Möbel › Genève Nous Déménagement Österreich

Möbel


Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 Flussdorf Möbel GmbH Tischler

3385
Prinzersdorf
TISCHE, STÜHLE, BÄNKE & REGALE aus österreichischem Holz von Tischler Hand regional gefertigt. In unserer hauseigenen Tischlerei schreinern wir mit handwerklicher Sorgfalt..
flussdorf.at Flussdorf Tische Bänke Regale Stühle Massivholz Holz Qualität Blog Beratung Lieferung Massivholzmöbeln Uhr Sehr Esszimmer
2 UMZUG WIEN - ÖSTERREICH Umzug

1140
Wien
Umzug in Wien und Umgebung Wir sind um einen Umzug Wien oder Österreich für Sie der richtige Ansprechpartner! Entsorgen kann eine..
topeasy.at/ Wien Umzug Angebot Kunden Besichtigung Umgebung Topeasyat Arbeiten Möbel Umzugshelfer Kostenlose Unser Know Termine Festpreis
3 Wiener Räumung Räumung

1140
Wien
Entrümpelung und Räumung in Wien mit Wiener Räumung Entrümpelung Wien: Wir transportieren Ihr Sperrmüll auf die Deponie Es ist möglich; Sie können..
wiener-raeumung.at/ Wien Entrümpelung Räumung Möbel Gratis Wiener Entrümpelungsfirma Einrichtungen Wohnungsräumung Sperrmüllabholung Haushaltsauflösung Wohnung Räumungen Hausauflösung Preisen
4 Gaisbauer Möbelwerkstätten GmbH Möbelhersteller

4082
Aschach
Gaisbauer steht für Edles aus Holz. Seit 1888, in der vierten Generation, werden in der Manufaktur in Aschach an der..
gaisbauer.co.at/ Gaisbauer Möbel Armchair Nuss Design Biedermeier Qualität Buffet Kommode Sessel Table Back Tisch Sidechair Club
5 Gaisbauer Möbelwerkstätten GmbH Möbelhersteller

4082
Aschach
Gaisbauer steht für Edles aus Holz. Seit 1888, in der vierten Generation, werden in der Manufaktur in Aschach an der..
gaisbauer.co.at/ Gaisbauer Möbel Armchair Nuss Design Biedermeier Qualität Buffet Kommode Sessel Table Back Tisch Sidechair Club
6 ADH Mölltal Möbel GmbH

9843
Großkirchheim
EXKLUSIVE DESIGNMÖBEL NACH TRADITIONELLER HANDWERKSKUNST..
moelltal-moebel.at Möbel Mölltal Gmb Tischlerei Holz Design Award Shop Wallner Sofas Baumes Lärchenholz Entstehung Verwendung Handwerkskunst
7 Antik Ankauf Antiquitäten

1180
Wien
Sie sind an einem Ankauf Antiquitäten interessiert? Dann sind Sie bei uns genau richtig. Antik Ankauf - Wien bietet Ihnen..
antikankauf-wien.at/ Ankauf Wien Antiquitäten Helvetica Angebot Verlassenschaften Wertschätzung Ort Antike Möbel Unsere Apx Besichtigung Open Sans
8 Räumung in Wien NÖ Antiquitäten

1040
Wien
Sofortiger Barankauf möglich Gerne helfen wir Ihnen beim Verkauf Ihrer gesamten Verlassenschaft Ankauf Wien oder von Antiquitäten daraus. Wir kaufen international..
antik-experte.at Roboto Antiquitäten Condensed Ankauf Wien Light Verlassenschaften Gegenstände Möbel Ihr Regular Antiquitätenhändler Verkauf Barankauf Kunst
9 Umzugsunternehmen Umzug +

8952
Schlieren
Wir als Umzugsfirma in Zürich bieten eine umfangreiche Leistungsangebot für Privatumzüge und Firmenumzüge an, denn sie sind ein fester Bestandteil..
umzugsservice-zh.ch Zürich Umzug Umzugsservice Ich Umzugsfirma Service Gmb Möbel Team Offerte Dank Ihren Mitarbeiter Schäden Preis
10 Umzugsunternehmen Umzugsfirma

8952
Schlieren
Umzugsservice Zürich GmbH – Ihre Umzugsfirma direkt aus Zürich Schlieren. Umzüge und dazugehörige Services von höchster Qualität. Wir als Umzugsfirma in..
umzugsservice-zh.ch/ Zürich Umzugsservice Umzug Ich Umzugsfirma Service Gmb Möbel Team Offerte Dank Mitarbeiter Schäden Ihren Reinigung
11 Babyzimmer einrichten mit den Inneneinrichtung

1080
Wien
Die Raumelfen haben sich auf die Planung und Einrichtung von Babyzimmern, Kinderzimmern und Jugendzimmern spezialisiert. Die beiden Schwestern überzeugen durch..
dieraumelfen.at/leistungen-kinderzimmer-einrichten-wien/ Kinderzimmer Raumelfen Planung Kindermöbel Leistungen Ihr Möbel Besprechung Asoral Kinderzimmers Fragen Informationen Accessoires Showroom Ja
12 Zirbenbetten Möbel

9400
Wolfsberg
Zirbenbetten aus rein luftgetrockneten Zirbenholz aus den österreichischen Alpen.Das Zirbenbett wir schwebend und metallfrei gefertigt...
das-zirbenbett.kaufen Mw Zirbenbetten Kategorie Betten Object Einkaufswert Bettwaren Schlafsysteme Zirbenmöbel Kontakt Checkout Wolfsberg Event Nützliches Gmb
13 Umzug Umzug Transport

1100
Wien
Wir sind ein erfahrenes Umzugsunternehmen, das sich um verschiedene Arten von Umzügen kümmert. Aus diesem Grund helfen wir Ihnen gerne..
bluemoving.at/ Wien Umzug Bluemoving Möbel Möbeltransport Ihren Umzugsunternehmen Transport Umzüge Blue Kunden Möbellift Organisation Unternehmen Ihr
14 Antiquitäten und Verlassenschaften Wien Antiquitäten Antik

1040
Wien
Hochqualitative Antiquitäten Ankauf in Wien oder österreichweit. Verlassenschaften Ankauf von Experte leicht gemacht. Kostenlose Wertschätzung und Gratis Räumung.Sie möchten Ihre..
antiquitaeten-wien.com Wien Antiquitäten Verlassenschaften Altwaren Ankauf Verkauf Antike Gegenstände Preis Sachen Abholung Gemälde Besichtigungstermin Barankauf Möbel Wirversprechen Abendstunden
15 Loogo Umzüge Österreich Umzüge

5400
Hallein
Mit LOOGO sparen Sie Zeit und Nerven. Überlassen Sie Ihren Umzug den Profis von LOOGO! Profitieren Sie von unserer Organisation und..
loogo.at Umzug Möbel Kartons Möbelküche * + Umzugsunternehmen Privatumzug Angebot Firmenumzug Verpackungsmaterial * Umzüge Loogo Kartons * Lkw * Internationaler Neumöbel Abholung Karton Rechner Demokratischevolksrepublikkorearepublikkroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmauretanienmauritiusmazedonienmexikomikronesienmoldawienmonacomongoleimontenegromosambikmyanmarnamibianaurunepalneuseelandnicaraguaniederlandenigernigerianiuenorwegenösterreichomanosttimorpakistanpalästinensischeautonomiegebie
16 Biotop Schuhe und Möbel Handel Textil

3242
Texing
Die Wollwerkstatt in Texing vertreibt wertvolle und hochwertige Produkte aus Schafwolle. Es handelt sich um Produkte wie Wolldecken, Gymnastikmatten, diverse..
wollwerkstatt.at Filzwolle Merino Meditationskissen Bettdecken Maß Hochwertige Hautpflege Unterbetten Filzpatschen Handschuhe Natur Produkte Kinderbettdecke Faltmatte Plaids Wollmütze
17 Entrümpelung Wien Umzug

1140
Wien
Entrümpelung Wien Entrümpelung Wien ; bedeutet so viel wie die Entsorgung von Gerümpel. Die Frage ist jedoch wieviel kostet das Entrümpeln von..
wiener-raeumung.at Wien Entrümpelung Räumung Gratis Wohnungsräumung Möbel Räumungen Haushaltsauflösung Entsorgen Sperrmüllabholung Kellerräumung Einrichtungen Wiener Hausräumung Entsorgung Altholz
18 Entrümpelung Wien Umzug

1140
Wien
Entrümpelung Wien Entrümpelung Wien ; bedeutet so viel wie die Entsorgung von Gerümpel. Die Frage ist jedoch wieviel kostet das Entrümpeln von..
wiener-raeumung.at Wien Entrümpelung Räumung Gratis Wohnungsräumung Möbel Räumungen Entsorgen Haushaltsauflösung Sperrmüllabholung Kellerräumung Wiener Entsorgung Hausräumung Einrichtungen Entrümpelungen
19 Gastronomiefachhandel Grosshandel Gastronomiebedarf

33178
Borchen
ask gastro UG liefert Gastronomiebedarf und Großküchentechnik namhafter Hersteller deutschland- und europaweit an Hotels und gastronomische Einrichtungen aller Grössen, sowie..
askgastro.shop Gastronomie Gastro Edelstahlmöbel Buffet Mein Kühltechnik Möbel Hygiene Gastronomiebedarf Ersatzteile Konto Neumärker Großküche Einrichtung Backtechnik Cool Line Air Wolf Kochen Gefrier Kunden Melamin Servierartikel
20 Möbel Handl GmbH Einrichtung

3860
Heidenreichstein
moebelhandl.at
21 Desigano.com Möbel

5203
Köstendorf
Desigano.com steht für qualitativ hochwertige Designer Möbel und Leuchten aus Europa. Finden Sie im Onlineshop einzigartige Sofas, Stühle und Tische..
desigano.com/ Leuchten Barhocker Sessel Etagenbetten Tische Gartenmöbel Möbel Beistelltische Stühle Stehtische Teppiche Wandklappbetten Designer Sofa Hängeleuchten Blumentöpfe Bartheke Kissen
22 Die schnelle Teppichreinigung bei Teppichreinigung

1080
Wien
Sie haben Teppiche in Ihrem Eingangsbereich liegen? Dann sollten Sie sich um eine professionelle Teppichreinigung umsehen. Denn wenn Ihre Teppiche..
teppichreinigungen-wien.at/ Teppich Teppichreinigung Teppiche Polstermöbelreinigung Wien Professionelle Reinigung Qualität Orientteppiche Wert Teppichreinigungen Wienat Möbel Partners Termin Jahre
23 Umzugsservice in Salzburg von Umzug

4180
Zwettl a.d.Rodl
Österreichs erster Umzugsvergleich mit Sofortergebnis! Egal ob private Übersiedlung, Möbeltransport, oder Firmenumzug wir machen es ihnen leicht. Finden und Vergleichen Sie noch..
flottumzug.at Umzug Salzburg Entrümpelung Linz Umzugsservice Umzugsfirma Möbel Demontage Internationaler Umzugslift Gern Services Montage Umziehen Doch Komplettangebot Sodass Preisen Räumungen Unternehmen * Kostenlose
24 Hane Möbel Möbel

1100
Wien
Neueste modernste Möbel zum Tiefpreis mit prompter Lieferung inklusive Montage. Hoch qualitative Möbelstücke mit toller Beratung nur bei Hane Möbel...
hane.at Esszimmer Schlafzimmer Moderne Aktion Sitzgruppen Ecksitzgruppen Möbel Avantgarde Babyzimmer Hane Polstermöbel Betten Jugendzimmer Italienische Dekoration Matratzen Sitzgarnituren Federkernmatratzen
25 Hane Möbel Möbel

1100
Wien
Neueste, modernste Möbel zum Tiefpreis mit prompter Lieferung inklusive Montage. Hoch qualitative Möbelstücke mit toller Beratung nur bei Hane..
hane.at Schlafzimmer Esszimmer Sitzgruppen Aktion Ecksitzgruppen Moderne Möbel Babyzimmer Avantgarde Hane Betten Polstermöbel Jugendzimmer Italienische Wohnwände Sitzgarnituren Server
26 Zirbenbetten Einrichtung Möbel

9400
Wolfsberg
Natur Zirbenbetten von Schröcker aus rein luftgetrockneten Zirbenholz von den Nockbergen...
das-zirbenbett.com Zirbenbetten Zirbenbett Natur Nachtkästchen Schröcker Schlafen Zirbenmöbel Tischlerei Planung News Bettwaren Zirbennachtkästchen Schlafsysteme Zirbenholzbett Wirkung Weißenbachstraße Zirbenpolster Schrnke
27 Möbel aus Beton Betonmöbel

Betonmöbel individuell von Hand gefertigt. Jedes Möbel ist ein Einzelstück. ... möbel aus beton Home Möbel Kamin Holz Beton Möbel Sideboard Waschtisch Architektur Sichtbetonstiege
xn--beton-mbel-kcb.at Betonmöbel Beton Möbel Sichtbeton Möbel
28 Möbel Pillichshammer Herzlich Pillichshammer Möbel GmbH & Co. KG Möbel
4870
Vöcklamarkt
Möbel Pillichshammer Möbel Tischlerei Planung Möbelbau Vöcklamarkt ... . Pillichshammer Möbel GmbH Co. KG Gries Vöcklamarkt Diese -Adresse ist vor Spambots geschützt
moebel-pillichshammer.at Möbel Pillichshammer Möbel Tischlerei Planung
29 Antike Möbel Shop Antike
6252
Breitenbach am Inn Austria
Antike Moebel Shop Matthias Seidner ... aktivieren um alle Funktionen in diesem Shop nutzen zu können. Antike Moebel Shop - Matthias Seidner
antike-moebel-shop.at Antike Moebel Shop
30 Antik Möbel Antike Antik
4600
Wels
Antik möbel online. Alte Bauernmöbel. Landhausmöbel Weichholzmöbel Vintage Möbel. Antik Möbel aus verschiedenen ... Möbel Vintage Möbel Antik Möbel Antike Tische - Antik Möbel Antike Schränke - Antik Möbel Antike
antik-zone.at Antik Möbel Bauernmöbel Wiechholzmöbel
31 Home Erotische Möbel erotische

Individuell gefertigte erotische Möbel oder auch SM Möbel genannt für Privat und Business aus Österreich. ... Erotische Möbel Wir fertigen Träume und Fantasien Erotische Möbel Wir fertigen Träume und Fantasien
erotische-moebel.at Erotische Möbel Sm Möbel Günter Grasser
32 OK Möbel Home Schreiner
5340
Sankt Gilgen
OK Möbel Sankt Gilgen ... Home Leistungen Referenzen Aktuelles Unser Betrieb Kontakt Anfahrt Möbel nach Mass Möbel
ok-moebel.at Schreiner Schreinerei Tischler Möbel
33 Antik möbel antique furniture hlb.project

antik möbel sekretär antique furniture secretaire ... ANTIK MÖBEL MAP ANTIK MÖBEL GALERIE GEBRAUCHT MÖBEL GEBRAUCHT MÖBEL GALERIE ACCESSOIRES ACCESSOIRES
antik-ambiente.at Hlb.project Moebel Secretaire Sekretär
34 Möbel Innsbruck Tischlerei Möbel

