Stocco Das HW Möbel
559 Willkommen Trocknung

Ihr zuverlässiger Partner bei Wasser und Brandschadensanierung! ... Willkommen Trocknung nach Wasserschaden Möbel De- und Remontage Bautrocknung Leckortung
btt.at Trocknung Wasserschaden Möbel Montage
560 Massivholz Tischler Massivholzmöbel

Massivholzmöbel massivholz Echtholz echtholz echtholz massivholz Naturholz Naturmöbel ... . üMaßanfertigung wir passen unsere Möbel genau nach den Bedürfnissen an und verwenden nicht zwingend Standardmaße
schnitzerei-krenn.at Massivholzmöbel Naturholz Naturmöbel Naturholzmöbel
561 Nilian Möbeldesign tischler

Der Lebenssituation angepasste Möbel aus Hölzern die Ihre persönliche Entwicklung unterstützen mit subjektiv intuitiver ... Ihrer Lebenssituation angepasste Möbel zur Unterstützung der persönlichen Entwicklung Dipl. Ing
nilian.at Tischler Holzbau Innenausstattung Massivholz
562 Sammelwerk Raritäten

Sammelwerk Raritäten Hochwertige Gebrauchtwaren in Graz. Stöbern und finden Sie Porzellan ... Möbel Accessoires Kunstgegenstände Kreative Geschenkartikel Radios Neuwertige Fernsehgeräte
sammelwerk-graz.at
563 MicTrans: Klavierexpress Umzug

Transportunternehmer für Klaviertransport Umzug Übersiedlung Lastentaxi Räumung und Delogierung in Wien ... mit einem Fuhrpark von Möbel LKWs und erfahrenen Transportprofis Möbelpacker und Klavierträger
klavierexpress.at Umzug Übersiedlung Klaviertransport Lastentaxi Wien
564 MÖBELWERKSTATT Michael Johann Tischler

Die Tischlerei mit Schwerpunkt Designentwurf und Möbelproduktion von hochqualitativen individuellen Lösungen für den Privat und
moebelwerkstatt.at Tischler 1140 Wien Möbel Holz
565 TISCHLEREI Diwald KEG Tischler


diwald.at Tischler Tischlerei Möbel Stiegen
566 Gastrodesign lokaleinrichtung gastrodesign hotelausstattung gastrodesign


gastrodesign.at Gastrodesign Gastrodesign Lokaleinrichtungen Hotelausstattungen Grossküchen Lade
567 Neudoerfler Büromöbel und OfficeSysteme: Neudoerfler

Erfolg lässt sich einrichten Büromöbel und moderne Raumsysteme mit Fokus auf Design und Beratung. ... . Erfahren Sie mehr über unsere Produkte. MARK pro - exklusiv und flexibel Möbel für Entscheider
xn--neudrfler-37a.at Neudoerfler Office Büromöbel Österreich
568 ONLINE VERKAUF mit gartenmöble

qualitativ hohwertig in großem auswahl diskont preisen auslieferung in ganz österreich gartenmöbel tisch stühle gartenmöbel ... JAGD und WEINKELLER POLYHOLZ MÖBEL GARTENMÖBEL TERRASSENMÖBEL BIERGARTEN GARNITUREN
gartendiskont.at Gartenmöble Garten Moebel Gartenmöbel Garnituren
569 Daniela Lenger Restaurierungen Möbelrestaurierun

Restaurierung von Stilmöbel ... vor. Meine Restaurierungsarbeiten umfassen hauptsächlich furnierte Möbel und Hartholzmöbel. Da jedes Möbelstück
stilmoebelrestaurierung.at Möbelrestaurierung Restaurierung Möbel Restauration
570 Tischlerei HIESS Home tischlerei
3040
Neulengbach
Tischlerei Wolfgang Hiess qualitative Bau und Möbeltischlerei im Wienerwald. ... nach ihren Wünschen und nach Maß. Sämtliche Möbel Türen und Fenster werden aus qualitativ hochwertigem Holz gefertigt
tischlerei-hiess.at Tischlerei Holzmöbel Holzmoebel Hiess
571 Willkommen bei Frauenberger´s Frauenberger´s Wohnen und Garten OG Frauenberger´s
2011
Sierndorf
Willkommen bei Frauenberger´s Wohnen und Gartenaccessoires! Bei uns finden Sie Ideen wie sie schöner ... Navigation überspringen Home Aktuelles Advent Wohnen Garten Shabby-Chic-Möbel Homestory Jobs
frauenbergers.at Frauenberger´s Frauenbergers Frauenberger's Wohnen
572 Service Montage Bau Tischler
6500
Landeck
Service Montage Bau und Möbelteile Stanz bei Landeck ... Partner wenn es ums Montieren geht egal ob Möbel Küchen Türen oder Fenster. Wir montieren
service-montage.at Tischler Tischlerei Möbel Möbelmontage
573 Www.montafonshop.at Der Onlineshop Montafon

Montafoner Möbel Schrank Tisch Bank Sessel Kassette Einlege
montafon-shop.at Montafon Montafonshop Montafonshop Handwerk
574 Optima Finanz | Kredite OptimaFinanz Vermögensberatung GmbH Finanzierungen
6020
Innsbruck
Der langersehnte Traumurlaub das neue Auto oder die neuen Möbel sind näher als Sie ... Auto oder die neuen Möbel sind näher als Sie denken. Mit einem Sofort Kredit von Optimafinanz
optimafinanz.at Finanzierungen Kredit Vorsorge Versichern
575 Küchen Möbeldesign Andreas
3200
Ober-Grafendorf
Küchen Möbeldesign Andreas Voak finden Sie in in 3200 OberGrafendorf bei Sankt Pölten. In ... Pölten. Er fertigt auch in seiner Tischlerei Möbel nach Ihren Vorstellungen und sorgt
holzinharmonie.at
576 Optima Finanz | Kredite OptimaFinanz Vermögensberatung GmbH Finanzierungen
6020
Innsbruck
Der langersehnte Traumurlaub das neue Auto oder die neuen Möbel sind näher als Sie ... Auto oder die neuen Möbel sind näher als Sie denken. Mit einem Sofort Kredit von Optimafinanz
express-kredit.at Finanzierungen Kredit Vorsorge Versichern
577 Home Mülltaxi Mülltaxi- Eigentum der Domizil & Partner Gebäudemanagement und Hygienetechnik GmbH
8053
Graz
Abholung Abtransport von Müll Sperrmüll Holz Metall Glas Papier ... Sperrmüll Glas Holz Papier Metall Grünschnitt Möbel Elektroschrott Akten etc. Unsere freundlichen
xn--mlltaxi-n2a.at
578 Optima Finanz | Kredite OptimaFinanz Vermögensberatung GmbH Finanzierungen
6020
Innsbruck
Der langersehnte Traumurlaub das neue Auto oder die neuen Möbel sind näher als Sie ... und Diskret Kredite Finanzierungen Der langersehnte Traumurlaub das neue Auto oder die neuen Möbel
optimakredit.at Finanzierungen Kredit Vorsorge Versichern
579 DER neue Concept Store

Bei Möblich gibt es MöbelUnikate Accessoires und Geschenke mit Flair. Wir stehen für kreative ... aus vergangenen Zeiten. Jedes unserer Möbel wurde mit Mut zu Extravaganz und Liebe zum Detail restauriert
moeblich.at
580 Tische aus Massivholz

Exklusive Möbel aus Holz ? natürlich zeitlos und beständig. Massivholztische aus Natureiche Wildeiche ... . Zu den Holztischanfertigungen Massivholz Design Jedes Möbelstück ist eine Einzelanfertigung. Exklusive Möbel aus Holz
massivholz-design.at
581 BUEROQUADRAT BQWEBSHOP Startseite Büroquadrat Büro- und Objekteinrichtungs GmbH
5020
Salzburg
Büroquadrat GmbH Büround Objekteinrichtung Medientechnik Möbel Wohnbereich Küche Wohnraum Schlafbereich Schlafraum Schnäppchenpreise ... ) Möbel für den Wohnbereich Qualität die begeistert
bq-webshop.at
582 HandschlagQualität weil es wohnung