Möbel Innsbruck ist das Spezialgebiet der Tischlerei Jenewein. Anfertigungen nach Maß und nach Ihren Vorstellungen. ... und gerichtl. beeid. Sachverständiger für Möbeltischlerei Möbel Innsbruck by www.tischlerei-jenewein
tischlerei-jenewein.at Möbel Innsbruck
35 ELLENSOHN. Handgemachte Möbel aus Möbel

Ellensohn Möbel Homepage handgemachte Massivholzmöbel Vollholz Massivholz Bauart und Design ... ELLENSOHN. Handgemachte Möbel aus Holz. Ein Baum wächst mehr als hundert Jahre bis das Holz
ellensohn.or.at Möbel Massivholz Vollholz Handwerk Bauart
36 Das Marken Möbel Outlet Kasper-Wohndesign-Outlet GmbH Möbel
76829
Landau
Das online Marken Möbel Outlet in Österreich | z.B. Rolf Benz KARE Design ... aktivieren um alle Funktionen in diesem Shop nutzen zu können. moebel-style Mein Warenkorb Zur Kasse
moebel-style.at Möbel Outlet Rolf Benz Ewald Schillig
37 Möbel See Möbel

Möbel See ihr Innenarchitekt in Haid. Möbel See Einfach schön leben ... Möbel See NUR FÜR KURZE ZEIT Besuchen Sie unseren Schauraum. NEU IM SORTIMENT Besuchen Sie unseren
moebelsee.at Möbel See Stilmöbel Inneneinrichtung Innenarchitekt
38 Die Möbel Sensation! Jetzt möbel

MöbelSensation.de Deutschlands großer Möbel OnlineShop. Bekannte Marken größte Vielfalt günstige Preise und ... Möbel Home Kontakt Beratung Warenkorb Ihre Vorteile Persönliche Beratung Best-Preis
stilbetten.at Möbel Günstig Onlineshop Bestellen
39 Möbel und Designermöbel günstig Möbel

llll? Hochwertige Möbel und Designermöbel im Shop günstig online kaufen. Kauf auf Rechnung ? Versandkostenfrei ... Garderoben Sets Tische Home Office Möbel Schlafen Kind Jugend Büro Gewerbe Stühle Sessel Tische
jenverso.at Möbel Shop
40 Günstig Möbel kaufen Schreibbüro und Lektorat OG Möbel
6380
St. Johann in Tirol
Dieser Shop bietet erstklassige Möbel zu Top Konditionen. Regelmäßiges Vorbeischauen lohnt sich. ... - Jugendzimmer Küche Schlafzimmer Wohnzimmer Lampen und Leuchten Programmpartner Kontakt günstig Möbel
guenstig-moebel-kaufen.at Möbel Möbelhaus Einrichtung Küche
41 Suppan Suppan suppan
1050
Wien
Einrichtungshaus für Indische und Chinesische Möbel massiven Esstischen und Landhausmöbel in Wien Österreich. ... Kommoden Sideboards TV-Möbel Nachtkästchen Schränke Regale Schränke Regale Truhen Licht Orientalische
suppanundsuppan.at Suppan Indische Möbel China Möbel
42 Fenster Türen Kaun GmbH Fenster
4490
St. Florian
TischlerQualität bei Fenster Türen Möbel MöbelRestauration und Antiquitäten von der Tischlerei Kaun ... Kastenstockfenstersanierung Wohnen Schlafen Kochen Baden Arbeiten Kastenfenster Restauration Türen Möbel/Fußböden
kaun.at Fenster Türen Möbel Antiquitäten
43 Objekteinrichtungen Stockbetten objekteinrichtung

Stranig Extrem starke Möbel Objekteinrichtungen Stockbetten Ihr Spezialist für stark ... Startseite Extrem starke Möbel Referenzen Unternehmen Aktuelles Objektinrichtungen
stranig.at Objekteinrichtungen Stockbetten Stranig Möbel
44 Möbel und Designermöbel online möbel

Der MöbelOnlineShop für Designermöbel. Große Auswahl tolles Design für alle Wohnbereiche bei avandeo: Hochwertige ... Passwort zugeschickt. Mein Warenkorb ? Möbel SOFAS SCHLAFSOFAS BETTEN ESSTISCHE COUCHTISCHE
avandeo.at Möbel Onlineshop Günstig Bestellen Online Kaufen Möbelshop Möbelhaus
45 URBA Ambiente | Willkommen URBA Ambiente GmbH Wohnwände
9020
Klagenfurt am Wörthersee
Wohnwände Wohnwand Möbel für Wohnzimmer Wohnzimmer Möbel Wohnzimmerschrank Wohnzimmer Set ... Lattenrost Sonstiges Attraktive Möbel zu günstigen Preisen! Wie wir das schaffen? Lesen Sie über uns - Link
topmoebel-shop.at Wohnwände Wohnwand Möbel Für Wohnzimmer
46 Home Möbel aus Möbel

Möbel aus Holz Marin Glawitsch Holz Kunst Handwerk ... Möbel aus Holz Martin Glawitsch Home Möbel Werkstatt Über mich Kontakt Links HOLZ + DESIGN
moebelausholz.at Möbel Aus Holz Marin Glawitsch Holz Kunst Handwerk
47 Royal Möbel royal

Möbel möbel moebel österreich möbel österreich
royalmoebel.at Royal Möbel Royal Navrkal Möbelstudio
48 1a Direktimport Möbel mexico

Mexico Möbel im Hacienda Stil und Vieles mehr für Liebhaber südlicher Wohnkultur. Direktimport aus Mexiko. ... Möbel Gartenartikel und Accessoires mit südlichem Flair. Unglaublich preiswert durch Direktimport
1a-direktimport.at Mexico Möbel Mexikanische Möbel Mexico
49 VCM24 | VCM Möbel vcm24

Bei VCM24 dem Möbel Onlineshop gibt es moderne Esszimmerstühle und Esszimmertische. VCM Möbel haben hohe ... ) Sie haben noch keine Artikel in Ihrem Warenkorb Sie sind hier Startseite Hifi- TV-Möbel CD-DVD-Möbel Hifi-Möbel TV-Möbel TV
vcm24.at Vcm24 Vcm Möbel Tv Moebel
50 LAGERHAUS 1900 1950 Möbel ArtDeco

Handel mit Möbel Kunst und Antiquitäten ... Möbel von - Lagerhaus Konkret Gemeinsam Planen Ona B. Aktuell Special Offer
art-deco.at ArtDeco Artdeco Art Nouveau Kunsthandel
51 TheObjects Möbel und Möbel

Hier entsteht ein Online Shop für Möbel und Wohnaccessoires. Wohnideen für anspruchsvolle Menschen ... TheObjects - Möbel und Wohnaccessoires Hier entsteht eine Einrichtungswelt für anspruchsvolle
theobjects.at Möbel Accessoires Wohnaccesoires Möbel Online
52 Möbel Interieur aus Salzburg

Living Lounge Möbel Interieur aus Salzburg ? hier erfahren Sie mehr über unsere Produkte ... Living Lounge Living Lounge Möbel Interieur Innsbrucker Bundesstraße a .Stock Salzburg
livinglounge.at Salzburg Möbel Salzburg Wohnzimmer Salzburg Interieur
53 Exklusive TV HIFIMöbel HifiMöbel

Seit 1999 die Adresse für HifiMöbel TVMöbel TVRack TVPhonomöbel LCDStänder ... Warenkorb Artikel Warenwert ? Warenkorb anzeigen HiFi-Möbel TV-Möbel TV
hifi-moebel.at HifiMöbel TVMöbel TVRack TVPhonomöbel
54 Homepage Möbel Laimer Möbel

Möbel Laimer bietet Beratung und Konzeption für anspruchsvolle Wohnungsideen Design und Handwerk. ... Telefon Map Unsere Leistungen Planung Beratung Möbel Tischlerei Produkte Übersicht Küche
einrichtungshaus-laimer.at Möbel Laimer Möbel Laimer Palting
55 Möbel Online Möbel

Möbel online kaufen
xn--onlinembel-kcb.at Möbel Einrichtung Indoor Outdoor
56 Tischlerei Herbert Reisinger GmbH Herbert Reisinger GmbH tischlerei
8966
Aich
Tischlerei Herbert Reisinger GmbH Möbel Fenster Türen Sanierung ... Home Möbel Kontakt und Copyright Herbert Reisinger GmbH.
tischlerei-reisinger.at Tischlerei Herbert Reisinger Gmbh Steiermark
57 Möbel auf moebelhaus24.at Möbel

... Moebelhaus.at Alles zum Thema MöBEL Startseite Angebote Beiträge Jetzt kostenlos anmelden
moebelhaus24.at Möbel
58 Home Möbel King nach

Nach Wunsch unserer SaunaKunden haben wir unsere neue Tätigkeit eingeführt: als Meisterbetrieb bieten wir professionelle ... Home Möbel Vorzimmermöbel Küchenmöbel Garderobenmöbel Kinderzimmermöbel Badezimmermöbel Büromöbel
mobelkonig.at Nach Mass Möble Möbel King Sauna
59 Homextra Möbel Zeit homextra

Homextra Möbel Zeit Für Schönes Wohnen ... Homextra Möbel Rotenhofgasse Wien + e-mail Diese -Adresse
homextra.at Homextra Türkisches Möbelhaus Wien; Möbel Moebel
60 Möbel günstig online kaufen Möbel
8132
Pernegg
Möbel Betten Sofas oder Tische für Ihre WohnungHausEinrichtung gesucht? Bestellen Sie Ihre WohnEinrichtung ... Möbel sicher einfach online kaufen bei Möbilia Artikel ? Zum Warenkorb » Möbel Badmöbel
moebilia.at Möbel Betten Sofas Tische
61 Gebraucht moebel second hand gebraucht

handlel mit gebraucht moebel second hand furniture arredamenti di secondo mano ... GEBRAUCHTE MOEBEL WOHNZIMMER ESSZIMMER SCHLAFZIMMER VORZIMMER ZIERGEGENSTÄNDE KÜCHE ANTIKES KUNST
gebraucht-moebel.at Gebraucht Moebel Bilig Polovno Neuwertig Ocuvan
62 Pirker Design Trafik Pirker

Pirker Design Trafik Shop Möbel und Interior Design f�r bessere Geschäfte und ... ... für bessere Geschäfte. Einzigartig wie das Leben - Ihre neue Einrichtung von Pirker Möbel und Interior Design
pirkerdesign.at Pirker Möbel Interior Design
63 OnlineMöbelhaus Karakter | Möbel Karakter
6800
Feldkirch
Karakter Möbel und Wohnaccesoires. Karakter bietet Möbel aus massivem Palisanderholz/Sheeshamholz im Kolonialstil und im ... Willkommen beim Online-Möbelhaus »Karakter« - Möbel im Kolonialstil und modernen Blockdesign Möbel
karakter.at Karakter Möbel Accessoires Möbelversand
64 TISCHLEREI PÖLZL STIEGEN Tischlerei

Tischlerei Pölzl: Stiegen Küchen Türen Möbel. 8083 St. Stefan im Rosental. ... Stiegen Türen Möbel Kontakt Wir bringen Leben in Ihre Wohnräume! Unsere Tischlerei bietet
tischlereipoelzl.at Tischlerei Pölzl Bezirk Feldbach St. Stefan
65 Exklusive Outdoor Möbel exklusives
6091
Neu Götzens
EXKLUSIVES DESIGN: Die Agentur für Design Outdoor Möbel Ihr Vertriebspartner von exklusiven Gartenmöbel ... by JoomlaVision.Com Katalog Homepage IMPRESSUM Möbelagentur - EXKLUSIVES DESIGN - Oudoor Möbel für Sie!
exklusivesdesign.at Exklusives Design Outdoor Möbel Garten Möbel
66 Willkommen bei Hochreiter Möbel Hochreiter GmbH Hochreiter
8644
Mürzhofen
Hochreiter Möbel wir planen und realisieren Ihr Projekt
hochreiter-moebel.at Hochreiter Möbel Tischler
67 Tischlerei Mayer: Möbel und Tischlerei

Tischlerei Mayer fertigt Möbel nach Ihren individuellen Wünschen. Unser Repertoire umfasst Treppen/Stiegen Küchen ... Tischlerei Mayer - Möbel und Stiegen/Treppen nach Mass
tischlerei-mayer.at Tischlerei Möbel Treppe Stiege
68 Home Ebenhofer Martin Martin

Martin Ebenhofer. Rechberg. Möbel Handel Montage Service. "Möbel für Ihre Sonnenseite"
ebenhofer-moebel.at Martin Ebenhofer. Rechberg. Möbel Handel Montage
69 Möbel Tischlerei in Aschau netwerk Kreidl GmbH & CO KG Schellhorn
6275
Stumm im Zillertal
Die Möbel Tischlerei Schellhorn bietet Ihnen höchste Qualität und meisterliche Verarbeitung Egal ob ein ... infoschellhorn Unsere Ausstellung Öffnungszeiten Mo - Fr - und -Uhr
schellhorn.at Schellhorn Möbel Gastronomie Franz
70 Mira Möbel

Möbel online bestellen! Mira Möbel bietet günstige Möbel für Ihr Zuhause. ... Wohnzimmer Schlafzimmer Arbeitszimmer Esszimmer Sessel Küchen Garderoben Möbel Kindersofas Kindrbetten Sofa
miramoebel.at
71 Pierburg Möbel und Mehr Gerhard Pierburg GmbH Möbel
5142
Eggelsberg
Handelsagentur Gerhard Pierburg Maßhemden Möbel Geweihe
pierburg.at Möbel Hemden Agentur Maßhemden
72 Möbel Pietschnig Willkommen Tischler
9360
Friesach
Ihr Partner für tolle Möbel schöne Küchen Wohnraumplanung mit bestem Preis persönlicher ... - Möbel Pietschnig Ing. Veronika Kotzent-Pietschnig St. Veiter - Friesach
pietschnig.at Tischler Möbel Einrichtung Friesach
73 Möbeldepot ? Vintage Möbel möbel

Vintage Design Möbel Accessoires und Antiquitäten aus Asien und dem Orient bei Möbeldepot in ... Möbeldepot ? Vintage asiatische Möbel Möbeldepot. Arts - Interiors - Exteriors. Newsletter
moebeldepot.at Möbel Möbeldepot Indisch Indische Möbel
74 Möbel Design Tischler Staller

Tischlerei Staller erfahrene fachmännische und individuelle Beratung sowie die Einzigartigkeit der gefertigten Möbel ... Möbel Design Tischler Staller Suchen HomeMöbel Design Tischler Staller WerkstätteHandwerk
tischlerei-staller.at Staller Tischlerei Staller Satller Siegfried
75 AKTION SITWELL MÖBEL Dekorartikel

AKTION SITWELL MÖBEL : Dekorartikel für Innen und Außen Stühle Barhocker Drehstühle Lounge ... Gartenmöbel Kurzfristig benutzt oder .Wahl Ledergarnituren Lounge Möbel und Fauteuil Polstermöbel Restposten
aktion-sitwell-moebel.at Dekorartikel Für Innen Und Außen Stühle Barhocker Drehstühle
76 FADA Industrie Möbel Fada

FADA Industrie Möbel Interieurdesign
fada.at Fada Stefan Rozic Möbel Möbeldesign
77 Tischlerei Hausleitner » Home Tischlerei Tischlerei
4882
Oberwang
Home Tischlerei Hausleitner Möbel Küche Tischler Oberwang Mondsee ... SA Home Leistungen Küchen Möbel Türen Ess- und Wohnzimmer Schlafzimmer Gewerbe Gastrononomie
tischlerei-hausleitner.at Tischlerei Oberwang Tischler Hausleitner Möbel
78 Möbel Meister moebelmeister

Möbel Meister ein Meisterbetrieb der steirischen TischlerWerkstätten mit hohen Anforderungen an Qualität und Leistung.
moebel-meister.at Moebelmeister Moebel Meister Tischler
79 QOQ Ein Lounge SUNSIGN GMBH Hocker
32514
Traiskirchen
Ein Lounge Möbel das begeistert! QOQ lässt Grenzen zwischen Land und Wasser außen und ... . Ein Lounge Möbel das begeistert! QOQ lässt Grenzen zwischen Land und Wasser außen und innen Design
sunsign-qoq.at Hocker Sessel Sitz Sitzgelegenheit
80 Möbel Shop Franz Franz König GmbH Möbel
6263
Fügen
Im Möbelshop der Franz König GmbH finden Sie geschmackvolle Accessoires Möbel Schmuckschatullen ... Startseite Kategorien Accessoires Gewürzmischungen Möbel Wanddekoration Uhren Licht Kinder Musik Marke
moebel-shop.at Möbel Shop Franz König
81 Wohnideen Möbel Lampen Gartenmöbel Design
40549
Düsseldorf
Onlineshop für moderne Einrichtung mit Wohnideen für Möbel Lampen Leuchten Gartenmöbel und ... designklassiker industrie look landhaus leuchtmöbel lloyd loom massivholz modernes wohnen skandinavische möbel
borono.at Design Möbel Lampen Leuchten PUK
82 Tischlerei Feuerstein ? Fenster Josef Feuerstein GmbH & Co KG Josef
6714
Nüziders
Die Tischlerei Feuerstein fertigt Fenster Türen Küchen Möbel Wintergärten Spezialanfertigungen ... Küchen Tischlerküche Möbel Möbel Handwerkliche Perfektion Emotion in Holz und eine Wohnumgebung
tischlereifeuerstein.at Josef Feuerstein Feuerstein Tischler Nüziders
83 Möbel Design design

Der Möbel Design Guide ein Reiseführer zur Wohnkultur in Österreich. Darüber hinaus führt der ... Registrieren Anmelden Über uns Kontakt News Vorjahres-Trends Newsletter Archiv Möbel Design
moebel-guide.at Design Guide Interior Guide Einrichtung Info
84 Hanli Möbel Ihr möbelmontage
5121
Ostermiething
Wir sind Ihr zuverlässiger Partner für Möbel aller Art jetzt unverbindlich nachfragen!
hanli.at Möbelmontage Möbelaufbau Böden Türen
85 Ihr Möbelhaus für Polstermöbel Ihr

Möbel Küchen Ingolstadt von der Planung bis zum Einbau. Ihr Möbelmarkt in Ingolstadt ... und Hocker Couchtische TV und HiFi Möbel Eck- und Beistelltische Sideboards und Kommoden Regale
wohnorama.at Ihr Möbelhaus Für Polstermöbel Planungs Küchen
86 MÖBEL KARBIENER Handwerk MÖBEL

MÖBEL KARBIENER steht für Handwerk mit Tradition Planung mit Zukunft. MÖBEL KARBIENER in Lambach ... Home Planung Designmöbel Werkstatt Kontakt Home MÖBEL KARBIENER JEDES MÖBELSTÜCK
moebel-karbiener.at MÖBEL KARBIENER Karbiener Thomas Thomas
87 MöbelTrans sijam

MöbelTrans fuer Oesterreich und Ausland ... FIRMA IN GRÜNDUNG! Möbel-Trans-Umzug - UMZUG Rufen Sie uns an wir machen Ihnen ein Spezialangebot
moebel-trans.at Sijam Montage Umzug Lkw
88 Janka Esterhazy Restauratorin janka

janka esterhazy restauratorin historische möbel holzobjekte hasnerstraße 64 1160 vienna ... Home Portrait Arbeitsweise Leidenschaften Atelier Kontakt Jedes historische Möbel
janka-esterhazy.at Janka Esterhazy  esterhazy  wien österreich Möbelrestaurator
89 Polster Möbel Polstermöbelerzeu
3251
St. Georgen
Polster Möbel Werkstatt FELLNER St. Georgen St. Pölten ... ? Polstermöbelrestaurierung ? Matratzenerzeugung ? Fahrzeugtapezierung ? Accessoires ? Antike Möbel ? Über uns Kontakt
polster-moebel-werkstatt.at Polstermöbelerzeugung Kenzo Mulberry Und Ralph Lauren
90 ::: Magnes Möbel ... Robert

Robert Magnes Möbel ... denn Ihr Tischlermeister macht's persönlich.
magnes.at Robert Magnes Möbel Tischler Tischlermeister
91 Mode Online Shop Universal

Universal Versand Ihr Shop um Mode Kleidung Schuhe und Möbel günstig online ... Online Shop - Kleidung - Schuhe - Möbel kaufen Universal Versand Hier finden Sie ein umfangreiches
universal.at Universal Versand Online Shop Mode
92 Khandmade alte Möbel Khandmade

Khandmade Möbel und Wohnaccessoires in Salzburg: Sitzmöbel Sessel Stühle shabby chic ... Khandmade aus alt wird neu Möbel und Wohnaccessoires in Salzburg alte restaurierte Möbel
khandmade.at Khandmade Möbel Und Wohnaccessoires In Salzburg: Alte
93 Franz König GmbH franz könig gmbH Franz
6263
Fügen
Franz König GmbH in Fügen im Zillertal Stuck Weinkeller Trockenbau Möbel ... Weinkeller Wand- Deckengestaltung Badrenovierung Möbel Accessoires Beleuchtung Shop Referenzen Kontakt
stuckateur.at Franz König GmbH Fügen
94 Möbel Fundgrube Home Handel

Möbel Fundgrube Margarethen am Moos ... Anfahrt Möbel Fundgrube Möbel Fundgrube Mit Möbel Fundgrube zum neuen Look! Optik ist immer
moebel-fundgrube.at Handel Großhandel Second Hand
95 Gastronomieeinrichtung Gastroeinrichtung sowie KASON GmbH & Co. KG Kason
94496
Ortenburg
KASON Hersteller von Gastronomieeinrichtung Objekteinrichtung und Hotelzimmereinrichtung. Fabrikverkauf – gebrauchte Gastro Einrichtung – ... - . Uhr +++ Vertriebspartner für DE AT und CH gesucht! +++ Besuchen Sie KASON auf folgenden Messen
kason.at Kason Möbel Moebel Stühle
96 Stefan Kohlbacher Moebel Raumdesign kohlbacher
8580
Koeflach
Stefan Kohlbacher Moebel Raumdesign ... Stefan Kohlbacher Moebel Raumdesign Alte Hauptstrasse Koeflach
kohlbacher-design.at Kohlbacher Möbel Raumdesign Tischler
97 MÖBELOnlineshop für Wohnen Möbel

Im Möbel Versand von nero Möbeloase finden Sie günstige Polstermöbel aus Leder Esszimmerstühle ... Couchtische Eck- Beistelltische Ordnung und Aufbewahrung Anbauwände Regale Raumteiler TV-Möbel Accessoires
nero-moebeloase.at Möbel Versand Polstermöbel Aus Leder Esszimmerstühle
98 Schmalnauer Treppen Tischlerei

Treppen Geländer Türen Möbel Montage Reparaturen 4632 Pichl/WelsLand ... Schmalnauer Treppen Türen Möbel Montage Reparaturen Startseite Projekte Kontakt Schmalnauer Harald
schmalnauer-t.at Tischlerei Treppen Geländer Türen
99 Wood.at: Möbel online planen möbel

Plattform zur OnlinePlanung von Möbeln ... wood Möbel online planen wood ist ein Projekt der Lumplecker Holzindustrieberatung GmbH
wood.at Möbel Planen Internet
100 KÖLBL PROFIMONTAGEN Möbel kölbl
8511
St. Stefan ob Stainz
KÖLBL PROFIMONTAGEN Möbel Türen Parkettböden
profi-montagen.at Kölbl Profimontagen Profi Montagen
101 Altholzdesign Möbel
9131
Grafenstein
Möbel aus Alzholz ... sthon Möbel aus Altholz Startseite Projekte Kontakt Altes Holz neues Design Glashaus
sthon.at Möbel Aus Altholz ; Möbel Aus Holz
102 Schreinerei Wirth | Bucher wb
88339
bad waldsee
wb* schreinerei wirth|bucher bad waldsee objekteinrichtungen innenausbau möbel ... verbindung von form und funktion? mehr schreinerei wirth-bucher innenausbau objekteinrichtungen möbel
wirth-bucher.at Wb Schreinerei Wirthbucher Schreiner
103 Einrichtungen Möbel

Möbel Rantschl ? Küchen Fenster Türen Möbel 3DPlanung Übersiedlungen ... Möbel Rantschl Produkte Küchen Esszimmer Wohnzimmer Schlafzimmer Jugendzimmer Begehbare Schränke
moebel-rantschl.at
104 Eventausstatter EMSON Möbel emson

Eventausstatter EMSON Möbel und Technik für jede Veranstaltung: Barhocker Stehtische Hussen ... der VIP-Lounge der Kleinen Zeitung auf der Grazer Ferien-Messe. Lounge-Möbel und Technik von Emson.
emson.at Emson Mietmöbel Möbel Mieten Veranstaltung
105 Möbel Klein Möbel

Das Möbelhaus mit Herz und Stil ... . Viel Spaß wünscht Ihnen Ihr Team von Möbel Klein. Möbel Klein Wien Landstraßer Hauptstraße
moebel-klein.at Möbel Küchen Wohnzimmer Polstermöbel
106 Rattan möbel rattan

Hier finden Sie qualitativ hochwertige Design und die Gartenmöbel von künstlichen Rattan die die ... im Warenkorb € inkl. MwSt Komfort Rattan Möbel nur für Sie Call + Hängematte Aventura
rattanmobel.at Rattan Mobel Garten Rattanmobel
107 Möbel Ludwig Ludwig
1220
Wien
Möbel Ludwig 4 x in Wien. Wiens größtes Möbelhaus mit 40.000m² Ausstellungssfläche. Der Spezialist
moebel-ludwig.at Ludwig Einrichtung Möbel Küche
108 MayrSchulmöbel | Schuleinrichtung | Mayr Schulmöbel GmbH schulmöbel
4644
Scharnstein
Schulmöbel von Mayr bewahren Lernende vor Haltungsschäden. Entdecken Sie jetzt unsere moderne und ergonomische Schuleinrichtung: ... Möbel für den komfortablen und in jeder Hinsicht gesunden Schulbetrieb. In unserem Portfolio finden
mayrschulmoebel.at Schulmöbel Schuleinrichtung Ergonomische Möbel
109 Tischlerei Künzler Bizau | Tischlerei Künzler GmbH & Co KG Tischlerei
6874
Bizau
Tischlerei Künzler Bizau | Bregenzerwald | Vorarlberg Bezau Küchen Türen ... Küchen Küchen Küchen Küchen Schlafzimmer Bad Möbel Tische + Bänke Kleinmöbel Garderoben Türen
kuenzler.at Tischlerei Künzler In Bizau/Bregenzerwald. Küchen Türen
110 Möbelonline.at Informationen zum

möbelonline.at ist Ihre erste und beste Informationsquelle über möbelonline Hier finden Sie auch weitere ... möbel-online Weitere Links Der Inhaber dieser Domain parkt diese beim Domain-Parking-Programm
xn--mbel-online-rfb.at
111 Home Max Leitner OHG Möbel
4020
Linz
Möbel Leitner Der Einrichter Ihres Vertrauens! ... Beleuchtung Bilder Schauraum Aktuelles Aktuelles Möbel Leitner Newsletter Nanai Fronten Design Noteborn
moebel-leitner.at Möbel Leitner Einrichter Individuelles Einrichten
112 Willkommen in der Kinderstrasse Kindermöbel
1160
Wien
Mode Möbel für selbstbewußte Kinder ... Home Shop Mein Warenkorb Mein Konto AGB´s Widerrufsrecht Versand-Informationen Möbel Materialien
kinderstrasse.at Kindermöbel Kinderbekleidung Kinderkleider Möbel Kinderzimmer
113 Tischlerei Spatzenegger ~ Möbel Tischlerei

Tischlerei Spatzenegger Spatzenegger Tischler Tischlerei Möbeldesign Türendesign Möbel ... Tischlerei Spatzenegger Johann Spatzenegger - Möbel und Türendesign News Design Wohnen Türen
spatzenegger.at Tischlerei Spatzenegger Spatzenegger Tischler Bau
114 Tischlerei OBERASCHER Mondsee :: Tischlerei Oberascher GmbH & Co KG Tischlerei
5310
Mondsee
Tischlerei Oberascher Möbel zum Wohnen und Arbeiten
oberascher.at Tischlerei Tischler Möbel Türen Fenster Küchen Innentüren Hautüren
115 Moebelgoll.at  Diese Website steht zum

Diese Website steht zum Verkauf! moebelgoll.at ist die beste Quelle für alle Informationen die ... moebel-goll Domain erwerben This domain is FOR SALE - Diese Domain steht ZUM VERKAUF Weitere
moebel-goll.at
116 Pure Velvet Möbel Online

Stilvolle und besondere Möbel Dekorationsartikel zu tollen Preisen auch online! Lassen Sie sich ... New In Get the Look! Möbel Beleuchtung Accessoires Dekokissen Kinderzimmer Stoffe Tapeten Sale
purevelvet.at
117 Moebelarchitektur.at Blumberger

Menschen mit Liebe und Freude am Weg. Wir von Blumberger begleiten Sie mit Möbelarchitektur in ... moebel-architektur - Möbel-Architektur ÖFFNUNGSZEITEN MO - DO bis Uhr und
moebel-architektur.at Blumberger Reinhart Waidhofen Waidhofen/Th. Waidhofen/Thaya
118 Tischlerei Ernst Küchen Möbel Tischlerei Ing. Ernst Gmbh & Co. KG Tischlerei
9330
Althofen
Tischlerei Ernst Küchen Möbel Fenster Türen Klagenfurt Althofen Kärnten. Die Tischlerei Ernst steht für Tradition ... Tischlerei Ernst Althofen Klagenfurt Kärnten Küchen - Möbel - Fenster - Türen Die Tischlerei Ernst
tischlerei-ernst.at Tischlerei Fenster Möbel Türen
119 Sanierung Renovierung Fenster Türen Sanierung

RUBUS Rund um Bau Sanierung Wir sind Ihr starker Partner bei Sanierungen
rubus.at Sanierung Sanierungen Fenster Türen Möbel Renovierung Renovierungen Wien
120 Möbel einfach Online bestellen

Moebella24 Möbel Onlineshop Möbel einfach Online bestellen Sofas Betten Essgruppen ... Reggio ? In den Warenkorb Essgruppe Rustico Vintage Style Landhaus Esszimmer Möbel von
moebella24.at
121 Easy Möbel Shop Steiner Shopping GmbH Möbel
3383
Hürm
... Kontakt Steiner Shopping GmbH Easy Möbel® Hainberg Hürm - Mail
easymoebel.at Möbel Wohnen Schlafen Einrichtung
122 Kastlwerkstatt Home Kastl
1130
Wien
Möbelunikate Recycled Wohnaccessoires Möbel Workshops ... Home Möbel Wohnaccessoires Plätzchen gesucht Recycled Accessoires Schon vergeben Making of
kastlwerkstatt.at Kastl Möbel Accessoires Recycled
123 Möbel und Bautischlerei Schösser