Wohnung Office Haus © Von der Planung über Bau Ausbau und die ... kompetente Planung und professionelle Ausführung aller Arbeiten. Ihr Partner für Möbel Vorhänge
handschlag.at Wohnung Wohnen Immobilien Luxuswohnung
583 Möbelaufbau24.de kompetent Möbelaufbau24.de® Hagen Mattik und Kay Wasmund GbR Möbel
13593
Berlin
Möbelaufbau Möbelreparatur Handwerksarbeiten ... für Ihre Möbel Mit der Erfahrung aus über Jahren Möbelaufbau und mehr als zufriedenen Kunden pro Jahr
moebelaufbau24.at Möbel Möbelmontage Möbelmontagen IKEA
584 Präsentationsmöbel Hedron

Das entwickelte Möbel kann unterschiedliche Materialien (Glas Metall Holz Kunststoff) kombinieren und ... eines neuartigen Präsentationsmöbels. Das entwickelte Möbel kann unterschiedliche Materialien (Glas Metall Holz
hedron.at
585 EF Kreativwerkstatt acryl

Lassen Sie sich in meiner MiniaturenWelt verzaubern und inspirieren! Bei mir finden Sie wunderschöne Artikel
efkreativwerkstatt.at Acryl Antik Aquarell Basteln Kleidung Bestellen Bilder Blumen
586 StauRaum Self Storage in stauraum
5023
Salzburg Gnigl
Sie suchen Stauräume Mietflächen und Lagerflächen? Stauraum zum Self Storage in Salzburg bietet gewerbliche
mietflaeche.at Stauraum Stauräume Lagerflächen Mietfläche
587 Fussball Fanshop für Österreich fanshop
84529
Tittmoning
Fanshop für Fussballfans aus Österreich. Fanartikel in den Farben des österreichischen Fussball Nationalteam`s. Möbel ... Fanshop.at Fanshop für Fussball-Österreich! Home Fanartikel Fanpakete Fanreisen Sonstige
fanshop24.at Fanshop Fanshop österreich Fussballer Fussballfans
588 Bambusmöbel Bambusbetten Hochwertige BambusmöbelLars bambusmöbel

... Bambusmöbel Möbel aus Bambus Bambusbetten Wintergarten mit Bambusmöbel Möbel im Wintergarten
bambusbetten.at Bambusmöbel Bambusmöbel Babmusmöbel Bambusmöbel Bambus Möbel Bambusmöbel Bambusb
589 Wohndesign aus dem Waldviertel Tischlerei

Planung und Fertigung sämtlicher Einrichtungen ... Essen Tische Boden Terrasse Bilder Unternehmen Links WILLKOMMEN Sie suchen - Möbel die individuell
wunschtischler.at Tischlerei Wunsch Rieggers Zwettl
590 Lorient | Lorient Sinnliches Babouche

... marokkanisches kunsthandwerk Marokko Naturkosmetik onlineshop orientalische Möbel Rassul savon noir
lorient.at Babouche Celige Ghassoul Marokkanisches Kunsthandwerk
591 Startseite | Günter Daxberger Tischler

Günter Daxberger angesagter HolzDesigner in Punkto Holzaccessoires Holzteppiche und Sonderanfertigungen. ... Holzdesign mit Flair Wir fertigen unsere Teppiche sowie Möbel und Accessoires nach Ihren Wünschen
holzteppich-daxberger.at Tischler Holzverarbeitung Holzteppich Holzaccessoires
592 Startseite tischlerei
2640
Gloggnitz
Wir arbeiten stehts nach dem Motto geht nicht gibt`s nicht daher ist es uns ... Ihre Wünsche Möbel werden Unsere Aufträge belaufen sich vom Privatbereich bis hin zum Objektbereich
moebel-bauer.at Tischlerei Moebel Bauer Tischler Küche Küchenplanung
593 Startseite | Günter Daxberger Tischler

Günter Daxberger angesagter HolzDesigner in Punkto Holzaccessoires Holzteppiche und Sonderanfertigungen. ... Holzdesign mit Flair Wir fertigen unsere Teppiche sowie Möbel und Accessoires nach Ihren Wünschen
holzteppiche.at Tischler Holzverarbeitung Holzteppich Holzaccessoires
594 Wohnplan Tischlerei Wannemacher Wohnplan
2253
Weikendorf
Wohnplan Tischlerei Wannemacher in Weikendorf ... und Holzbau - auch Ihr Büro wird nach neuesten ergonomischen Erkenntnissen gestaltet. Möbel vom Tischler
wohnplan.at Wohnplan Tischlerei Tischler Möbel
595 Pia Reger Interior

Meine wunderschönen Stoffkollektionen aus Frankreich England und Italien. Tapeten aus London und Paris ... Teppiche Möbel Das Unternehmen Nach einer fundierten Ausbildung im Bereich des Interior-Designs machte
interiordecoration.at
596 Contur die kunst contur

Welcome by contur die Kunst der traditionellen Einlegearbeit
contur.co.at Contur Moebel Möbel Möbel
597 DanKüchenstudio Ybbs Kemmelbach mit Dan

Die Staudinger Dolp OEG ist seit Jahren in den Bereichen Wohnen Möbel ... Qualitätsstandards. Die Staudinger Dolp OEG ist seit Jahren in den Bereichen Wohnen Möbel Licht und Design
dan-ybbs.at Dan Küchen Danküchen Studio
598 Grünzweil Ihr SteinmetzBetrieb Steinmetz
4184
Helfenberg
Naturstein Ideen für Küche Möbel Eingang Fassade Diele Terrasse Bad ... Stiege Küche Möbel Bad Sanitärbereich Terrasse Garten Grabdenkmal Fensterbänke Restauration
steindesign.at Steinmetz Rohrbach Steinmetz Urfahr Steindesign
599 Über uns Tischlerei
5412
Puch
In unserer Tischlerei entstehen seit 1998 Möbel und Inneneinrichtungen von höchster Güte. Zwei Tischlermeister ... Möbel und Inneneinrichtungen von höchster Güte. Zwei Tischlermeister ein Tischlergeselle und zwei
tischlerei-gschwandtl.at
600 HELMUT DOLZER | Planen Helmut

Helmut Dolzer Planen Handel Möbelmontage in Engerwitzdorf in Oberösterreich erzeugt moderne
dolzer-tischler.at Helmut Dolzer Dolzer Planen Planen
601 Hoflehner Interiors | Raumplanung Hoflehner GmbH & Co KG
4030
Linz
Auf internationalen Messen und Showrooms suchen wir die schönsten Möbel der Welt für Sie aus. ... bei Hoflehner Interiors Jetzt im November minus % auf alle Möbel der Kultmarke edra! Willkommen auf Hoflehner
hoflehnerinteriors.at
602 Umzugtransport.at Umzug und umzug

MegiTrans ist Ihr zuverlässiger und starker Partner für Transporte aller Art Umzug und Transport ... Kellern und Dachboden und der sachgerechten Entsorgung des ausgeräumten Abfalls und Möbel
umzugtransport.at Umzug Umzig Wien Umzug Wien Transport Transport Wien
603 Zirbenliebe: Home Zirbenliebe
8750
Judenburg
Die Tischlerei Zitz in Judenburg ist Spezialist für die Fertigung von Zirbenmöbel. Ein besonderes MöbelHighlight ... Zirbenschlafzimmer Exclusive Zirbenschlafzimmer Jugendtraum Zirbengitterbett Möbel Modernes Zirbenlokal Moderne
zirbenliebe.at Zirbenliebe Zirbe Zirbenlampe Zirbenliege
604 Interieur H. Haider | Kunsthandel
3002
Purkersdorf
Unser AntiquitätenGeschäft finden Sie in Wien Umgebung nur 3 km entfernt vom Weststadtrand Wiens ... - Purkersdorf bei Wien "Interieur"- Kunst- und Antiquitätenhandel Harald Haider Das feine Möbel
haider-interieur.at Kunsthandel Antiquitäten Antiquitätenhandel Antiquitäten Restaurierung
605 Ankauf Antik Ankauf
44135
Dortmund
Ankauf antik Ankauf Antiquitäten Ankauf Gemälde Ankauf alte Bücher antike Möbel Bronzefiguren ... qm GEMÄLDE BÜCHER MÖBEL Möbel Bücher Haushaltsauflösung Antiquitaeten Ankauf Dortmund Bochum
verlassenschaften-ankauf-wien.at
606 Tischlerei Feng Shui pittini
8753
Fohnsdorf
Robert Pittini Tischlerei Feng Shui ... Möbel begleiten Sie viele Jahre lang. Wählen Sie aus verschiedenen Holzarten Stilrichtungen
pittini.at Pittini Robert Tischlerei Feng Shui
607 Rainer Holz Möbelwerkstätte tischlerei
9622
Weißbriach
Die Möbelwerkstätte Rainer Holz bietet Ihnen Planung Anfertigung und Montage von Möbeln an. Ihr ... bei der fertigung individueller möbel und einrichtungen. klicke auf das bild um in die jeweiligen kategorien
rainerholz.at Tischlerei Rainer Holz Moebel Werkstaette
608 Günstige gebrauchte Büromöbel in Büro