Qualität steht bei uns an erster Stelle ! Diese beginnt schon bei der fachkundigen Beratung ... Möbel- und Bautischlerei Schösser - Lanersbach - A Tux
tischlerei-schoesser.at Schösser Thomas Kreativ In Holz
124 Farkas Moebel Tischlerei

Ihr Meistertischler Wohndesign Bau und Möbeltischlerei Bau und Möbeltischlerei · Farkas Alois ... ÜBER UNS BERATUNG PLANUNG AUSFÜHRUNG KONTAKT Einrichtung-Möbel RAUMGESTALTUNG Küche Esszimmer
farkas-moebel.at Tischlerei Möbeltischlerei Bautischler Alois
125 Suche Möbel Home CONST

Suche Möbel Marktplatz zum Suchen und Finden Ausstellen und Verkaufen neuer und ... Finden Ausstellen Verkaufen neuer neuwertiger sowie gebrauchter Möbel. Suchemoebel bietet
suchemoebel.at CONST IT CONSULTING
126 IdeaForDesign.at Interieur auf Interieur

Wir erstellen den Vorschlag und die Visualisierung. Darüber hinaus bieten wir eine rasche Montage und
ideafordesign.at Interieur Auf Massenfertigung Böden Türen
127 HOME | ConverTTable iPhonetable

Der High End Autosimulator / Fahrsimulator inkl. RECARO Sitz als Design Möbel für home ... und Sie habenkeinen Platzverlust! Vielmehr ist dieses Möbel eine Skulptur die Ihrem Raum mehr Atmosphäre verleiht
coffeetable.at IPhonetable Tableconnect Multitouch Simulator
128 Traditionelle Möbel handwerklich Möbel

Traditionelle Möbel fügen sich in keine schnelllebigen Trends sondern überdauern Mode und bleiben sich
moebel-romantik.at Möbel Holz Natur Landhaus
129 Möbel günstig online kaufen
2431
Enzersdorf an der Fischa
KM Handel ist der günstigste Möbel online shop mit unschlagbaren Preisen bei km möbel . ... Shop über uns Kontakt Shop Österreichs bester Online-Shop für Möbel Jetzt NEU Bezahlen
km-handel.at
130 Filzer Möbel Willkommen tischlerei

Kreativmöbel Tischlerei Filzer ... stefanmoebel-filzer
moebel-filzer.at Tischlerei Filzer Holz Leogang
131 Schloss Grubhof – Wohnen Schloss

Schloss Grubhof wurde 1325 erbaut und war die ehemalige Residenz des Königs von Bayern
schloss-grubhof.at Schloss Schlosshotel Möbel Betten
132 Möbel austria – Tage Möbel

Österreichische Möbelfachmesse vom 7. – 8. Mai 2013 im Messezentrum Salzburg ... Besucherinfos Aussteller News Presse Kontakt Registrierung möbel austria
moebel-austria.at Möbel Austria Messe Fachmesse
133 Moebelmarkt.at Informationen zum

moebelmarkt.at ist Ihre erste und beste Informationsquelle über moebelmarkt Hier finden Sie auch weitere ... moebel-markt Domain erwerben This domain is FOR SALE - Diese Domain steht ZUM VERKAUF Domain
moebel-markt.at
134 Wunderbar durchdachte Möbel LIVING SIEDENDORF KG
3400
Klosterneuburg
DesignerMöbel mit einer besonderen Funktionalität handgefertigte Wohnaccessoires und hochwertige Wollteppiche mit geometrischen Mustern. ... Start Produkte Magnetwände Magnete Teppiche Möbel Über uns Service Kontakt Start Produkte
living-siedendorf.at
135 GLAFO MÖBEL Wohnzimmer

Möbel aus Österreich
ninimax.at Wohnzimmer Wohnmöbel Schlafzimmer Schränke
136 Best Möbel

Best Möbel
bestmoebel.at
137 Modl.at :: Modl GmbH Modl Ges.m.b.H. Modl
5202
Neumarkt am Wallersee
Modl GmbH Tischlerei Möbel Objekteinrichtung Küchen ... Produkte Jobs Kontakt MODL - kreativ einrichten die Tischlerei für Ihre Möbel Copyright Modl
modl.at Modl GmbH Tischlerei Möbel Objekteinrichtung
138 Tischlerei Pfister: Möbel nach Möbel
6721
Thüringerberg
Tischlerei Pfister Walter ... Küchen Wohnzimmer Schlafzimmer Verschiedene Möbel Fenster Türen Altbausanierung Kontakt
pfister-holz.at Möbel Fenster Schlafzimmer Walls Türen Betten Garderoben Tischlerarbeiten
139 Möbelshop.at Informationen zum

möbelshop.at ist Ihre erste und beste Informationsquelle über Möbel shop Hier finden Sie auch ... Domain erwerben infodomcollect DE US möbel
xn--mbel-shop-07a.at
140 BöhmMitsch: Möbel nach Maß Böhm-Mitsch GmbH Böhm
2244
Spannberg
Die Tischlerei BöhmMitsch im Weinviertel fertigt Ihre Möbel nach Maß: Küchen Wohn Schlafzimmer
boehm-mitsch.at Böhm Mitsch Möbel Möbel Nach
141 Bambusmöbel Möbel aus Bambus Bambusmöbel

... ... ...sich Ihren Wohnraum mit Möbel aus Bambus einrichten? ...in einem Bambusbett ein neues Schlafgefühl erleben
bambus.co.at Bambusmöbel Bambusmoebel Möbel Aus Bambus Bambusbett Bambusbetten Gelbett
142 Das Online Möbelhaus XXXLutz KG
4600
Wels
Möbel online kaufen bei XXXLutz ? Möbel Leuchten Wohnaccessoires ? Das Online Möbelhaus ... abonnieren XXXL Preisepass alles über den XXXL Preisepass Möbel Wohnzimmer Polstermöbel Wohnwände
xxxlutz.at
143 Möbel Computer Kleinanzeige

Kleinanzeigen kostenlos inserieren verkaufe kaufe suche Gebrauchtwaren Secondhand Computer ... Inserate Diverses Fahrrad Mountainbike TV Hifi Elektro gebraucht Inserate Musik Möbel Sitzgarnitur
haustiermarkt.at Kleinanzeige Kostenlos Inserieren Verkaufe Kaufe
144 Möbel und Raum Asiamöbel
8020
Graz
Exclusive Möbel und Accessoires aus Asien mit Einmaligkeit Lebendigkeit und individuellem Ausdruck ... Vermietung und Sonstiges Newsletter AGB Telefon Adresse Anfahrstplan Herzlich Willkommen bei Möbel
moebelundraum.at Asiamöbel Chinamöbel Hochzeitsschrank Asien
145 CityAntik Jugendstil Wien Jugendstil

CityAntik Jugendstil Wien bietet Jugendstil Moebel Thonet Glas Keramik Schmuck
city-antik.at Jugendstil Wien Goldscheider Meissen Jugendstil
146 Möbel nach Maß

Tischlerei Erwin Kalischko in Neustift / Pühret. Qualitative hochwertige Möbel aller Art termintreu ... Qualitative hochwertige Möbel und Einrichtungen nach Maß aller Art. Termintreu und mit optimalem Preis
kalischko.co.at
147 Moebeltransport.at Informationen zum

moebeltransport.at ist Ihre erste und beste Informationsquelle über moebeltransport Hier finden Sie auch weitere ... + moebel-transport Weitere Links Der Inhaber dieser Domain parkt diese beim Domain
moebel-transport.at
148 Gebrauchte Möbel: Gebrauchtmöbel Kleinanzeigen

Der kostenlose Anzeigenmarkt für gebrauchte Möbel! Gebrauchtmöbel kaufen und verkaufen! Unbegrenzt inserieren und gratis für ... Sofagarnitur Designer Eckbank Couchtisch Möbel für Gastronomie Neue
moebelanzeigen.at
149 Tischlerei Feldkirch Kurt Tischlerei

Tischlerei Feldkirch Möbel Küche Bad Wohnzimmer Esszimmer Schlafzimmer
moebelmeier.at Tischlerei Feldkirch Möbel Küche
150 Air Style Designer
8010
Graz
Bei AIRandSTYLE finden Sie aufblasbare Design Möbel für den indoor und outdoor Bereich. Unsere aufblasbaren ... -Adresse Passwort Passwort vergessen? Registrieren aufblasbare Designer Möbel erweiterte Suche
airandstyle.at Designer Möbel Eventmöbel Möbel Für Events Möbel Für
151 Möbel nach Maß Flewid Media GmbH möbel
29227
Celle
... Individuelle Möbel nach Mass online konfigurieren und bestellen. Moderne Designmöbel aus Massivholz
damao.at Möbel Nach Mass Designmöbel Möbel Online Konfigurieren Möbeldesign
152 Joha Türen Baumart

Joha Türen. Baumart Wohnraumdesign Möbel nach Maß Spezialanfertigung. Qualität besteht! ... officejoha-team » Nachricht schliessen! Joha Türen Möbel by Joha Türmodelle Service Bilder Kontakt
joha-team.at
153 Smart Living ? Möbel SMART LIVING GmbH
1070
Wien
Smart Living in 1070 Wien sind Ihre Ansprechpartner für Wohnkonzepte aus modernen Möbel Beleuchtungssysteme ... für Einrichtung. Unser Spektrum umfasst exquisite Möbel Raumplanung und Inneneinrichtung. Egal ob Möbel
smartliving.co.at
154 Moebel hochwertige Möbel SOLEUM GmbH bambusmöbel
4230
Pregarten
... neue Wohlfühlbereiche schaffen! Sie möchten... ...sich Ihren Wohnraum mit Möbel aus Bambus einrichten
moebel.or.at Bambusmöbel Bambusmöbel Babmusmöbel Bambusmöbel Bambus Möbel Bambusmöbel Möbel
155 Home C. Fank Plattenzuschnitt
8250
Vorau
Plattenzuschnitt Fank Qualität für Heimwerker und Profitischler. Plattenzuschnitte Bekantungen Tischlereizubehör Beschläge ... Willkommen bei C. Fank Möbel! Wir fertigen für Tischler und Möbelhändler Möbel für den gesamten Wohnbereich
c-fank.at Plattenzuschnitt Selbstbaumöbel Platten Arbeitsplatten
156 Tischlerei Josef Kranzl kranzl

Tischlerei Josef Kranzl Niederösterreich Massivholzmöbel Einzelanfertigungen Vintagemöbel Klassische Möbel
tischlerei-kranzl.at Kranzl Tischlerei Holz Design
157 Toscana Möbel

Toscana Möbel
toscanamoebel.at Möbel Massivholz
158 Spechtenhauser :: Fenster Holz- und Glasbau GmbH
6020
Innsbruck
?? Unser Familienunternehmen wird höchsten Qualitätsansprüchen im Bereich Möbel Küchen Glas Fenster ... Erfahrung handwerkliche Präzision und Fenster in Meister-Qualität. Möbelbau Möbel und Innenausbauten
spechtenhauser-moebel.at
159 Vintage and Contemporary Möbel

Shop Antiquitäten Vintage MidCentury und Contemporary Möbel und Lampen von den besten Händlern ... aus dem . Jahrhundert und früher Neues in Vintage Möbel Möbel Alle Möbel Sitzmöbel Tische Aufbewahrung
pamono.at
160 Tischlerei INHolz Schladming Winkler Steiner OG Tischlerei
8970
Schladming
Tischlerei InHolz in Schladming: Individuelle Möbel für Ihren individuellen Geschmack. Wir nehmen uns Zeit für ... und vor allem mit Verlässlichkeit unsere Kunden überzeugen. Individuelle Möbel für Ihren individuellen Geschmack. Wir nehmen
in-holz.at Tischlerei InHolz Schladming Steiermark Österreich
161 Gartenmöbel Exclusive Möbel IHP - Ihr HandelsPartner GmbH & Co. KG Gartenmöbel
6020
Innsbruck
Ihr Spezialist für Gartenmöbel Rattanmöbel in Österreich. Exclsuive Möbel für Garten und Terasse. Tirol ... Kaufabwicklung Schauraum Sicher Einkaufen Empfehlung fritz-Sitzsack moebel-rattan ihp.at the-green-pot Garino
moebel-garten.at Gartenmöbel Rattanmöbel Polyrattanmöbel Online Shop
162 Möbel Messestand und Möbel

Tischlerei und MassMöbelHerstellung sowie Objekteinrichtung FranekEibl GmbH in Adnet beei Salzburg Österreich Tel +43(0)624585074
passt.at Möbel Einrichtung Möbelbau Einrichtungen
163 KWAT :: Nina Habe
8160
Weiz
KWAT :: Nina Habe :: Weiz Steiermark Österreich Produktdesign Design Malerie ... KWAT DESIGN SOLUTIONS Home About Raumgestaltung Möbel Accessoires Brett KH Schuhblock VE
kwat.at
164 Polsterprofi Einrichten Wohnen Markenmoebel

Markenmoebel Inneneinrichtung Innenausbau Hoteleinrichtung Designermoebel Landhausküchen Schreinerei Innenarchitektur
polsterprofi.at Markenmoebel Inneneinrichtung Innenausbau Hoteleinrichtung
165 Startseite Putz Möbel Putz Möbel GmbH logo
8230
Hartberg
Ihr Einrichtungspartner in Hartberg. Erhalten Sie bei uns viele neue Wohnideen und Tipps vom Profi. ... Dekoideen Putz Möbel bei Facebook Besuchen Sie uns auf unserer Facebook-Seite. mehr lesen Küche planen
putzmoebel.at Logo Moebel Wohnen Wohnideen Abholmarkt
166 MÖBEL NACH MASSINNENAUSBAUGESCHÄFTSEINRICHTUNGFENSTERTÜRENTORE TISCHLEREI
1090
Wien
Tischler 1090 Wien Maßanfertigung Holzdesign ... So finden Sie uns Produkte Küchenmöbel Inneneinrichtung Möbel nach Maß Einzelmöbel Individuelle
tischlerei-wolfram.at TISCHLEREI 1090 Wien Möbel Nach Mass
167 WebTischler Natur Möbel Tischler

Hier erfahren Sie alles über individuelle persönliche und passgenaue Einrichtungen ... webTischler - Natur Möbel Design Schauptmayr Herzlich Willkommen Man kann einen Menschen
webtischler.at Tischler Tischler Webtischler Webtischler
168 Küchenstudio Bergheim mit Tischlerei

In Bergheim nahe Salzburg finden Sie das Küchenstudio Bergheim und die Tischlerei Klein. ... in Bergheim erzählen Sie uns von Ihren Vorstellungen und wir erstellen individuelle und handgefertigte Möbel
tischlerei-klein.at
169 GRABNER MÖBEL Baden Wien  Hochrainer GmbH
2500
Baden
Seit 1969 entscheiden sich Kunden für GRABNER MÖBEL in Baden bei Wien. Verwirklichen Sie gemeinsam ... GRABNER MÖBEL Baden Wien Aktuelles Unternehmen Service von A-Z -D Online Küchenplaner Wohnen
grabnermoebel.at
170 Sofa Shop online Designer

Sofashop24 ist der online Shop für exklusive Sofas Ledersofas und schönen Wohnlandschaften. Kaufen Sie ... und Betten aus dem Designer Möbel Onlineshop von Sofashop Hotline Menü Home Wohnzimmer
sofa-dreams.at
171 Teak Gartenmöbel und Vollholzmöbel terrassenmöbel
8042
Graz
Als der grösste Teak und VollholzMöbelAnbieter in Österreich haben wir ständig grössere Mengen von Teakholz ... Teak Gartenmöbel - Vollholzmöbel - Massivholzmöbel - Möbel nach Mass online kaufen AGB Kontakt
fantasteak.at Terrassenmöbel Teakholz Teak Gartenmöbel Gartenmöbel
172 AnaZard Shabby Chic keywords
1230
Wien
Onlineshop für Shabby Chic Vintage Landhausstil Homedecoration Accessoires Möbel Leuchten ... für ? Home Decoration ? Wohnaccessoires ? Möbel ? Modeschmuck ? ? Shabby Chic ? Vintage ? Landhausstil
anazard.at Keywords Kommagetrennt
173 Planungsbüro Hermann Lammerhuber planungsbüro

Das Planungsbüro Lammerhuber ist spezialisiert auf Innenraumplanung die Erstellung von Rohplänen und Innenplänen ... Start Planung Möbel Samina Referenzen Kontakt You need to upgrade your Flash Player Wir setzen
planung-lammerhuber.at Planungsbüro Lammerhuber Innenplanung Raumplanung Innenarchitektur
174 Weißenbek Der energetische

Weißenbek Möbel Design Montage Energetik Feng Shui Radiästhesie ... officeweissenbek - Website www.weissenbek Möbel - Design - Montage - Energetik - Feng Shui
weissenbek.at
175 Amtmann: Tischlerei Innenausbau Möbel
5450
Werfen
Amtmann baut Möbel mit höchster individueller Funktionalität. Funktionalität verstehen wir als das Zusammenspiel von ... Amtmann baut Möbel mit höchster individueller Funktionalität. Funktionalität verstehen
amtmann.co.at
176 Joha Baumart

Joha Türen. Spezialist Inneneinrichtung Wohnraumdesign Möbel nach Maß Spezialanfertigung Tischlerei ... Joha Türen Baumart Joha Möbel Joha-Türen Baumart Möbel by Joha Kontakt Home Willkommen bei Joha
joha.at
177 Ergonomie: Ergonomische Büromöbel

Ergonomie! Infos über ergonomische Möbel für Büro Wohnung Arbeitsplatz. » Bürostuhl » Schreibtisch ... Übersicht Ergon Tischgestell Spine² iMove Vital-Office Ergonomie Vital-Office Bambus Möbel Vital-Office
ergonomie-katalog.at
178 Thalia möbel wohnform löffler möbel

Thalia Möbel im 16. Bezirk in Wien fuehrt Planungen EinrichtungsPlanung Einrichtungsplanung von Qualitätsmöbel in edle
moebel-thalia.at Möbel Wien Planungen Thalia
179 Apuria Glas

einzigartige Möbel
apuria.at Glas Handwerk Holz Möbel
180 Mode Online Shop | Otto GmbH
8020
Graz
OTTO Versand: Der ?????OnlineShop für Mode Lifestyle Schuhe Möbel und mehr. Bequem ... . Möbel Möbel . Heimtextilien Heimtextilien . Baumarkt Baumarkt . Spielzeug Spielzeug . Marken Marken
ottoversand.at
181 M24austria.at M24 GmbH M24austria.at
96482
Ahorn - Triebsdorf
Professionelle und preiswerte Möbel für Gastronomie Gewerbe und Handel bei m24austria.at. Hier finden Sie ... von Einzelteilen und Ersatzteilen für unsere Möbel über Stoffe in verschiedenen Materialien und Farben
m24austria.at M24austria.at Möbel Inneneinrichtung Stühle
182 Möbelcorner Germ GmbH in

Bei Möbelcorner Germ GmbH in 1050 Wien Margareten finden Sie Möbel nach Maß für Küche ... Wir sind Ihr freundliches und kompetentes Fachgeschäft in Sachen Möbel nach Maß Küchen/Einbauküchen Küchenumbau
moebel-germ.at
183 Tischlerei Neunkirchen

Tischlerei Wolfgang Schaller ? Ihr Tischler für Möbel Fußböden Türen Einrichtungen ... Möbel nach Mass Fußböden Türen Einrichtungen Reparaturen und Änderungen Übersiedelungen Herzlich
tischlerei-schaller.at
184 Home Klinar2 Handels Klinar2 Handels OG fenster
9872
Millstatt
Der Spezialist für Fenster Türen In OutdoorMöbel Physiotherm Tischlerarbeiten ... Referenzen Lage Karl Klinar In- Outdoor-Möbel Schauraum Thomas Morgenstern Platz Seeboden
klinar2.at Fenster Türen Möbel Physiotherm
185 Startseite Logo Möbel Putz Möbel GmbH logo
8230
Hartberg
Ihr Einrichtungspartner in Hartberg. Erhalten Sie bei uns viele neue Wohnideen und Tipps vom Profi. ... Sie jetzt unsere Online-Gutscheine -Einfach und sicher direkt online! mehr lesen Logo Möbel bei Facebook Besuchen
logo-moebel.at Logo Moebel Wohnen Wohnideen Abholmarkt
186 Greiner Möbel
2304
Orth an der Donau
Greiner Möbel www.greinermoebel.at Objekteinrichtung Hoteleinrichtung TürenSonderanfertigungen Tischlerei www.judithkeles.com
greinermoebel.at
187 Mothergoose Klassisch zeitlose mothergoose

Klassischzeitlose Möbel Interior Textilien und Spielsachen für Mädchen und Buben von 08 ... Klassisch zeitlose Möbel Textilien und Spielsachen für Mädchen und Buben von bis Produkte
mothergoose.at Mothergoose Calice Trauttmansdorff Wallner
188 Möbel online günstig kaufen
10623
Berlin
Mehr als 2000 Möbel günstig im Online Shop bei KaufUnique.at. Dauertiefpreise bei allen Möbeln ... quadratisch Sideboard Kommoden TV-Möbel Wohnwand LED-Möbel Wandkonsole Konsolentisch Elektrokamin
kauf-unique.at
189 Henders Hazel Henders

Henders Hazel kreiert Möbelmode. Möbel aus eigenem Atelier angefertigt von Fachkräften. ... Schränke Buffetschränke Bücherregale Highboards Lagerschränke Sideboards TV-Möbel Vitrinen Sofas -sitzer
hendersandhazel.at Henders Hazel Kreiert Möbelmode. Möbel Aus Eigenem
190 Home: alles im griff GRIFF

PRODUKTION UND VERTRIEB VON GRIFFEN ALLER ART IM SPEZIELLEN FUER MOEBEL UND EINRICHTUNG ... für Möbel verbunden sind. Von . bis . Februar sind wir wieder auf der ZOW vertreten und freuen uns schon
allesimgriff.co.at GRIFF GRIFFE ALUMINIUMGRIFFE EDELSTAHLGRIFFE HOLZGRIFFE MOEBELFUESSE DESIGN MOEB
191 WohnARTStudio MÖBEL HALTER wohnart

... MÖBEL HALTER Garant für gutes Wohnen Terminvereinbarungen unter ab ..
wohnart-studio.at Wohnart Möbel Halter Bruck Halter
192 Günstiger Baby OnlineShop | Kinderwagen
01665
Käbschütztal
Günstige Babyausstattung in unserem Baby Familienportal mit Kaufempfehlungen und Tipps rund um Baby ... Möbel Kinderzimmer-Ausstattung Die Einrichtung des Babyzimmers bzw. Kinderzimmers richtet sich ganz
baby-und-kind.at Kinderwagen Baby Shop Kindermode Kinderzimmer Möbel Still BH
193 In Baden bei Wien Hochrainer GmbH
2500
Baden
Seit 1969 entscheiden sich Kunden für GRABNER MÖBEL in Baden bei Wien. Verwirklichen Sie gemeinsam ... Wohlfühlen Kochschule Rezepte Kontakt Grabner Möbel im neuen Gewand Neuer Name ? gleiche Qualität
derwohnraumgestalter.at
194 Brege Möbel Sitzmöbel Stuhl

Familienbetrieb Brege Möble aus Wenns im Pitztal stellt Sitzmöbel und Tische aus eigener Produktion her. ... Brege Möbel Wir sind ein professionelles Unternehmen aus Wenns im Pitztal spezialisiert auf Fertigung
brege-moebel.at Stuhl Sessel Hocker Barhocker
195 Hase Kramer | Tischler
6850
Dornbirn
Tischler aus Vorarlberg. Neue Küchenideen im Küchenstudio Dornbirn.Wir sind im hochwertigen Möbel und Innenausbau tätig. ... in Dornbirn. Küchen und Möbel nach Maß. Schauraum Vorarlberg Dornbirn Innenstadt Eisengasse a. Tel
hase-kramer.at Tischler Aus Vorarlber Dornbirn Kuechen
196 Home Tischlerei Weber Tischlerei
8672
St. Kathrein a. H.
Tischlerei Weber Ihre Tischlerei in St. Kathrein a. H. im Bezirk Weiz. Beratung und Planung ... Leistungen Referenzen Unternehmen Aktuelles Kontakt Möbel mit Geschmack Einfach wohlfühlen Küchen nach Mass
tischlerei-weber.at Tischlerei Weber St. Kathrein Am Hauenstein
197 Hochwertige gebrauchte Büromöbel Gebrauchte

Gebrauchte Büromöbel billig günstig preiswert mieten kaufen Wien Niederösterreich ... Gebrauchte Büromöbel günstig - mieten - kaufen - Bene Möbel - Hali Möbel - Neudörfler - Sitzmöbel
moebelmieten.at Gebrauchte Büromöbel Billig Günstig Preiswert
198 Altholz Tischlerei Antikholz altholz

Der auf Altholz spezialisierte Tischler in Salzburg informiert über Möbel aus Antikholz wie z.B. Türen
antikholzwerkstatt.at Altholz Möbel Tischlerei Altholzmöbel Tischler Antikholz Antikholzmöbel Antiquit
199 Tischlerei Thaler Tischlerei
9842
Mörtschach
Wir erzeugen Ihre Möbel nach Maß und Wünschen. So wird Ihr Traum von schöner Wohnen ... Meisterbetrieb hochwertige Möbel die Ihren Wünschen und Bedürfnissen entsprechen. Ausgewählte natürliche
tischlerei-thaler.at Tischlerei Möbel Stiegen Mörtschach
200 Willkommen bei GEA GEA

GEA MÖbel und Schuhe und mehr
gea.at GEA MÖbel Schuhe
201 Tischlerei Freudenthaler GmbH Wohncharakter Altenberg

Tischler Altenberg Freudenthaler Möbel
wohncharakter.at Altenberg Freudenthaler Möbel Tischler
202 Friedrich Otto Schmidt FOS
1090
Wien
Spezialist für Planung und Anfertigung von Inneneinrichtung sowohl als auch auf fachgerechte Restaurierung und ... Restaurierung und Kopie alter Möbel spezialisiert ist. Entsprechend der Tradition des Unternehmens werden seit
fos.at FOS Möbel Restaurierung Innenarchitektur
203 Möbel nach Maß
4451
Garsten
... möbel-dimitrov officemoebel-dimitrov Home Unsere Firma Projekte - Galerie Lieferanten
moebel-dimitrov.at
204 Privileg Technik Möbel Online QUELLE

QUELLE Versand 300.000 Artikel | Möbel Technik Privileg günstig online kaufen | ... Monitore NF Mailing KW Rühren Mixen Notebooks QUELLE - Möbel Privileg Garten und Baumarkt kaufen
quelle.at QUELLE Online Shop Österreich
205 FEHLENDE ÜBERSCHRIFT CoolesHandwerk

CoolesHandwerk Tischlerei Schallert Schallert Mario Cooles Handwerk Tischlerei Mario Schallert Möbelbau Küchen Sonderanfertigung Design Möbel ... FEHLENDE ÜBERSCHRIFT Küchen Bad Möbel Sonderanfertigung Kontakt Links Gästebuch FEHLENDE
cooles-handwerk.at CoolesHandwerk Tischlerei Schallert Schallert Mario Cooles Handwerk Tischlerei
206 AWEST Shop AWEST

AWEST Shop Ladenbau Ladeneinrichtung Geschaeftseinrichtung Ladenbedarf Displays POS
awest.at AWEST Shop Ladenbau Ladeneinrichtung
207 Designermöbel online kaufen im Designermöbel

Designermöbel Möbel namhafter Marken Online kaufen und inspirieren lassen. ?Qualität ?Große Auswahl ?100% ... Registrieren + HOME - DESIGN - LIFESTYLE % sicher einkaufen Toggle navigation MENU Möbel
nunido.at Designermöbel Möbel Einrichtung Sofas
208 Wiesner Möbel .:. Home Einrichtung

Wiesner Möbel | Individuelle Erzeugung von Gästezimmer Hotelzimmern und Einrichtungsobjekten
wiesner-moebel.at Einrichtung Objektgestaltung Möbelerzeugung Handel
209 Tischlerei Walter Trattner..........Möbel aus Tischler
8162
Passail
Tischlerei Walter Trattner Möbel aus Meisterhand
trattner.at Tischler Tischlerei Tischlermeister Meisterbetrieb
210 Tischlerei Lehner Möbel
4611
Buchkirchen
Tischlerei Lehner Möbel und Türen nach Maß
tischler-lehner.at
211 Möbel mit zeitlosem Klang Symphonic GmbH symphonic
8184
Anger
Möbel mit zeitlosem Klang Symphonic GmbH
symphonic.at Symphonic Objektausstatter Hotelausstatter Möbelhersteller
212 Deisl Möbel

... Javascript Menu by Deluxe-Menu Deisl Möbel
deisl-moebel.at
213 Andreas Leibnitz Möbelrestaurator Restaurator

Restaurator Andreas Leibnitz. Reversible Restaurierung von Holzobjekten wie Möbel Kunstgegenständen ... Alte Möbel zu besitzen und mit ihnen zu leben bedeutet eine emotionale Bindung zu bleibenden
andreasleibnitz.at Restaurator Restaurierung Kunst Tischler Antik Antiquitaeten Moebel Polstermoebe
214 Tischlerei Walter Haberl Tischlerei

Tischlerei Walter Haberl Ihr Meisterbetrieb Möbel Fenster Türen Stiegenbau ... Möbel Fenster Türen Stiegenbau Parkett und Blindbodenverlegung Inneneinrichtungen
tischlerei-haberl.at Tischlerei Haberl Möbel Fenster
215 Tischlerei Technisches Buero Ing. Tischlerei
4551
Ried im Traunkreis
Wir fühlen uns verpflichtet umweltkonforme Produkte zu produzieren umweltverträgliche Materialien zu verwenden und ... zu verwenden und garantieren ein optimiertes Design und Alltagstauglichkeit unserer Möbel. Langlebige
mistlberger.at Tischlerei Technisches Büro Möbel Aussengestaltung
216 Moebelfink.at

... moebel-fink Unsere Seiten befinden sich im Aufbau. Besuchen Sie uns wieder. Fragen postmaster
moebel-fink.at
217 Willkommen auf der Startseite Restaurator