Riesiges Angebot an gebrauchten Büromöbeln. Sensationelle Aktionsangebote. Tägliche Zustellung und Montage. Konkursverwertung. Permanent wechselndes Sortiment. ... Fantoni Blaha und vielen Qualitätsmarken mehr in top gepflegter Qualität. Täglich neue Möbel
xn--gebrauchtebrombel-d0b4i.at Büro Möbel Konkursverwertung Billig Günstig Lieferung Montage Vermietung
609 De Witt Küche Arbeitsplatte
4060
Leonding
de Witt Möbel nach Maß Selbstbaumöbel Küche Wohnzimmer Vorzimmer
dewitt-leonding.at Arbeitsplatte Aus Buche Dewitt De Witt
610 Tischlerei Halwachs Georg in Tischlerei

... Fähigkeiten dafür ein Möbel und Einrichtungen herzustellen die Ihren Vorstellungen und Bedürfnissen
tischlerei-halwachs.at Tischlerei Tischler Halwachs CNC
611 Ajst Holz im ajst

... ? hochwertige Verarbeitung - Form und Funktion die Hände um Möbel Türen Fenster herzustellen die schön
ajst.at Ajst Aist Tischler Tischler Freistadt Tischlerei
612 Tischlerei Ziegerhofer | Ratten Ziegerhofer
8673
Ratten
... Die Tischlerei Ziegerhofer in Ratten produziert Möbel für Wohnzimmer Küche Diele Bad Schlafzimmer
ziegerhofer.at Ziegerhofer Tischlerei Ratten Steiermark Möbel Österreich Peter Schaufenster
613 TomScope Startseite TomScope e.U. Tischlerei
3311
Zeillern
Raumkonzept Möbeldesign; Wohlbefinden ist die Summe von Funktionalität und Design ... welche wir an Räumlichkeiten stellen auch erfüllen und Wohlbefinden einkehren kann ist bei der Konzeptionierung von Möbel
tomscope.at Tischlerei Planung Verkauf Boden Böden Türen Möbel Raumkonzept
614 GalerieRadetzky GalerieRadetzky

GalerieRadetzky: Die Adresse im Herzen Wiens fuer Wohnkultur Einrichtung und Accessoirs ... Galerie Radetzky NEUE WARE EINGELANGT! MODESCHMUCK LAMPEN UND KLEINE MÖBEL! Seilergasse ?
galerie-radetzky.at GalerieRadetzky Radetzky Antiquitaeten Antiques
615 TeakMaster Exklusive Wohn Teakholz
8073
Feldkirchen bei Graz
TeakMaster Exklusive Wohn Gartenmöbel Teakholz Teakmöbel Teakholzmöbel Wohnmöbel Gartenliegen ... Sie Ihren Wunsch vom eigenen Traumgarten mit absolut wetterfesten Möbel aus Teak Holz Old Teak Edelstahl
4seasonsoutdoor.at Teakholz Möbel Teak Teakmöbel Teakholzmöbel
616 Kunsthaus Wiesinger Kompetenz

Das Kunsthaus Wiesinger hat vier Unternehmensschwerpunkte. Der Ursprung liegt bei Möbel aus dem Zeitraum des ... Wiesinger hat vier Unternehmensschwerpunkte. Der Ursprung liegt bei Möbel aus dem Zeitraum des . bis
kunsthaus-wiesinger.at
617 Webshop der Ihnen
8083
St.Stefan Im Rosental
Dieser Webshop bietet Ihnen Küchen Kücheneinbaugeräte interessante Möbel Designstücke aus Holz und ähnlichen ... Startseite Holzweinglas Holzgolfball Golfball Holzschuhe Interessante-Möbel Lieferdaten Gästebuch
wurzwebshop.at
618 SITbOX Papphocker Papphocker

Sitbox und Artiture Innovative Mercandise Produkte Dekoartikel und moderne Möbel aus einem Materialmix von
sit-pack.at Papphocker Pappe Hocker Sitz Stuhl Sitbox Sit Box
619 Kunsthandel Pichler An Kunsthandel
1030
Wien
... Navigation Menu+ Über uns Eva Pichler Verena Pichler Neues Schmuck Kleinkunst Bilder Möbel Schmuck
kunsthandel-pichler.at Kunsthandel Pichler Kunsthandel Pichler Möbel
620 GünstigerDesign Exklusive Designer Einrichtungshaus Melior GmbH
94315
Straubing
Wir bieten neuwertige Ausstellungsstücke internationaler Designmarken stark reduziert und sofort lieferbar. Unser Sortiment umfasst luxuriöse ... Günstiger Design Möbel Navigation überspringen Marken Über uns F.A.Q. Kontakt Kundentelefon
xn--gnstigerdesign-gsb.at
621 Tischlerei Johannes Stockreiter Tischlerei

Tischlerei Johannes Stockreiter ... der Montagetermine Der Chef montiert persönlich Meine Produkte Möbel wie Wohnzimmer Schlafzimmer und Vorzimmer Wand
tischlerei-stockreiter.at Tischlerei Stockreiter Baden Möbel
622 Acrylglasmöbel Plexiglasmöbel abWERK Handel GmbH Acrylglasmöbel
1050
Wien
Individuelle stylische Möbel aus Acrylglas finden Sie bei der Firma Blickfest in Wien. Hier ... Staffelei usw. Unsere hochwertigen Acrylglas-Möbel werden unter strengen Qualitätskriterien
blickfest.at Acrylglasmöbel Plexiglasmöbel Plexiglasverarbeitung
623 Möbel Gruber Stummerberg [[METAKEYS]]

[[METADESC]]
moebel-gruber.at [[METAKEYS]]
624 Möbelwerkstätten | Wittmann | Wittmann

Die österreichische Polstermöbelmanufaktur Wittmann steht für Qualität die höchsten Ansprüchen an Komfort Langlebigkeit
wittmann.at Wittmann
625 MM3 möbel von matthias

... ) f + - officemm.at Startseite Landhausküche [
mm3.at
626 PerleKids Möbel für PERLE Textil GmbH
6020
Innsbruck

perlekids.at
627 SPÄTAUF MÖBEL


spaetauf.at
628 Möbel Agfalterer GmbH


agfalterer.at
629 EICHBERGER MÖBEL :: MÖBELHANDEL küchen
7435
Unterkohlstätten
onlinekuechen.at informiert Sie über Hersteller Händler und Trends für Ihre neue Traumküche. Holen Sie ... Mobil + officeeichberger-moebel Werbegrafik Webdesign Media.at
eichberger-moebel.at Küchen Einbauküchen Online Planung
630 Möbel Elektro Goller


elektrogoller.at
631 Elite Stilmöbel Elite
1060
Wien
Wiens größtes Spezialgeschäft für Stilmöbelzeigt auf über 600 m² eine faszinierende Schau internationaler Stilmöbel. Elite präsentiert
elite-moebel.at
632 Möbel Minihuber Wohnstudio alufensterbank

der preiswerte Systemlieferant für das FensterbankProgramm GUNTIA (R) 25 GUNTIA (R) 40 für
fensterbank-online.at Alufensterbank Alufensterbänke Alufensterbaenke Gleitendstück
633 Das Wohnen Moebel


dieerde.at
634 Tischlerei Vesselsky Möbel
3553
Schiltern

vesselsky.at
635 David Walch | Möbel


davidwalch.at
636 Das Wohnen Moebel


daswasser.at
637 Philosophie Wohnatelier lifestyle philosophie

Der Weg den das Wohnatelier seit Entstehen 1996 geht ist wahrscheinlich nicht vergleichbar
wohnatelier.at Philosophie Weg Wohnatelier Entstehen
639 Willkommen bei Möbel Watzke!