Restaurator Andreas Scheinast. Reversible Restaurierung von Holzobjekten wie Möbel Polstermöbel Kunstgegenständen und Vergoldungen. ... Referenzenliste Angebot Möbel Das Berufsbild des Restaurators Neueste Nachrichten Bericht Bawag Filiale Bericht
scheinast.at Restaurator Restaurierung Kunst Tischler Antik Antiquitaeten Moebel Polstermoebe
218 Atelier Majestic Tiger Individuelle
1140
Wien
Individualität für deine Möbel! Kunstmöbel Wohnen Design Lifestyle WIEN Vintage ... Atelier online shop Möbel Wohnaccessoires Zubehör möbelwerkstatt Workshops Neue Seite Inspiration
majestictiger.at
219 Aumeier Möbel aumeier


aumeier.at Aumeier Schönau Schoenau Tischler
220 Tischler Unternehmen Krzeptowski KG tischler

Wir sind ein Tischler Unternehmen mit viel praktischer Erfahrung Tradition ... vor dem Tischlerhandwerk. PROJEKTE Planung und Erzeugung Möbel Privatkunden Firmenkunden Klein und große Objekten
krzeptowski-kg.at Tischler Krzeptowski Tischlerei Tischlermeister
221 La Maison d'Elisa Möbel
1070
Wien
Im französischen WohndekoShop La Maison d'Elisa finden Sie Möbel und Wohnaccessoires im französischen Landhausstil. ... schönen Farben und schlichten Materialien. In meinem Shop finden Sie Möbel und Wohnaccessoires
maison-elisa.at Möbel Wohnaccessoires Französischer Landhausstil Shabby
222 Tischlerei Schober aus Lofer Tischlerei
5090
Lofer
Tischlerei Schober aus Lofer Handwerk mit Idee und Verstand. Traditionelles Handwerk moderne Wohnkonzepte ... der Tischlerei Schober in Lofer. In unserer Werkstatt fertigen wir aus besten Rohstoffen besondere Möbel
tischlerei-schober.at Tischlerei Schober Lofer Planung Möbel Wohnen Küche Bautischlerei
223 Möbel Pommer | Es Pommer

... Service Aktuelle Projekte Über Möbel Pommer Jobs Großhandel Wegweiser Kontakt Eigene Erzeugung
pommer.at Pommer Möbel Schlafzimmer Küche
224 Alles für ein schönes möbel

Mit LionsHome findest du neue Wohnideen exklusive Tipps von unseren Einrichtungsexperten und günstige Möbel ... Million Angeboten. Möbel Badmöbel ? Bar-Möbel ? Betten ? Garderoben ? Hängematten ? Hocker ? Kaminöfen
lionshome.at Möbel Wohnen Garten Shopping Produktsuche Preisvergleich Suchmaschine Für
225 Kunstschmiede | Kunstschmiede Ukovmi Schmiede
2405
Bad Deutsch Altenburg
Ukovmi Kunstschmiede bei Prešov. Schmiedeeiserne Möbel nach Maß Geländer Zäune Tore ... Schmiedeeiserne Geländer Schmiedeeiserne Geländer für Innen- und Außenbereich. Geländer Schmiedeeiserne Möbel
ukovmi.at Schmiede Kunstschmiede Schmiedeeiserne Tore Schmiedeeiserne
226 Home Massiv
8983
Bad Mitterndorf
Massiv Möbel Klassische Möbel Sondermöbel Holz Art Skulptur Büste Holzschnitzerei ... werden zur Umsetzung sowohl eigens gefertigte Kunstgegenständen als auch individuell entworfene Möbel
holzwerke.at Massiv Möbel Klassische Möbel Sondermöbel
227 Tischlerei GRÖMMER – Einrichtung Tischlerei

Tischlerei Grömmer produziert Möbel nach Maß für Krankenhäuser die Hotellerie Gastronomie und den ... Die Tischlerei Grömmer fertigt innovative designorientierte Möbel zum stilvollen Leben
groemmer.at Tischlerei Grömmer St. Roman Oberösterreich
228 F.Z. Möbelmontagen · flott Montage

Wir montieren Ihre Traummöbel in Tischlerqualität beraten aber auch gerne bei Einrichtungsproblemen jeglicher Art ... Art und planen auf Wunsch Ihr neues Möbel sogar millimetergenau und computerunterstützt! Dazu bieten
fz-montagen.at Montage Montagen Möbel Möbel
229 Agentur objekt direkt Andreu

Moebel Agentur fuer Oesterreich der Hersteller Andreu World Bla Station Indecasa Nanimarquina ... Indecasa Sellex Möbel Moebel Teppiche Stuehle Stuhl Stühle Sessel. Barhocker Gastronomiemöbel
objektdirekt.at Andreu World Bla Station Indecasa
230 Tischlerei Bucher GmbH tischlerei

F.Bucher Tischlerei Möbel für Wohnbereich Geschäft und Büro. Bauteile für Industrie Gewerbe ... von Zweckmäßigkeit und Gestaltung ist unsere oberste Maxime. Einzelmöbel Unsere Möbel sind Maßarbeit
fbucher-tischlerei.at Tischlerei Bucher F.bucher Fbucher
231 Home Antikbeimwasserturm antik

antikbeimwasserturm.de antike Möbel restaurationen abbeizen flechten 60siger Jahre Möbel Klassiker der 60 entwurmen polstern sandstrahlen ... machen zu können. Zur Zeit findet ein Räumungsverkauf statt. Auf m² bieten wir alle Möbel zu Sonderpreisen
antik-beim-wasserturm.at Antik Möbel Schrank Kommode Sekretär Tönisvorst Restauration
232 Eichenholz / Betten

Betten und Möbel in Eichenholz von Ihrem Tischler Profi geplant und realisiert
tischlerei-hutterer.at
233 Homestyle4u eShop | Wohnen Paravent

Alles zum Thema Möbel Einrichtung und Wohnaccessoires. Blitzschneller Versand.
homestyle4u.at Paravent Raumteiler Bambusbett Hochbett
234 Aktionen Javahouse Bradach Einrichtungs KG Javahouse
9081
Reifnitz am Wörthersee
Javahouse hochwertige Möbel aus Indonesien
javahouse.at Javahouse Java Indonesien Indonesia
235 Willkommen bei Tischlermeister Himmelstoss! Tischlermeister
9123
St. Primus
Tischlermeister Himmelstoss Tischlerei Möbel
tischlermeister-himmelstoss.at Tischlermeister Himmelstoss Tischlermeister Himmelstoss Tischler
236 Aktionen Javahouse Bradach Einrichtungs KG Javahouse
9081
Reifnitz am Wörthersee
Javahouse hochwertige Möbel aus Indonesien
baligazebo.at Javahouse Java Indonesien Indonesia
237 Home Tischlerei Kapsammer Home

Home. Tischlerei Kapsammer Tischlerei Kapsammer Möbel Moderne Möbel
kapsammer.at Home Tischlerei Kapsammer
238 Home Schmiede

geschmiedeter Stahl Niro Kupfer Messing und Corten traditionell und zeitgemäß am und ... Bildergalerie StartEinrichtungen - Möbel - Gitter - Tore - Grabzeichen - Treppen - Lichtobjekte
metallgestalter.at Schmiede Kunstschmiede Stahl Design Einrichtung Gestaltung Möbel Gitter
239 Moebeldesigner.at

... Thomas Fleihaus Möbel-Designer Home Services PARTNER Küchen Wohnen Bad Jugend Stiegen Schlafen
moebel-designer.at
240 Dental Service Wien Dentaleinheiten
2380
Perchtoldsdorf bei Wien
Dentaleinheiten Möbel Einrichtung für Zahnarztpraxis und Zahntechnikerpraxis Wien Dental Reparatur Service Wien
dental-service.at Dentaleinheiten Möbel Einrichtung Für Zahnarztpraxis Und Zahntechnikerpraxis
241 Beauty Gesundheit Artikel allaround

Finden Sie allaround shopArtikel in den eBay Shops sowie Beauty Gesundheit Möbel ... ) Handy Computer? Foto HiFi Heimwerker Garten Möbel Wohnen Party und Feiern (
all-around.at Allaround Shop Beauty Gesundheit Möbel
242 WERKSTUECK.AT Lampen

Werkstueck.at bietet Objektlösungen in den Bereichen Möbel Lampen und Accesoires.
werkstueck.at Lampen Möbel Accesoires
243 Fenster Türen Tischlerei Krismer GmbH & Co KG Schautischlerei
6460
Imst
Schautischler Krismer Imst Fenster Türen Küche Bad Maßmöbel Zimmer ... Unternehmen Team Kontakt Fenster Fenster nach Mass Türen Die Visitenkarte Möbel Wohnträume Küchen
krismer-imst.at Schautischlerei Krismer Imst Tirol
244 Www.tischlerhandwerk.at | Tischlerei Mathias Tischlerei

Tischlerei Mathias Fellner. Hochqualitative Möbel Design Möbel und mehr von Mathias Fellner.
handwerksregion.at Tischlerei Fellner Mathias Fellner Matthias Fellner
245 Möbel nach Maß dewitt
1110
Wien
The description of my page
xn--mbelnachmass-4ib.at Dewitt Maßmöbel Massmoebel Küche Kueche Wohnzimmer Badezimmer Büroeinrichtung
246 Tischlerei/SchreinereiMöbelKüchen Hamminger St.Johann a. Tischler

... Flash Tischlerei Schreiner Tischler Möbel Braunau Innviertel St.Johann Ried St.Johann Schlafzimmer
tischlerei-hamminger.at Tischler Oberösterreich Braunau St.Johann Tischlerei Schreinerei Tischlerei Schr
247 Startseite Möbi Wohndiskont Möbi Wohndiskont GmbH moebi
5020
Salzburg
Ihr günstiger Möbelabholmarkt in Salzburg und Lamprechtshausen! Möbel für alle Wohnbereiche auf über 3000 m². ... Haben Sie Lust in unseren aktuellen Prospekten zu blättern? Kein Problem. mehr lesen Onlineshop Möbel
moebi.at Moebi Wohnen Wohnideen Abholmarkt
248 Home IDEEN AUS Ideen

Ideen aus Holz Klaus Schallmeiner Ihr Tischler im Bezirk Gmunden. Möbel Stiegen ... und Möbel. INDIVIDUALITÄT Holz ist schon allein durch die Natur individuell. Kein Teil gleicht vollständig
ideenausholz.at Ideen Aus Holu Klaus Schallmeiner;Tischler Tischlerei
249 Startseite urbanek

Möbel für Dein Zuhause! Rund um Wohnen und Einrichten viele inspirierende Wohnideen. ... Verband. Die GARANT-MÖBEL-GRUPPE schafft ein enorm großes Einkaufsvolumen und damit Preisvorteile
moebel-urbanek.at Urbanek Urbanekmöbel Möbel Urbanek Moebel
250 Schnaeppchenhalle Möbel und Gartenmöbel Gartenmöbel

Im Lagerverkauf der Schnaeppchenhalle ist jeden Tag SALE! Moebel Restposten Konkurswaren und Gartenmoebel
xn--mbel-outlet-zentrum-q6b.at Gartenmöbel Billig Abverkauf Sienagarden
251 Startseite Hofmobiliendepot | Möbelmuseum
1070
Wien
Das Hofmobiliendepot. Möbel Museum Wien ist eine Rarität unter den Sehenswürdigkeiten Wiens und ein Geheimtipp: ... Hofmobiliendepot ? Möbel Museum Wien Öffnungszeiten Veranstaltungen im Hofmobiliendepot ? Möbel Museum Wien
hofmobiliendepot.at Möbelmuseum Biedermeier Möbeldepot Wiener Moderne
252 Tischleria /// Tischlermeister Jakober Holz
6133
Weerberg
Iht Tischlermeister in Tirol Holzmöbel nach Maß Designer Möbel Planung und Beratung ... Garderoben Kontakt Handwerksqualität auf höchstem Niveau ... Deine Vorteile! Persönliche Beratung Möbel
tischleria.at Holz Tischler Handarbeit Beratung
253 Meinkasten.at Möbel nach Heinz Stark GmbH Kasten
8502
Lannach
Möbel nach Maß. Made in Austria. Planen Sie Ihren Kasten nach Belieben und Bestellen Sie
meinkasten.at Kasten Küche Maßanfertigung Bestellen
254 Urlaubtipps für Ossiacher See Urlaub

Urlaubtipps Ossiachersee und Faakersee Einkauftipps Möbel und mehr.
bio-bauer.at Urlaub Ossiacher See Faaker See
255 HOME Antiquitäten
9220
Velden am Wörthersee
Antiquitäten Velden am Wörthersee Velden Geschenke Möbel Schmuck Skulpturen ... HOME STANDORT Postazione ANGEBOT Offerta MÖBEL Mobili SKULPTUREN Sculture BILDER Quadri
antiquitaeten-tsantilas.at Antiquitäten Antiques Renaissance Gotik
256 Premium Moebel

... Herzlich Willkommen bei Premium Möbel Ihr Partner für Exquisiten Möbelbau Restaurierungen
premiummoebel.at
257 Willkommen auf der Startseite Küche

Wir planen und fertigen für Sie: Möbel für den Wohnbereich Gaststätten Büros Haus ... und fertigen für Sie Möbel für den Wohnbereich Gaststätten Büros Haus- und Wohnungstüren. Außerdem verlegen
tischlerei-ecker.at Küche Wohnzimmer Esszimmer Schlafzimmer
258 Hutle Möbel | Tischlerei

Hutle Möbel | Tischlerei. Tischlerei mit Planungsbüro Werkstatt und Ausstellungshalle. Standord Dornbirn
hutle-moebel.at
259 Möbel vom Tischler

... Möbel vom Tischler - Paul Hanzlovic - Moosgasse - Zistersdorf - -
moebelvomtischler.at
260 :: trend:schrank | Günter trendschrank

trendschrank Möbel Koller
trendschrank.at Trendschrank Trendchrank.at Möbel Koller Moebel Koller Günter Koller
261 Start :: Bau und Tischlerwerkstätt
8010
Graz
Die Tischlerwerkstätte Vogl wird seit 60 Jahren nun in dritter Generation geführt. Unser Tätigkeitsbereich erstreckt ... bis hin zum Webshop für Möbel und Accesoires." Unsere Philosophie Der Kunde definiert durch seine Bedürfnisse
tischlereivogl.at Tischlerwerkstätte Ernst Vogl Renovierung
262 Rauscher Möbel Möbel


r-rauscher.at Möbel Wohnen Messen Dekor
263 Freund Naturholz Tischlerei Freund Naturholz Tischlerei GmbH & Co KG Freund
5771
Leogang
Nach dem Vorbild der Natur jedes unserer Möbel ist ein wertbeständiges Unikat. Fachmännische Meisterhände ... Nach dem Vorbild der Natur - jedes unserer Möbel ist ein wert-beständiges Unikat. Fachmännische Meisterhände
freund-naturholz.at Freund Tischlerei Möbelhandel Leogang
264 Rootpage Silz
6424
Silz
Strolz Tischlerei Silz Tirol Ihr Tischler Ing. Roman Strolz fertigt Ihre Möbel (Küche ... Tischlerei Strolz News Planung Referenzen Stellenangebote Ing. Roman Strolz Möbel
strolz-tischlerei.at Silz Tischlerei Silz Tischlerei Strolz Strolz Silz Tischlerei
265 Geschirr Gläser Mobiliar schokobrunnen
5020
Salzburg
Nonfood Catering Partyverleih Gläserverleih Salzburg Österreich Leihequipment Leihgeschirr Geschirrvermietung Mietgeschirr ... ... SpülmaschinenGeschirrspüler und Waschbecken MobiliarStühle - Tische - Lounge Möbel Hussen Mietwäsche Kaffeemaschinen
gastrostaff.at Schokobrunnen Champagnerbrunnen Partyverleihsalzburg Hussen Stehtischhussen Gläs
266 Paradis Küchen Paradis