moebel-watzke.at
640 Möbel Minihuber Wohnstudio alufensterbank

der preiswerte Systemlieferant für das FensterbankProgramm GUNTIA (R) 25 GUNTIA (R) 40 für
xn--fensterbnke-s8a.at Alufensterbank Alufensterbänke Alufensterbaenke Gleitendstück
641 Palettenwerkstatt ? Paletten für


palettenatelier.at
642 Concept Studio Design

Das ?conceptstudio? vereint die Themen Design und Architektur den Vertrieb von hochwertigen Produkten im ... und Architektur den Vertrieb von hochwertigen Produkten im Bereich Möbel und Infrarotheizung sowie Planung
concept-studio.at
643 Startseite tischler

Tischlermeister Franz Mallits Tischlereibetrieb für Anfertigen von Möbelstücken aller Art Küche Wohnzimmer ... Outdoor Möbel Unikate Geschenke Pokale Hauptmenü Startseite Produkte Kontakt Home
mallits.at Tischler Meister Holz Möbel
644 Tischlerei Tschapeller Home Tischlerei

Tischlerei Tschapeller Objekttischlerei für Hotellerie und Gastronomie Einrichtung aus Holz zum Wohlfühlen für ... . AKTUELLE ARBEITEN Hotel Löwe Schruns Möbel Zimmer öffentlicher Bereich Privatvilla Lienz Möbel
tschapeller.at Tischlerei Tischler Osttirol Hotel
645 Homepage von Manfred Möbelart möbelart

Möbelart Oberhauser fertigt und bietet alles von nachhaltigen handgefertigten Möbeln bis hin zu nachhaltigen Geschenken ... Profil Wohnen Leistungen Partner Kontakt Moebel Schlafen Zirbenbetten Parkett WOHNEN - SCHLAFEN
xn--mbelart-90a.at Möbelart Oberhauser Manfred Haba Pinolino
646 Startseite hoelbling

Tischlerei für kreatives Gestalten mit Holz. Gesamter Innenausbau Innentüren und Fenster. ... tischlerei-hoelbling - Aktiv leben kreativ wohnen den Augenblick genießen! Möbel
tischlerei-hoelbling.at Hoelbling Arriach Holz Tischlerei
647 Barrierefrei Planen Bauen behindertengerech
1030
Wien
KarlHeinz Hoffmann Lebensgerechte Einrichtungsberatung für barrierefreies Planen Bauen Einrichten und Wohnen ... Solution Imagesbild wir freuen uns auf Deinen Ihren Besuch. Möbel Raumdesign Hallo und Willkommen
prohandicap.at Behindertengerecht Rollstuhlgerecht 50plus Seniorengerecht
648 Ferienwohnung Wien Zentrum: Elegante Wien

Die Wohnung in einem Biedermeierhaus ist eine Oase mitten in Wien: in ruhiger Lage in ... Küche Bad WC.... für - Personen. Altwiener Möbel und moderner Komfort verführen zum daheim bleiben
apartment-wien-zentrum.at Wien Ferienwohnung Ferienwohnung Wien Wien
649 Bretz Sofa Sessel Treiber GmbH bretz
70173
Stuttgart
Bretz Sofas und Polstermöbel Bretz Design Sofas Sessel oder Tische mit 0% finanzieren. ... Alles über Bretz Möbel Bretz FAQ bretz Alles über Bretz Polstermöbel Anfahrt Angebote Kontakt
bretz-shop.at Bretz Cultsofa Bretz Brothers Design Sofa Polstersofa Polstermöbel
650 Die Kitz Tischler Erich Prethaler e.U.
6365
Kirchberg in Tirol
Holzkunst Tischler und Handeslgewerbe Möbel
kitztischler.at
651 Katzenschreck Katzenschreck V1

... V Alle Tiervertreiber Möbel + Dekoration > - % Rabatt (Der Rabatt
katzenschreck.at
652 RudolfEisen Schmiedeeisen

... Links Startseite Über uns Kontakt Produkte Tore Zäune Geländer Fenstergitter Möbel
rudolf-eisen.at Schmiedeeisen Schmied Eisen Handgeschmiedet
653 Kostenlose Kleinanzeigen kaufen kleinanzeigen

Quoka Kleinanzeigen: kostenlos privat inserieren. Quoka.at Ihr Spezialist für kaufen und verkaufen über private Anzeigen ... Bekanntschaften Computer Fahrräder Gewerbe Business Handwerk Hausbau Haushalt Möbel Haustiere Zubehör Hifi
quoka.at Kleinanzeigen Kostenlos Kostenlose Kleinanzeigen Anzeigen
654 Www.preisagenturpfennigfuchser.at Preisvergleich
40472
Düsseldorf
Ermittlung des günstigsten Preises durch individuelle Preisverhandlung Preisermittlung und Preisrecherche für Konsumgüter und Dienstleistungen. ... Pfennigfuchser Wofür ermitteln wir den besten Preis ? Egal ob Möbel Haushaltgeräte Umzüge Dienstleistungen
preisagentur-pfennigfuchser.at Preisvergleich Preisrecherche Preisagentur Pfennigfuchser
655 Gastropolis24 Österreich Gastronomiebedarf Gastropolis24 GmbH gastronomie
1160
Wien
direkt online bestellen ? Über 55.000 zufriedene Kunden ? Über 13.000 Produkte ? Jetzt hier ... ... Sonderangebote anzeigen > Herzlich Willkommen bei Gastropolis.at - Europas großer Fachhändler
gastropolis24.at Gastronomie Gastro Gastronomiebedarf Gastrobedarf
656 VEBO | Großhandel von outdoor
1000
Ljubljana
Tische Stühle und Catering für Gastronomie. Aus Metall Holz Rattan Plastik. ... ! Schön dass Sie bei uns reinschauen. Ihre Möbel sind nur einige Klicks von Ihnen entfernt. Falls
vebo.at Outdoor Stuhle Und Tische Für Gastronomiemoebel Gastro
657 Willkommen bei der Tischlerei Tischlerei
3931
Schweiggers
Tischlerei Honeder Mannshalm 3 A3931 Schweiggers Ideen Formen geben ... individueller Wohnkonzepte und den hochwertigen Möbel- und Innenausbau im Privat- wie auch im Geschäftsbereich
tischlerei-honeder.at Tischlerei Honeder Tischlerei Andreas Honeder Andreas
658 Home: Johann Röster | Tischler
3661
Artstetten
Johann Röster RODE Röster Design Raumplanung Möbelfachhandel ... Vorzimmer Tische Stühle Elektrogeräte Möbelfachhandel RODE bietet Ihnen Möbel der Firmen Dan FM
roester-design.at Tischler Möbel Küche Küchen Raumplanung Fachhandel Möbelfachhandel Design
659 INNENARCHITEKTUR | SHOPDESIGN | Innenarchitektur

Interior Design Kantner Möbel und Innenausbau Tischlerei in Baden Pfaffstätten. Wir bieten
interiordesign.at Innenarchitektur Wohnraumgestaltung Objektgestaltung Möbel Und
660 Startseite | Babyland | Putz Möbel GmbH babyland
8230
Hartberg
Ihr Einrichtungspartner in Hartberg Oststeiermark. Erhalten Sie bei uns zahlreiche Tipps rund um Baby ... Möbel Babyland! Ihr Babyland-Team Öffnungszeiten Mo. - Fr. von bis Uhr Sa. von bis Uhr
babyland.at Babyland Baby Kind Kindererziehung Geburt Babymöbel Kindermöbel Babymoebel
661 CASA (TexBo) 2014 Impressum der Reed Messe Salzburg GmbH
5020
Salzburg
... Möbel Wohnen Sitzen Schlafen Wohnaccessoires Beleuchtung Sonnenschutz Ihr Browser unterstüzt
casa-messe.at
662 Porzellan Restaurator Restaurierung Restaurator

Porzellanrestaurator ... von Kunstgegenständen für Sammler Museen und Antiquitätenhandel wie Figuren Teller und Möbel aller Art
porzellan-restaurator.at Restaurator Porzellan Antiquität
663 Kostenlose Kleinanzeigen gratis inserieren GLOBOsapiens GmbH Kleinanzeigen
81543
München
Kostenlos inserieren im findix Kleinanzeigenmarkt. Einfach und schnell. Lokale Anzeigen in Ihrer Region. Keine Anmeldung ... Modellbau Musikinstrumente Möbel Hausrat Sammeln Software Spiele Sonstiges Sportsachen TV Video Uhren
findix.at Kleinanzeigen Inserat Inserieren Kaufen
664 Brigitte Salzburg Exclusiv Brigitte Exclusiv GmbH Deko
6851
Dornbirn
?Wunderschöne Auswahl an Dekoartikeln Möbeln exklusiver Mode ? Jetzt Schönes Praktisches ... -Figuren zaubern Jung und Alt ein Lächeln aufs Gesicht! /AT/HotSpot/compSB
brigitte-salzburg.at Deko Versand Brigitte Salzburg Schäfer Shop
665 Tischlerei Spitzer Tischlerei
6642
Stanzach
Tischlerei Spitzer ... nach etwas Besonderem? Sind Möbel von der Stange nicht Ihr Stil? Lieben Sie Holz? Dann sind Sie bei uns richtig
spitzer.co.at Tischlerei Spitzer Tischler Tischlerei Schreiner
666 Senger Tischlereiwerkstätte Senger

Individuelle Anfertigung von Toren Eingangstüren Innentüren Küchen Wohnzimmer Esszimmer ... Bäder Kinderzimmer Schlafzimmer Einrichtung Möbel Traunfeld Hochleiten Weinviertel
senger-tischlerei.at Senger Tischler Tischlerei Holz
667 Die Möbelei Aditus Bildungs- und Unternehmensconsulting GmbH VintageLook
1150
Wien
Vintage und Shabby Chic Möbeldesign ... Was ist eigentlich ?Die Möbelei?? Der Name Möbeleiverbirgt trendige individuell gestaltete Möbel in Vintage Shabby
diemoebelei.at VintageLook Möbel Landhausstil Fashion
668 5life Vollholzmöbel 5life

Möbel aus Vollholz Büffelleder Polycarbonat | Die Schnittmenge aus europäischem Bedürfnis und asiatischer ... und Newsletter Über uns IM OSTEN GEHT DIE SONNE AUF IM WESTEN AUCH. Möbel aus nachhaltigen Werkstoffen
5life.at 5life Vollholzmöbel Vollholz Büffelleder
669 ANTIKUS Antiquitäten Antikes Antiquitäten

ANTIKUS Antiquitäten Antikes und Tischlerei in Niederösterreich ... Sie stilgerecht restaurierte Möbel aus Biedermeier Gründerzeit Jugendstil sowie abgebeizte Antikmöbel. Besuchen
antikus.at Antiquitäten Antikes Shabby Chic Jugendstil Historismus Gründerzeit Biedermeier
670 Youstyle24.at kare

youstyle Heute ist ein guter Tag. ... Willkommen auf youstyle.at youstyle.at ? Möbel und Deko für Menschen mit Geschmack und Liebe zum Detail
youstyle24.at Kare Freistil Rolf Benz Bretz Piure
671 TopElektronik.at www.top-elektronik.at , ein Online-Shop der Fa. Hifi-Design Handelsunternehmen OG Hifi
1030
Wien
OnlineShop für hochwertige Hifi Lautsprecher Elektronik Multiroom CarHifi und vieles mehr ... Co. Car-HiFi Navigation TV Projektoren Leinwände DVD Blu-Ray Möbel Racks Dienstleistungen A K
top-elektronik.at Hifi Streamer Lautsprecher Standboxen
672 Ital Office > Büromöbel Italoffice Büroeinrichtungs GmbH Ital
1230
Wien
ITAL OFFICE eine dynamische Marke mit viel italienischem Flair geschaffen um ein ... Home News Service BÜromÖbel StÜhle Sitzlandschaften Outdoor MÖbel Accessoires Kontakt HOME
italoffice.at Ital Office Büromöbel Architektur Design Lifestyle Objekteinrichtung Möbel
673 Professionelle Reinigung und Reparatur POS Polsterservice GmbH POS
53547
Hausen
POS Polsterservice Die Profis für Reinigung Pflege und Reparatur von Polstermöbeln und Autositzen. ... . Unser Polsterservice repariert Ihre Möbel und reinigt professionell Ihre Stoff- oder Ledergarnitur ? in ganz
polsterservice.at POS Polsterservice Polstermöbel Autositze
674 Möbel Halter Garant
2460
Bruck an der Leitha

halter.at
676 Johannes Schroll Restaurator


schroll-restauro.at
677 Marti am Kornhaus

Kundenorientierte Gesamtbetreuung ist unser Anliegen. Kreativität Dienstleistungen und ein umfassendes ProduktPortfolio sind die Bausteine.
buerostudio-marti.at
678 KORNIK Tadeusz Wolski Tischler

Tischler Tischler Wien Tischler Wien Fünfhaus Möbelrenovierung Möbelerzeugung Möbelanfertigung
kornik.at Tischler Tischler Wien Tischler Wien Fünfhaus
679 Perfect wood möbel Tischler

PERFECT WOOD steht für klare Linien dessen zeitloser Stil sich an die italienische Formsprache
perfect-wood.at Tischler Steiermark Design Küchen
680 Marti am Kornhaus

Kundenorientierte Gesamtbetreuung ist unser Anliegen. Kreativität Dienstleistungen und ein umfassendes ProduktPortfolio sind die Bausteine.
xn--brostudio-marti-zvb.at
682 Möbel Atelier und Montagen
4060
Leonding

mihlan.at
683 Class Moebel Wien


classmoebel.at
684 Flinky.de OnlineMarktplatz neue Flinky

Beim Online Marktplatz Auktionshaus Flinky kaufen und verkaufen Sie Kleidung Elektronik Computer ... ? Heimwerker Garten ? Immobilien ? Kleidung Accessoires ? Modellbau ? Möbel Wohnen ? Musik
flinky.at Flinky Auktion OnlineShopping OnlineAuktion
685 DesignKratzbaum | DesignKatzenmöbel | Kratzbaum
30171
Hannover
Unsere DesignKatzenmöbel revolutionieren die KratzbaumBranche. Nicht umsonst wurde unsere Geschäftsidee mit dem Gründerpreis von drei|v ... wohlfühlt sind ein paar spezielle Möbel und Accessoires unabdingbar. Mit unseren durchdachten Produkten
stylecats.at Kratzbaum Design Kratzbaum Design Katzenmöbel
686 Möbel nach Maß in Möbel
9132
Gallizien
Möbel nach Maß aus Völkermarkt in Kärnten – individuell zugeschnittene Möbel Tischlerei Klagenfurt ... ist es hochwertige Moebel nach Maß anzufertigen – ebenso individuell wie Sie es sind. In Kärnten Völkermarkt
moebeltraum.at Möbel Moebel Möbel Nach Maß Schrank Tisch Sofa
687 Klinglmayr WEBAT tischlerei

Möbel Maringer ...Ihr Einrichtungshaus mit eigener Tischlerei
moebel-maringer.at Tischlerei Einrichtungshaus Maringer Vöcklamarkt Hannes Holz Cnc
688 Tischlerei Fuhrmann haka

Planung Beratung und Erzeugung hochwertiger Möbel
tischlerei-fuhrmann.at Haka Holz Küche Massiv
689 Wohnen mit Tradition Wohnen

Wohnen mit Tradition Salzburg: Möbel und Wohnaccessoires
wohnenmittradition.at Wohnen Tradition Wohnen Mit Tradition
690 Ihr fahrender Tischlermeister: Wolfgang ?kein
4050
Traun
Wolfgang Oser Ihr fahrender Tischlermeister 4050 Traun Traunerstraße 70A LinzLand ... Mobiliar Ich baue Fertigteil-Möbel für Sie zusammen Ich repariere Wasserschäden-Möbel Einbruchs
fahrender-tischlermeister.at ?kein Auftrag Zu Klein? ?individuelle Neumöbelherstellung?
691 Lagerhaus 19001950 Lagerhaus
1040
Wien
Das LAGERHAUS ist auf Möbel aus der Zeit von 1900 bis 1950 spezialisiert. Also Möbel des
lagerhaus1900-1950.at Lagerhaus 19001950 Antiquitäten Vintage Jugendstil
692 MUR Home Design

MuR Modernes und Raritäten ... Design Möbel Licht Accessoires Roland Rainer Eames Stelton Iittala Georg Jensen Carlo
mur.co.at Design Möbel Licht Accessoires
693 Mobimenti mobimenti

mobimenti
mobimenti.at Mobimenti Möbel Design Kultur
694 Anton Griessler Tischlerei GesmbH Tischlerei