Paradis Küchen möbel nach maß
paradiskuechen.at Paradis Paradis Paradisküchen Paradiskuechen Küchen
267 FOTOMOEBEL FotoMöbel

Möbel aus Österreich ... schnell fotographiert werden. Hier bedarf es vorab einer kompletten Montage. Einmal werden die Möbel
fotomoebel.at FotoMöbel Wohnmöbel Wohnzimmer Schränke
268 Baumkind Möbel aus Recyclingmaterialien

Möbel aus Recyclingmaterialien Möbelstücke aus Altpapier und Holz.. Sustainable Design aus Graz Upcycling
baumkind.at
269 Garten Möbel Home Mexiko 4 U, e.U. Mexiko
1070
Wien
Mexiko 4 U Wohn.der.Ware aus Mexiko! Wir wollen Ihnen unser geliebtes Mexiko näher bringen ... Fliesen Zubehör Geschirr Gläser Glaskrüge Lampen Möbel Holz Möbel Equipales Acapulco Sessel Stuhl
mexiko4u.at Mexiko Mexico Mex Mexiko 4
270 Alfred Dobnig Möbeldesign Alfred
8075
Hart bei Graz
Für Ihren individuellen Wohnstil bietet Ihnen Alfred Dobnig Möbeldesign handgefertigte Produkte und Möbel mit individuellem
alfred-dobnig-moebeldesign.at Alfred Dobnig Möbeldesign Handgefertigte Möbel Möbel
271 Tischlerei Karnische Massivmöbel Stuben Tischlerei

Ihr Profi für massive SchreinerQualität. Tischlerei Karnische Massiv Möbel Stuben Wohnzimmer Schlafzimmer Küchen Landhausküchen. ... massive Möbel Bei Stube Schlafzimmer Wohnzimmer Küche ist die Firma Karnische Massivmöbel GmbH
km-moebel.at Tischlerei Karnische Massivmöbel Stuben
272 MaasCenter Wien maas

Möbel | Haushaltswaren | Heimtextilen | Teppich ... ) + Wohnwand = Setpreis ?. Sitzgruppe ++ Sitzgruppe ++ ? MÖBEL
maas-center.at Maas Center Wien Möbel Sitzgruppen
273 Tischlerei Herbert Lorenz Möbel
8075
Hart bei Graz
Tischlerei Lorenz Möbel..Carports..Stiegen..Decken..
h-lorenz.at Möbel Stiegen Decken Carports
274 A E C Webverzeichnis

A E C LINKVERZEICHNIS ist ein redaktionell geführtes Verzeichnis mit Themen wie Kunst ... A E C - L I N K V E R Z E I C H N I S Surftipps Antiquitäten - Antike Möbel
aec-fallmann.at Webverzeichnis Linkverzeichnis Pagerank Linktausch Verzeichnisse Webkataloge Kun
275 Dekoverleih Wien/Österreich Deko

Verleih von Dekorationsartikeln wie z.B: Sesselhussen Kerzenständer Empfangsdekoration Geschirr Möbel ... Mein Konto Anmelden Möbel Vasen Geschirr Kerzenständer Empfangsdeko Dekomodelle Sesselhussen Säulen
dekoverleih.at Deko Dekor Dekoration Deko Wien Deko Österreich Deko
276 Möbelpolsterei Kneidinger aus Enns Möbel
4470
Enns
Möbelpolsterei Kneidinger in Enns bietet Leistungen im Bereich Möbel neu beziehen reparieren tapezieren ... Kneidinger in Enns bei Linz Wir polstern Ihr Möbel nach Ihren Wünschen auf und beziehen es neu
moebelpolsterei.at Möbel Neu Polstern Polstermöbel Tapezieren
277 WOHNEN nach MASS | Innenarchitektur

Ideen pro Quadratmeter Innenarchitektur und Handwerk | Interior Design Kantner Möbel und Innenausbau
wohnmass.at Innenarchitektur Wohnraumgestaltung Objektgestaltung Möbel Und
278 Heimat Gatto Möbel cms
1050
Wien
Content Management System ... Gatto Heimat . zur Möbel/Taschenaustellung . Online-Shop . Über Uns . Kontakt Gatto sagt hallo
gatto-moebel.at Cms Publish Ecommerce Content Management
279 Haider Möbel und Montagen
3300
Greinsfurth
... Startseite Firmenstruktur Projekte Partner Kontakt Haider Möbel Montagen HaiderMöbel Montagen
t-haider.at
280 DST möbel mobil |

... Sie werden gleich automatisch weitergeleitet zur Website von DST möbel mobil .
dst-moebel-mobil.at
281 Chesterfield leder sitzgarnitur sitzgarniur

Chesterfield möbel ... Ecksofa Schlafzimmer Möbel Stühlen Hocker Tisch Informationen Unsere AGB's ... Liefer- und Versandkosten
chesterfields.at Sitzgarniur Leder Sitzgarnitur Sofa Sessel
282 Lagerfäche.at Lagerflächen von Lagerfläche


lagerflaeche.at Lagerfläche Lagerflächen Lagerflaeche Lagerflaechen
283 LANDHAUSMÖBEL ACHAU Moebel

landhausmoebel achau moebel und accessoires rund ums wohnen
interantik.at Moebel Landhaus Achau Accessoires
284 Werkzeug zum Erfolg Gewerbe

Gradauer GmbH Lösungen für Sie: Im Werkzeug Formen und Maschinenbau in der ... - Formen- und Maschinenbau in der Möbel- Fenster- Türen und Küchenherstellung Papier- und Sägeindustrie
gradauer.at Gewerbe Industrie Metall Holz
285 MOEBEL KOLONIE Kolonialmöbel

... ... Sie werden weitergeleitet auf die Hauptseite der MOEBEL KOLONIE ... Alle Möbel Accessoires
moebelkolonie.at
286 Designerin ? ein Traumberuf? Designerin

Der Beruf der Designerin oder des Designers gilt für viele Menschen als Traumberuf kann ... verantwortlich Fotografien Filme und Webseiten aber auch Bekleidung Möbel Automobile Werkzeuge Schmuck
designerin.at Designerin Designer Design Gestalter
287 Möbel und Skulpturen |

... Direkt zum Inhalt Möbel Skulptur Projekte Kurt Foit News Links Kontakt
kurtfoit.at
288 Willkommen FZMoebel Moebel

Totalabverkauf von Möbel
fz-moebel.at Moebel Möbel Stuhl Stühle Tisch Kommoden Vitrinen Anrichten
289 Hybridmöbel online
3393
Matzleinsdorf
viole sind Hybridmöbel aus Stoff die bunt und individuelle gestaltete werden können. ... was das Besondere an viole ist Wohnen ist viel mehr als das bloße Aufstellen verschiedener Möbel
viole.at Online Möbel Onlinemöbel Möbel Online
290 Willkommen bei Möbel Manzl

... Willkommen bei Möbel Manzl Über Uns Seit der Firmengründung bietet Möbel Manzl eine perfekte
moebel-manzl.at
291 Kunsthandel Antiquitäten Rudolf Mahringer Kunsthandel

Kunsthandel Antiquitäten Mahringer Wien. Möbel Gemälde Skulpturen und Kunstgewerbe aus allen ... HOME NEWS MÖBEL GEMÄLDE KLEINKUNST SKULPTUREN VERKAUFS- U. SCHAURÄUME MESSEN KONTAKT english LEA
kunsthandel-mahringer.at Kunsthandel Antiquitäten Wien Österreich
292 Auflagen.at Stuhl

auflagen.at ... auflagen Please contact us for more information. Search the Web Stuhl Moebel Tisch Chairs
auflagen.at Stuhl Moebel Tisch Chairs
293 GRIESSENBERGER Kultur in Möbel

Kultur in Holz getreu dieser Firmenphilosophie wird jedes Möbel von Hand gefertigt...
griessenberger.at Möbel Design Designmöbel Tischlerei
294 Möbelservice Pfister Ihr moebel

Möbelservice aus Meisterhand Planung Ihrer Einrichtung fachgerechte und rasche Montage Ihrer Moebel ... Fachgerechte und rasche Montage Ihrer Möbel Bei mir erhältlich Garagentore · Dienstleistungen Zustellung
moebelservice.at Moebel Möbel Tischler Schreiner
295 Antiquitäten Figl Home Antiquitäten
1010
Wien
Familie Figl betreibt in dritter Generation den Antiquitätenhandel auf 3000 m² im Denkmalgeschützten Meierhof Plankenberg ... Sie in Ihrem Browser JavaScript aktivieren.> Home Plankenberg Wien Möbel Objekte Ankauf Ausstellung Vergangene
antikhof-figl.at Antiquitäten Handel Altwaren Verlassenschaften
296 Innenarchitekt für wohnen Innenarchitekt

Ideenpavillon ist der Innenarchitekt für alles rund ums Wohnen und Leben. Wir gestalten Büros
ideenpavillon.at Innenarchitekt Innenarchitektur Innenarchitekt Für Villen
297 Helmmoebel.at Informationen zum

helmmoebel.at ist Ihre erste und beste Informationsquelle über helmmoebel Hier finden Sie auch weitere
helm-moebel.at
298 Holzmöbel.at Informationen zum

holzmöbel.at ist Ihre erste und beste Informationsquelle über Möbel Hier finden Sie auch weitere
ww1.xn--holzmbel-r4a.at
299 Moebelshop.at Informationen zum

moebelshop.at ist Ihre erste und beste Informationsquelle über Möbel Hier finden Sie auch weitere
moebelshop.at
300 Wohnzimmermöbel.at Informationen zum

wohnzimmermöbel.at ist Ihre erste und beste Informationsquelle über Möbel Hier finden Sie auch weitere
ww1.xn--wohnzimmermbel-5pb.at
301 QUINTESSENCE Interior Design quintessence

quintessence interior design wien einrichtungsfachhandel quintessence interior design wien einrichtungsfachhandel geschmack schön tapeten einrichtung lampen ... CONSTRUCTION Ground Floor Britannia Rd. London PLANUNG DESIGN AUSFÜHRUNG SHOP BERATUNG STOFFE TAPETEN MÖBEL
quintessence.co.at Quintessence Interior Design Wien Einrichtungsfachhandel Geschmack Schön Tapeten
302 Tischlerei Johann Hengsberger
8543
St. Martin i.S.
Wir schaffen Möbel fürs Leben ... Startseite Betrieb Bereiche Besonderheiten Bildergalerie Kontakt Wir schaffen Möbel fürs Leben
tischlerei-hengsberger.at
303 Hauser möbel design

... Die Firma Hauser-Möbel-Design wurde gegründet. Das Ziel war schon damals hochwertige Möbel
hauserdesign.at
304 Szapacs Design

... =>> Hier geht es zu den Seiten von Szapacs - Design - Möbel =>> Gerhard Szapacs Schulstraße
s-d-m.at
305 EVA Energetisch Veredelte Zirbe
5452
Pfarrwerfen
Energetisch Veredelte Artikel Energetisch Verarbeitetes Arvenholz Energetische Möbel Energetische Arbeit
eva-shop.at Zirbe Zirbenholz Möbel Zirbenmöbel
306 Schlafwelt24.at Informationen zum

schlafwelt24.at ist Ihre erste und beste Informationsquelle über Moebel Möbel Einrichtung home Sessel Sofa ... schlafwelt.at Weitere Links Der Inhaber dieser Domain parkt diese beim Domain-Parking-Programm
schlafwelt24.at
307 Wohnexperte24.at Informationen zum

wohnexperte24.at ist Ihre erste und beste Informationsquelle über Moebel Möbel Einrichtung home Sessel Sofa ... Domain erwerben Sie können die Domain wohnexperte.at kaufen! wohnexperte.at Weitere Links
wohnexperte24.at
308 Antik Möbel Markt (Gerhard

... Antik Möbel Markt Gerhard Mayrhofer Oberwolfern Wolfern + +
antikmoebelmarkt.at
309 Möbel Innenausbau

... Möbel Mitter - design and more Wohnung - Einrichtung Bambus Stühle Barhocker
moebel.co.at
310 Möbel und Accessoires /

... Die Liste der Produkte von A bis Z Möbel Mitter Übersicht alphabetisch geordnet Accessoires
xn--mbel-5qa.or.at
311 Holzmedia_Möbel und Medientechnik_© 2005 Holzmedia

Holzmedia verbindet Möbel und Medientechnik. Zwei Komponenten die zusammen in der Synergie ganz neue ... Holzmedia verbindet Möbel und Medientechnik. Zwei Komponenten die zusammen in der Synergie ganz
holzmedia.at Holzmedia Holzmedia GmbH Manuel Holz
312 Startseite

Altmoebel.at die Lösung für die Möbel ... Startseite Auspolsterung Moderne Möbel Antike und alte Möbel Tischler Werke Küchenmöbel Büromöbel
altmoebel.at
313 Steiner Möbel | Kindergarten Steiner Möbel GmbH
4644
Scharnstein
... Workshop Raumgestaltung "Angelika von der Beek" ... Steiner Möbel GmbH Badstraße Scharnstein tel
steiner-moebel.at
314 Dirnbauer Möbel /

... und Partner Referenzen Dirnbauer GmbH Möbel und Design seit Studenzen Steiermark T + (
dirnbauermoebel.at
315 Chicantiques vintage möbel

... chicantiques vintage living möbel accessoires zur freude was bieten wir? gelebtes
chicantiques.at
316 Dirnbauer Möbel /

... und Partner Referenzen Dirnbauer GmbH Möbel und Design seit Studenzen Steiermark T + (
studiof.at
317 Modul Möbel: Home

... Bildergalerie Anfrage Kontakt Bereit für Veränderungen Modul Möbel Wolfschwenger .-Oktober-
modul-moebel.at
318 Rauchenzauner Möbel GmbH Rauchenzauner Möbel GmbH
4890
Frankenmarkt
... Rauchenzauner Möbel GmbH Mühlberg Frankenmarkt Austria officerauchenzauner
rauchenzauner.at
319 Bambusshop 24 bambus
1100
Wien
Möbel Dekoration und Accessoires aus Bambus und Rattan. Riesige Auswahl im Online Shop. Exklusive ... bei Bambusshop.at Wohnaccessories Gartenaccessories Schutzanstrich Stein im Garten Mehr
bambusshop24.at Bambus Shop Onlineshop Möbel
320 Tischlerei Zeibich Home tischler
1160
Wien
Die Tischlerei Zeibich GmbH ist ein moderner Produktionsbetrieb für Möbel Ladenbau und Messebau. CAD ... zählen wir zu den führenden österreichischen Produzenten im Möbel- Laden- und Messebau
zeibich.at Tischler Wien Burgenland Neutal
321 Stilwerkstatt Tischlerei Leberbauer Restauration

Stilwerkstatt Alte Möbel neu entdecken | Tischlerei Leberbauer
stilwerkstatt.at Restauration Ergänzungen Neuanfertigungen Schellack
322 BiogasTraktor Leberbauer David Restauration

Stilwerkstatt Alte Möbel neu entdecken | Tischlerei Leberbauer
biogastraktor.at Restauration Ergänzungen Neuanfertigungen Schellack
323 Bau und MöbelTischlerei Mühlbacher Eckbank

Bau und Möbeltischlerei Mühlbacher OEG in Weyregg am Attersee ist Ihr Ansprechpartner für maßgefertigte Möbelstücke
tischlerei-muehlbacher.at Eckbank Kasten Türen Fenster
324 KSart.at Metallkunst Metalldesign KSart
3051
St. Christophen
Auf unserer Homepage sehen Sie einen Querschnitt unserer Produkte. Wir fertigen unter anderem Möbel ... darf. Ich fertige unter anderem Möbel Brunnen Feuerstellen Skulpturen Trophäen Pokale Tore
ksart.at KSart Metallkunst Metalldesign Wienerwald Kinastberger Metal Art Kunsthandwerk
325 ULRICH sitzen.schlafen.wohnen Hüsler Hüsler

Seit 1989 fertigen wir in unserer eigenen Holzwerkstatt formschöne schlichte Möbel aus dem Urmaterial ... Unternehmen Team Kontakt T + www.dasbett Startseite Möbel Schlafen Sitzen Aktuelles
das-bett.at Hüsler Nest Möbel Ulrich Viktor Ulrich
326 LAMA MOEBEL | Holzmanufaktur

... LAMA MOEBEL Holzmanufaktur MARTIN LACKNER Schwarzensee A- Neuhaus tel +
lamamoebel.at
327 Möbel Garschall Home

... Rutsch ins Neue Jahr! design by joomladress About joomladress Möbel Garschall Joomla! is
moebel-garschall.at
328 Ambiente Romana Dürner accessories

Hochwertige Stoffe für Möbel Vorhänge und Dekoration sowie Polstermöbel Kleinmöbel und Accessories.
duerner.at Accessories Ambiente Duerner Dürner
329 TISCHLERARBEITEN UND MÖBEL AUS

... wirtschaftlich sein müssen. Fenster Fussböden Treppen TISCHLERARBEITEN UND MÖBEL AUS MEISTERHAND HERZLICH
ihr-tischler.at
330 Möbel für Terrasse und Teakmöbel

Gartenmöbel aus Dänemark sind bekannt für edles Design und Witterungbeständigkeit teakgartenmoebel ... zu teakgartenmoebel Möbel für Terrasse und Garten Infos zu teakgartenmoebel Teakmöbel Gartenmöbel aus Dänemark
gartenmoebel-onlineshop.at Teakmöbel Terrasse Gartenstuhl Gartentisch
331 BOTZ // AGENTUR FÜR LICHT UND MÖBEL
1080
Wien
... botzagentur für licht und möbel Ihr Browser kann leider
botz.at
332 CASA Möbel mehr

... Bettenkollektion bei CASA Coole Möbel für alle Anlässe freistil Kollektion bei CASA HAY - About A Lounge Chair CASA
casamoebel.at
333 Bueromoebel.at Informationen zum

bueromoebel.at ist Ihre erste und beste Informationsquelle über bueromoebel Hier finden Sie auch weitere
buero-moebel.at
334 Gebrauchtemoebel.at Informationen zum

gebrauchtemoebel.at ist Ihre erste und beste Informationsquelle über gebrauchtemoebel Hier finden Sie auch weitere
gebrauchte-moebel.at
335 Sitzmoebel.at Informationen zum

sitzmoebel.at ist Ihre erste und beste Informationsquelle über sitzmoebel Hier finden Sie auch weitere
sitz-moebel.at
336 Massivmöbel.at Informationen zum

massivmöbel.at ist Ihre erste und beste Informationsquelle über massivmöbel Hier finden Sie auch weitere
xn--massiv-mbel-yfb.at
337 Designermöbel.at Informationen zum

designermöbel.at ist Ihre erste und beste Informationsquelle über Design möbel Hier finden Sie auch
xn--designer-mbel-rmb.at
338 Euromontage.at Herzlich willkommen Euromontage

Euromontage Herbert Battlogg Fachkundige Möbel u. KüchenMontage Herstellung u. Montage von Treppengeländer
euromontage.at Euromontage Herbert Battlogg Fachkundige Möbel U. KüchenMontage Herstellung
339 Up.ART.ig by ma|ma GmbH up.ART.ig

up.ART.ig by ma|ma GmbH Das virtuelle Kunstressort Möbel Wandskulpturen Skulpturen
upartig.at Up.ART.ig Upartig Kunstressort Möbel
340 Hotelmöbelgruppe Home | Hotel
6300
Wörgl
Hotel Möbel HMG Hotelmöbelgruppe Hotelzimmer Hoteleinrichtung Hotelmöbelgruppe Die Objekt Hoteleinrichter in Tirol
hotelmoebelgruppe.at Hotel Möbel HMG Hotelmöbelgruppe Hotelzimmer Hoteleinrichtung
341 Ferrocom Möbel in Biedermannsdorf

... Sonderangebote Messetermine Bezugstoffe Downloads Anfahrt Kontakt Herzlich willkommen bei Ferrocom - Möbel! Seit
ferrocom.at
342 Holzmugl Möbel und Holzmöbel
8605
Pogier
Wir bauen ganz eigene Möbelstücke als Unikate aus Holz für wertorientierte Kunden. ... Sie sich ein neues Lebensgefühl dank hochwertiger Echtholzmöbel. Individuelle und maßgefertigte Möbel- bzw
holzmugl.at Holzmöbel Möbelstücke Wunschmöbel Individuelle Kunststücke
343 Clemens moshammer | raum+möbel

clemens moshammer | ingenieur für möbeldisigntischlermeister | wir beraten sie gerne unverbindlich und planen auf ... führen wir u. a. küchen möbel und accessoires folgender marken next küchen next line küchen
raumplusmoebel.at
344 Home flowolf Montage
6552
Tobadill
... meine vielfalt - ihr vorteil Home Über Florian Wolf Hausmeister Möbel Montage Kontakt Partner
flowolf.at
345 Home ocean wood

... ocean wood ? möbel aus booten home shop alle produkte tische und sessel wohnmöbel boot kollektion
oceanwood.at
346 Dagmar Fezzi |Innenarchitektur Dagmar
8010
Graz
Innenarchitektur Inneneinrichtung Raumgestaltung Büromöbel Objekteinrichtungen Einrichtungskonzepte Wohnideen Innenausbau DesignMöbel Planungsbüro MöbelDesign Einrichtungen Raumausstattung Raumplanung Wohnidee
dagmarfezzi.at Dagmar Fezzi Ist Ihr Partner In Sachen Wohnen
347 Designleuchten Designmöbel schöner wohnen beluga
9020
Klagenfurt
Design Leuchten Kartell Möbel TimeoutGraf Shop Graf Licht Kartell Möbel
i-punkt.at Beluga Cubetto Designlampen Designmoebel
348 Gastronomie Möbel / Möbel

... Gastronomie Möbel Möbel für die Gastronomie Möbel für die Gastronomie bzw. Gastronomiemöbel
gastronomie-moebel.at
349 Design Sottsass Colombo Mendini Design

italienisches Design Möbel Glas Keramik Lampen und Objekte Stücke von: ... ." Diese Seite informiert vor allem über die Klassiker des italienischen Designs Möbel
designklassiker.at Design Möbel Verkauf Shop
350 Home
6444
Längenfeld
Fenster und Möbel nach Maß ... MÖBEL UND FENSTER NACH MASS Willkommen in der Fachwerkstätte für Massarbeit und exklusiven Innenausbau
industrieinfo.at
351 Wohnkram Salzburg Gnigl
5023
Salzburg Gnigl
... Geöffnet ist jeden Dienstag und Freitag von . bis . Uhr. wohnkram Salzburg - Gnigl Möbel
wohnkram.at
352 Antike Fundgrube Antikstube: Antik Antik

Die Website der Antiken Fundgrube in Gronau. Hier finden Sie Antiquitäten aller Art. Ob Antike
antikstube.at Antik Antikmöbel Packmor Antike Fundgrube
353 Bauund Möbeltischler Klaudius Tischler

Bau und Möbeltischler in der 3. Generation Spezialist für Hotelerie und Gastgewerbe Design und
klaudius.at Tischler Tischlermeister Schreiner Schreinereibetieb Möbel Einrichtung Spezialmö
354 Walli Gartenmöbel Pavillon Garten Gartenmöbel
2832
Thernberg NÖ
Walli natürlich Holz Gartenmöbel Wohn und Freizeitmöbel für Haus und Garten
walli.co.at Gartenmöbel Walli Holz Möbel
355 Möbel Infos Einrichtungsgegenstände

... Möbel Infos Informationen zum schöneren Wohnen Möbel Infos Einrichtungsgegenstände können mehr
moebel-infos.at
356 Farbenfachmarkt Hinterholzer Farben Farbenfachmarkt

Farbenfachmarkt Hinterholzer Farben Lacke Innenbereich Aussenbereich Holzveredelung Wohnraum Möbel Holzbodenversiegelung Silikat Wohnraumfarben Feuchtigkeit
farben-hinterholzer.at Farbenfachmarkt Hinterholzer Farben Lacke
357 FlügelPianotransporte Startseite Piano

Transporte von Klavier Pianos Möbel Trsoren Flügel usw.
pianotransporte.at Piano Pianino Flügel Stutzflügel Konzertflügel Cembolo EPiano Möbel
358 Tischlerei Gansger tischlereigansger
5440
Golling
Nach eigenen Wünschen gestaltete Möbel spiegeln die Persönlichkeit des Nutzers wieder und sind genauso unverwechselbar ... gestaltete Möbel spiegeln die Persönlichkeit des Nutzers wieder und sind genauso unverwechselbar
tischlerei-gansger.at Tischlereigansger Tischlereigansger.at Tischler Gansger Günther
359 Möbel Pienz | Wir

... Kindermöbelprogramm Fenster Türen Referenzen Galerie Anfahrt Lage Kontakt Möbel Pienz Wir geben Ihren Visionen
meistertischler-pienz.at
360 Stefanik GmbH Stefanik

Stefanik Bau und Möbeltischlerei ... Neuverlegung Möbel Montage Demontage Reparatur Einzelanfertigung
stefanik.at Stefanik Tischlerei Bau Möbel
361 Schrotttec Spatz

Spatz Reindesign Schrotty Trash Möbel Design Tonne Aliens Furniture
spatz-reindesign.at Spatz Reindesign Schrotty Trash Möbel
362 Tischlerei Mayerhofer Holz

Bau und Möbeltischlerei. Handgefertigte Möbel kreativ und kompetent nach Ihren Wünschen umgesetzt.
tischlerei-mayerhofer.at Holz Möbeltischler Möbeltischlerei Josef MAYERHOFER Bautischler Bautischlerei Mö
363 Www.reichelwohndesign.at Wohndesign

Reichel Wohndesign ... Hauptmenü Startseite Unternehmen Produkte Möbel Referenzen Anfragen Kontakt News Neuheiten Login
reichel-wohndesign.at Wohndesign Reichel Raumkonzept Möbel
364 Holzwerkstatt Sarleinsbach GmbH Bad

hochwertige Möbel Planung und Bau individueller Inneneinrichtung Wohnzimmer Küche Schlafzimmer
holzwerkstatt.at Bad Büro Esszimmer Jugendzimmer
365 Tischlerei Kalhamer Tischlerei Kalham

Website der Tischlerei Kalhamer Mattsee Spezialist in der Herstellung von Fenstern und Türen sowie diverser
kalhamer.at Tischlerei Kalhamer Mattsee Türen Fenster Möbel Holz HolzAlu Alu
366 AW Pfeffer Herzlich A&W Pfeffer GmbH Bibliothekseinric
2371
Hinterbrühl
Die AW Pfeffer GmbH bietet Ihnen Möbel für Ihre Büroeinrichtung sowie ergonomische Sitzmöbel für Ihre
awpfeffer.at Bibliothekseinrichtung Nichtraucherschutz Büroeinrichtung Heizsysteme
367 Tischlerei Krumphuber Unternehmen Krumphuber

Die Tischlerei Krumphuber fertigt seit 1997 Inneneinrichtungen und Einzelmöbel nach Maß an. Individuell und funktionell gleichermaßen. ... die Gestaltung unserer Möbel den persönlichen Stil des Kunden unterstreicht. Um auf die verschiedensten
krumphuber.at Krumphuber Johann Tischlerei Tischler Grossendorf
368 Jugendstil Art Deco Jugendstil

 Jugendstil Art Deco | Amstetten. Erstklassig restaurierte Möbel und Lampen von 1900 bis 1930.
jugendstil-artdeco.at Jugendstil Art Deco Jugendstil Art Deco
369 Tischlerei Murauer Möbeltischlerei Tischlerei

Wir fertigen nicht nur hochwertige und einzigartige Möbel an sondern sorgen für die komplette
tischler-murauer.at Tischlerei Tischlereien Möbel Wohnraum
370 Gastronomiemöbel Gastromöbel Polsterbank

Wir bieten Gastronomieeinrichtung Polsterbank Stehtisch Holztisch Gastronomie Bank Gastronomie Möbel ... willkommen bei -GASTRO Ihrem Gastronomie Möbel Shop. Polsterstühle Holzstühle Finden
bankett-outdoor-moebel.at Polsterbank Polsterbank Günstig Kaufen Gastronomie Möbel
371 Möbel polt – Einrichtungshaus

... Unternehmensgeschichte Tischlerei Kontakt Kontakt Anfahrt Ansprechpartner Einrichtungshaus Tischlerei möbel
moebelpolt.at
372 Lesky : Tischler Graz Tischler
8042
Graz
Die Lesky Stiegen Wohnwerkstatt ist Ihre innovative Tischlerei Graz Voitsberg und baut auch
lesky.at Tischler Graz Voitsberg Möbel Stiegen
373 Antiquitaeten Moebel antiquitaeten

Kunsthandel Antiquitäten Möbel aller Stilepochen antike Kachelöfen Bilder Lampen
antiquitaeten-kral.at Antiquitaeten Antik Antiquitaeten Mobel
374 Bauernsessel Bauernstühle
6070
Ampass
... Bauernvitrinen VERSCHIEDENE MÖBEL HISTORISCHE BAUSTOFFE bemalte Bauernmöbel Schützenscheiben Geschäftsbedingungen
rustikal.at
375 Umzug Wien Umzüege umzugsunternehmen

umzug umzug nach umzugshilfe internationaler umzug kosten umzug möbel umzug ... . Möbel n die passenden Verpackung smaterialien. Das Müll das beim Umziehen auftaucht ist leider
umzug4you.at Umzugsunternehmen Umzugshilfe Umzug Umziehen

Möbel Genève Nous Déménagement Bewertung:

Die Öffnungszeiten können zu Feiertagen Pfingsten, Fronleichnam, Reformationstag und Allerheiligen abweichen.
Ergebnisse der Auswertung: 76 Bewertungen ergeben 3 StadtBranche Punkte

Neuer Eintrag 

Die Begriffe Möbel und Mobiliar bezeichnen Einrichtungsgegenstände vorwiegend in Innenräumen wie Wohnungen, Geschäften, Büroräumen oder anderen Nutzungseinheiten, sowie im Außenbereich . Der Begriff steht somit im Gegensatz zu unbeweglichen Dingen , die mit dem Boden oder baulichen Anlagen fest verbunden bzw. verwachsen sind. Möbel Öffnungszeit und Erfahrungen

△ nach oben kostenfreier Eintrag Datenschutz