Startseite Anton Griessler Tischlerei GesmbH
tischlerei-griessler.at Tischlerei Möbel Büromöbel Küchen
695 Willkommen in der Tischlerei Tischlerei
4280
Königswiesen
Tischlerei Obereder
obereder.at Tischlerei Möbel Küche Design
696 Steel Deluxe high Stahl

Steeldeluxe ist Leidenschaft für Edelstahl.
steel-deluxe.at Stahl Möbeldesign Möbel Design
697 Startseite Manfred Meixner Reparatur

... reparieren restaurieren Beschläge einstellen und austauschen montieren ... auch Kleinaufträge ... es persönlich ! Ich repariere Betten Tische Sessel Fenster Möbel usw... restauriere stelle Ihre Beschläge
reparaturtischler.at Reparatur Tischler Wien Meixner Manfred Schammerl Bankerl
698 Einrichtungshaus Zeitlhofer | A colorvita

Modernes Wohndesign erwartet Sie. Wir planen und gestalten Gesamtlösungen für kreative und färbige Lebensräume.Und ... Vitrinen Möbel Tischler Schalfzimmer RundbänkeAusziehtische Esszimmer Küchen Teppiche Keramik Leuchten
zeitlhofer.at Colorvita Wohndesign Modern Modernes
699 Home Aktuelles

Malerei Design und Oberflächengestaltung im privaten und öffentlichen Raum ... . RESTAURIERUNG . . . . VERGOLDUNG FARBGESTALTUNG MÖBEL WÄNDE WANDMALEREI REFERENZEN KONTAKT AKTUELLES PROFIL
mara-ateliers.at Aktuelles Arbeitsbereich Kontakt Freie Malerei
700 CA$H KING Einkauf + CASHKING
1100
WIEN
CASHKING.AT Ankauf + Verkauf von Waren aller Art Internet Café Geldtransfer ... HOME SHOP Mobilfunk Computer Küchengeräte Möbel/Antiquitäten TV/Hifi Fahrräder Spielkonsolen
cash-king.at CASHKING Ankauf Verkauf Waren Aller
701 Bluspa pool bluspa

Daniel Bliem von der bluspa pool relax gmbh in Mondsee hat jahrzehntelange Branchenerfahrung im ... werden Sie ebenfalls begeistern. Eine aktuelle Übersicht der Möbel-Kollektionen unserer Partner Myyour ? Sifas ? Aguti
bluespa.at Bluspa Pool Relax Daniel Bliem
702 Home staron

Staron and Radianz are acrylic solid surface and quartz surface made by Samsung ... Möbel Montagearbeiten Großprojekte Schreinerei Lackierbetrieb Metallverarbeitung Premium Virtuemart
solid-surface.at Staron Samsung Dupont Corian
703 Puppenstuben Puppenhaus Zubehör Puppenstuben

Puppenstuben Puppenhaus Miniaturen und Puppenhäuser in Oma's Puppenstube: Miniaturen und Puppenhaus Zubehör Puppenmöbel ... im Sammlermaßstab auch über Deutschlands Grenzen hinaus. Wir führen Puppenstuben-Zubehör und Puppenhaus-Möbel
puppenstuben.at Puppenstuben Puppenstube Puppenhaus Miniaturen
704 Elite Luxury We

Die ExklusivSchiene von Elite Möbel Wien Österreichs größtes Spezialgeschäft für Stilmöbel und klassisches Wohnen zeigt ... ? Kontakt English We design luxury. Die Exklusiv-Schiene von Elite Möbel Wien Außergewöhnliche Raumlösungen
elite-luxury.at
705 Restaurator Tischler und Restaurator
5431
Kuchl
Die Liebe im Detail zeichnet die Präzision älterer Möbel aus. Diese Liebe im Detail ist ... ] Die Liebe im Detail zeichnet die Präzision älterer Möbel aus. Diese Liebe im Detail ist auch die Basis
holzdesignwerkstatt.at Restaurator Tischler Moebeltischler Altmoebel
706 Leiner Einrichtungsarchitekten kuechen

Einrichtungsplanung war noch nie so einfach. Wir planen maßgeschneiderte Einrichtungslösungen komfortabel bei Ihnen Zuhause. ... . . Wenn sich in meiner Wohnung noch alte Möbel befinden muss ich diese entfernen
einrichtungsarchitekten.at Kuechen Planung Kuechenplanung Küchenplanung Küchen
707 Das neue OnlineNachrichtenmagazin Simmering SIMMERING

SIMMERING AKTUELL AUSTRIA NEWS ONLINE das unabhängige Magazin für Österreich Wald Weinviertel Niederösterreich und Burgenland
simmering-aktuell.at SIMMERING AKTUELL AUSTRIA NEWS ONLINE Das Unabhängige Magazin
708 Massmöbel aus der Steiermark Steiner GesmbH & CO KG
8322
Studenzen
Tischler Tischlerei Planung Planungsbüro Möbel Qualitätsmöbel Designmöbel SteirischenTischler Tischler Steiermark Landesauszeichnung Gütezeichen Neff Siemens Miele ... - Massmöbel aus der Steiermark Möbel speziell für Sie als Kunde angefertigt und keine Serienprodukte ? dafür
steiner.or.at
709 ARNREITER Die Tischlerei Arnreiter GmbH ARNREITER
4122
Arnreit
ARNREITER Die Tischlerei Ihr Partner für‘s Wohnen und Arbeiten. Seit über 70 Jahren ... . Firmenphilosophie Das Team Geschichte Produktion Möbel zum Wohnen Möbel zum Arbeiten Planung Zulieferer
arnreiter.at ARNREITER Die Tischlerei Ihr Partner Für‘s
710 Meingebrauchtes.at Privat kostenlos Antiquitäten

Ihr OnlineMarktplatz für Kleinanzeigen Kostenlos inserieren Für Private! ... Sachbücher Reiseliteratur Romane Schule Ausbildung VHS Kasetten Sonstiges Büro Möbel Wohnen Badezimmer
mein-gebrauchtes.at Antiquitäten Sammlungen Kleinanzeigen Bücher
711 Liniewaldviertel.at Blumberger

Menschen mit Liebe und Freude am Weg. Wir von Blumberger begleiten Sie mit Möbelarchitektur in ... Karte Kultur der Maße Kultur der Farben Galerie Postkarte Kontakt Anreise Links Möbel-Architektur
linie-waldviertel.at Blumberger Reinhart Waidhofen Waidhofen/Th. Waidhofen/Thaya
712 Startseite Echtholz Heller Tischler

ECHTHolz Heller Tischlerei und Holzhandel in Baden bei Wien ... Echtholz Heller Suche Navigation Startseite Über mich Leistungen Möbel Böden Naturformen
echtholzheller.at Tischler Tischlerei Baden Möbel
713 Treno Möbel Franz Esstische

... Schlagwortaufzählung für Suchmaschinen zum Inhalt dieser Seiten Treno Möbel Franz Möbelfranz
treno.at
714 TISCHLEREI TREML Tischlerei

Wir sind ein Familienbetrieb und unsere Tischlerei betreut Kunden in Wien dem Großraum von Wien
treml.or.at Tischlerei Treml Tischlerei Treml Günther Treml
715 Umzug service umzuege umzuege

Ihr Umzugspartner fuer Privat und Buero in Europa Schutzverpackungen und Montagen eigenes Moebellager ... umzuege umzüge möbel montagen und demontagen umzugskarton AGB WILLKOMMEN beim TRANSPORT RING
moebeltransporte.at Umzuege Service Umzüge Schutzverpackungen Und Montagen
716 Plexiglas und Acrylglas Zuschnitte Acryplex Kunststofftechnik GmbH Plexiglas
1100
Wien
Wir verarbeiten Acrylglas wie Plexiglas als Platten Rohr und Stäbe. Wir fertigen Zuschnitte aus ... und Vitrinen aus Acrylglas Möbel aus Acrylglas Buchstaben aus Acrylglas Awards und Pokale aus Acrylglas
acryplex.at Plexiglas Acrylglas Plexiglaszuschnitt Acrylglaszuschnitt
717 FortisLineHundebettenPolstermöbelHundefutterwww.fortisline.de FORTIS Tomasz Jakubow e.K. Hundebett
02977
Hoyerswerda
Bei uns finden Sie ein Angebot an Hundebedarf Deko Möbel. Ob kleine Mengen ... EINZELHEITEN Wir von fortisline bieten Ihnen Möbel Polster und Zubehör für Mensch und Tier. Egal
fortisline.at Hundebett Hundematten Hundekorbe Hundekissen
718 EXCLUSIVE COSMETIC GmbH [Nails LCN

Exclusive Cosmetic GmbH ist Ihr neuer zuverlässiger Partner mit LCNProdukten in Österreich. Unsere Produktpalette umfasst ... und Möbel erwerben. In unserer Beauty-School finden Sie Standardkurse von LCN. Wir bieten professionell
exclusive-cosmetic.at LCN BeautySchool Nail Designer Maniküre Permantent Makeup
719 Willkommen auf der Startseite bambus
4674
Altenhof am Hausruck
Alles Bambus Solid Bambus hier gibt es aus Bambus: Rohre nach Wunsch und ... Küche Bad Mode Kleidung Möbel Segiun Werkzeug Maschinen Zeige alle Produkte Produktsuche Erweiterte
alles-bambus.at Bambus Bamboo Bambootextil Bambusfrottier Bambusfrottee Bambuskleidung Bambuswel
722 Tischlerei Kreuzmayr Grieskirchen

Die Tischlerei Kreuzmayr aus Grieskirchen bietet u.a. moderne Küchenideen kombiniert mit stimmungsvollem Mobilar und Tischen
extradaheim.at
723 Enzis für alle ::


enzis.at
724 Möbel vom Tischler Tischlerei
5134
Schwand

tischlerei-wansch.at Tischlerei Wansch Schwand Küche Wohnen Türen Handwerk Braunau
725 Tischlerei Konrad Zwölfer in

Die Tischlerei Konrad Zwölfer in 1190 Wien ist Ihr Spezialist für modernen Möbelbau. Wir setzen
tischler12er.at
726 Fenster Türen


tischlerei-feuerstein.at
727 Tischlerei Schilcher Voitsberg Tischler
8570
Voitsberg

tischlerei-schilcher.at
728 Lerch Wohnen mit


wohnenmitgefuehl.at
729 Möbelmärkte.at Informationen zum

möbelmärkte.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
xn--mbelmrkte-z2a7q.at
730 Paneeleon Shop | Paneele Paneelen

Jetzt kommt Leben an die Wand...und wo Du sonst noch magst. Gestalte Dein Zuhause nach
paneleon.at Paneelen Oberflächen überdecke Alte Kacheln
731 Aufmöbler.at Informationen zum

aufmöbler.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
xn--aufmbler-q4a.at
732 Möbelkauf.at Informationen zum

möbelkauf.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
xn--mbelkauf-n4a.at
733 Rattanmöbel.at Informationen zum

rattanmöbel.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
xn--rattan-mbel-yfb.at
735 Haidvogel Möbel


moebelunddesign.at
736 Praxismöbel.at Informationen zum

praxismöbel.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
xn--praxismbel-kcb.at
737 Alexander Pichler Innenarchitektur


alexanderpichler.at
738 Atelier de Sade


atelier-de-sade.at
740 Home Mobile Bühne


eventtank.at
741 Florenz Möbel Italian
1040
Wien
We sell Classic and Modern Interiors from Italian companies whether it is furniture
florenz-moebel.at
742 Wandtattoo trifft auf echte
9020
Klagenfurt am Wörthersee
Egal ob mit Licht (kein Stromanschluss nötig) Massivholz oder individuell wir kombinieren Wandtattoos
wandkleid.at
743 ALPE :: Zimmerei alpe

Die Firma Alpe in Fohnsdorf ist in folgenden Bereichen tätig: Zimmerei Tischlerei Holzbau ... Sie uns Produkte Holzbaupreis Carports Erfolgslokale Möbel Saunen Stiegen Terrassen Wintergärten/Balkone
alpe.at Alpe Fohnsdorf Steiermark Zimmerei
744 [Gilby] [freestyle at work]

... moebelgilby
gilby.at
745 Slawitscheck Tischler und Tischlerei

Sie befinden sich im Moment auf der Startseite der Tischlerei Slawitscheck GmbH. Hier finden Sie ... Kundenbetreuung und Individualität unserer Produkte zeichnen unseren Betrieb aus. Hochwertige Möbel und Stiegen
tischlerei-slawitscheck.at Tischlerei Slawitscheck Möbel Wohideen
746 Skandinavisches Design mit Möbeln House

Skandinavisches Lebensgefühl mit den Wohnwelten und Accessoires von Petit Pont. Artikel von IB Laursen und ... und Adventszeit Geschenke für die Großen Geschenke für die Kleinen Wohnen Leben Wohnzimmer Möbel
petitpont.at House Doctor Skagerak Virginia Casa
747 Wohnplattform Linz Idee dana

Experten Netzwerk zum Thema Wohnen und Innenarchitektur ... Innenarchitektur INNENARCHITEKTUR MANUFAKTUR SEIT . EXCLUSIVE MARKEN MÖBEL KONZEPTE. Ihr Ansprechpartner
wohnplattform-linz.at Dana Türen Dana Hafro Böden
748 HOLZIDEE Tischlerei Gruber österreich
2301
GROSS-ENZERSDORF
HolzIdee Tischlerei Gruber Ihre Idee ist unser Job
holzidee.at österreich österreich Tischler Tischlerei
749 Petres|design Home Petres

... Navigation aufklappen/zuklappen Home Möbel Tisch - K Big Henry Petres Monrou II Obstschale Small
petres.at Petres Petres Petresdesign Petresdesign
750 Holztechnik Hofer montage

Montagetischler Holztechnik Stubai Stubaital Innsbruck Land Möbel
holztechnik-hofer.at Montage Möbelmontage Moebelmontage Montagetischler
751 MontagetischlerÖller: Startseite Markus

Ich übernehme die Lieferung und Montage von Möbel. Meine auftraggeber sind meistens Tischlereien.
montagetischler.co.at Markus Öller Montagetischler Montage Möbelmontage
752 Möbelmanufaktur und Möbelkultur Keller Züberwangen AG möbelkultur
9523
Züberwangen
Keller Züberwangen ist die Möbelmanufaktur in der Ostschweiz. Besuchen Sie unsere Ausstellung in Züberwangen und ... Küche Bäder Möbel Innenausbau Manufaktur Unternehmen Dienstleistung Team Jobs Mehrwert-Service
officesysteme.at Möbelkultur Moebelkultur Möbelmanufaktur Moebelmanufaktur
753 WOHNEN Mayrhofer

Mayrhofer Der Einrichter
mayrhofer-dereinrichter.at Mayrhofer Einrichter Möbel Tischlerei
754 Möha Möha

Möha
moeha.at Möha Küche Möbel Kremsmünster Hackl
755 Mike Brötz mike
6060
Hall in Tirol

broetz.at Mike Brötz Architekt Design Möbel
756 Tischlerei Seidl Zirbenbetten Möbel

Bau und Möbeltischlerei mit über 20 Jahren Erfahrung. Vom Zirbenbett über Tische Stühle
tischlerei-seidl.at Möbel Aus Holz Tische Stühle
757 Tischlerei Litschauer tischler


tischlerei-litschauer.at Tischler Tischlerei Litschauer Möbel
758 Einrichtungshaus Schöffmann Möbel

Einrichtungshaus Schöffmann Judenburg Steiermark
schoeffmann-moebel.at Möbel Einrichtung Judenburg Küche Polstermöbel
759 Sitz und Office Studio Office
2460
Bruck an der Leitha
Sitz und Officestudio bietet Ihnen hochwertige Büromöbel. Vom Sessel bis zum Tisch bieten wir
sitz-officestudio.at Office Sessel Büro Möbel
760 YANI.at Inneneinrichtung und Möbel

Einrichtungsgegenstände aus Indonesien Thailand Indien China Antik und Kolonialmöbel
yani.at Möbel Teak Bambus Asien
761 Kunsttischlerei Kubelik "MöbelRestaurieru


kunsttischlerei-kubelik.at "MöbelRestaurierungen 'Kunsttischlerei' 'Metallwerkstatt' Kubelik"
762 Willkommen! Kleemayr Zäune & Tore GmbH Bambusmöbel
4844
Regau
Kleemayr Bambusmöbelshop Regau
kleemayr-moebel.at Bambusmöbel Teakmöbel Philippinische Möbel Indonesische
763 Tischlerei Orthof KEG Tischler
8263
Großwilfersdorf
Tischlerei Orthof KEG Großwilfersdorf
tischlerei-orthof.at Tischler Holz Tischlerei Orthof
764 ThomasShop | der FanShop Thomas

Thomas und seine Freunde riesige Auswahl rund um Thomas der kleinen Lokmotive Eisenbahnen ... -- DVD - Einzelfolgen -- DVD - Specials -- DVD - Boxen - Hörspiele - Mega Bloks - Möbel und Lampen
thomasshop.at Thomas Und Seine Freunde Lokomotive Eisenbahn
765 Herzlich Willkommen bei der Tischler

Tischlerei Taibel Ihr Wohn + Bettenstudio! ... Tischler Tischlerei Möbel Möbeltischler Möbeltischlerei Taibel Tulln Hochäckerstraße Eßzimmer
taibel.at Tischler Tischlerei Möbel Möbeltischler Möbeltischlerei Taibel Tulln Hochäckerst
766 Volksmoebel.at Informationen zum

volksmoebel.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
volksmoebel.at
767 ARC Circle exklusive


arc-circle.at
768 Dekoexperte.at Informationen zum

dekoexperte.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
deko-experte.at
769 Hoeffner.at Informationen zum

hoeffner.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
hoeffner.at
770 Perfectbaby.at Informationen zum

perfectbaby.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
perfectbaby.at
771 Tischwelt24.at Informationen zum

tischwelt24.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... tischwelt.at Weitere Links Domain erwerben Sie können die Domain tischwelt.at kaufen
tischwelt24.at
772 Umzug service umzuege umzuege

Ihr Umzugspartner fuer Privat und Buero in Europa Schutzverpackungen und Montagen eigenes Moebellager ... umzuege umzüge möbel montagen und demontagen umzugskarton AGB WILLKOMMEN beim TRANSPORT RING
moebeltransport.at Umzuege Service Umzüge Schutzverpackungen Und Montagen
773 Tischlerei Kigerl tischlerei

Tischlerei Kigerl Wir machen mehr aus Holz ... Sorry but Javascript is not enabled in your browser! Home Über uns Leistungsprofil Möbel Bau Top
kigerl.at Tischlerei Günter Kigerl Gmbh Guenther
774 Umzug service umzuege umzuege

Ihr Umzugspartner fuer Privat und Buero in Europa Schutzverpackungen und Montagen eigenes Moebellager ... umzuege umzüge möbel montagen und demontagen umzugskarton AGB WILLKOMMEN beim TRANSPORT RING
umzugservice.at Umzuege Service Umzüge Schutzverpackungen Und Montagen
775 SALE | Einzel und designer

Einzel und Ausstellungsstücke zu günstigen Preisen bei Hoflehner Interiors Linz! ... Sitzhöhe cm Ligne Roset statt EUR - EUR - More Möbel Bild vergrößern Freunde zeigen Essbank
sale.hoflehnerinteriors.at Designer Möbel Abverkauf Ausstellungsstück Ausstellungsstücke Sale Billig Billig
776 Gartenmöbel Gartentisch ABI Teak Concept Handels GmbH gartenmöbel
3400
Klosterneuburg
Wenn Sie Teak Gartenmöbel denken Sie sind richtig bei uns. Wir bieten Gartenbänke ... können Sie sich bei Ihrem Gartensessel dem Gartenstuhl oder Gartentisch für Rattanmöbel entscheiden. Teak Möbel sorgen ebenso wie Rattan
gartenmoebel-shop24.at Gartenmöbel Gartencenter Balkonmöbel Sonnenschirm
777 Kwfmöbeldesign Herzlich Willkommen


xn--grnkunst-75a.at
778 Leder Fein Lederreinigung Leder
93133
Burglengenfeld
LederFein die Lederpflege und Lederreinigung statt teurer chemischer Reinigung. Leder kann per Hand oder ... -Pflege-Fibel Leder-Möbel Leder-Waschanleitung Lederpflege-Produkte Leder - Selbstschneidern Bestellen
leder-fein.at Leder Fein Lederfein LederPflegeFibel
779 KNAUS der Wohlfühltischler Knaus

Ihr Wohlfühltischler KNAUS urSteirisch : Wohnraum | Garderobe Vorraum | Küche ... Objekteinrichtung Sanierung Fenster Möbel Buseinrichtung Sonstige Promotion Kurioses Zirbenbett urSteirisch Kontakt
knaus.at Knaus Feldbach Steiermark
780 Antiquitäten Markus Höglinger Ankauf
4810
Gmunden
Ankauf und Verkauf Antiquitäten und Kunst und Altwaren Räumung Schätzung. Ankauf und Verkauf ... Volkskunst habe ich Gemälde aus unterschiedlichen Zeitepochen im Angebot. Möbel von Barock Empire
antiquitaeten-ankauf.at Ankauf Verkauf Alte Möbel Alte
781 Tischlerei Kirchmair Inzing Tischlerei

... Tischlerei Kirchmair GmbH Niveau statt Norm Hotelausstatter Küchen Wohnzimmer ... Team Jobs Die Gestaltung individueller Möbel ist unsere Passion und das seit über neunzig Jahren
tischlereikirchmair.at Tischlerei Kirchmair Inzing Tirol Coriantischlerei
782 Wmparkett Startseite wm

Parketten Tischlerei und Verlegung ... fenster josko moebel möbel küchen innentüren wohnräume kreatives wohnen wohnen schlafzimmer
wmparkett.at Wm Wmparkett Parkett Parkettverlegung
783 Kuecheneinrichtungen.at Informationen zum

kuecheneinrichtungen.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
kuecheneinrichtungen.at
786 Designermoebel.at Informationen zum

designermoebel.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
designer-moebel.at
787 Tischlerei Johann Bauhofer
6233
Kramsach

tischler-bauhofer.at
788 Rattanmoebel.at Informationen zum

rattanmoebel.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
rattan-moebel.at
789 Designzentrum.at Informationen zum

designzentrum.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
designzentrum.at
790 Sbmoebel.at Informationen zum

sbmoebel.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
sb-moebel.at
791 Modernisieren.at Informationen zum

modernisieren.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
modernisieren.at
792 Antikemöbel.at Informationen zum

antikemöbel.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
xn--antike-mbel-yfb.at
793 Vollholzmöbel.at Informationen zum

vollholzmöbel.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
xn--vollholzmbel-djb.at
794 Elitemöbel.at Informationen zum

elitemöbel.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
xn--elite-mbel-kcb.at
795 Athome.at Informationen zum

athome.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
athome.at
796 Babymoebel.at Informationen zum

babymoebel.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis
baby-moebel.at
797 Chiara Ambra | Beauty Chiara

Chiara Ambra Beauty Wellness Fashion Das Original Chiara Ambra STEMCELL
silver-star.at Chiara Ambra Beauty Wellness Fashion
798 Bauen Wohnen Einrichten | Bauen
34599
Neuental
Der Webkatalog BauenWohnenEinrichten.de bietet seinen Besuchern viele Webseiten die sich mit den Themen Hauskauf ... ... Einrichtung Möbel Einrichten mit Stil und Ambiente ist gar nicht so leicht! Designer Möbel oder vielleicht
bauen-wohnen-einrichten.at Bauen Wohnen Einrichten Bauen Hausbau
799 Textilhanddruck Barbara Kossär Textildruck

TextilDruck für Innen und Außen
textilhanddruck.at Textildruck Sonnenschirme Schirme Möbel Decken Polster Pölster

Möbel Genève Nous DéménagementGenève Österreich Möbel - Die Öffnungszeiten können zu Feiertagen Karneval, Valentinstag, Ostern (Karfreitag Ostersonntag Ostermontag), Tag der Arbeit und Himmelfahrt abweichen. Statistiken: 4 StadtBranche Punkte für "Möbel " - In die Bewertung wird die Anzahl der Besucher und Erfahrungsberichte dieser Themenseite mit einbezogen. Kontakt + Möbel › Genève Nous Déménagement Österreich - Möbel Bewertungen Öffnungszeiten und Erfahrungen. Stand:

Neuer Eintrag 

Die Begriffe Möbel und Mobiliar bezeichnen Einrichtungsgegenstände vorwiegend in Innenräumen wie Wohnungen, Geschäften, Büroräumen oder anderen Nutzungseinheiten, sowie im Außenbereich . Der Begriff steht somit im Gegensatz zu unbeweglichen Dingen , die mit dem Boden oder baulichen Anlagen fest verbunden bzw. verwachsen sind. Möbel Öffnungszeit und Erfahrungen

△ nach oben kostenfreier Eintrag Datenschutz