Österreich › Ort

Hall › Steiermark › Österreich › 8911 Erfahrungen

Branchenbuch Hall

8911 Steiermark

Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 Goldstube Hallein Juwelier

Goldstube Hallein ihr Spezialist für Gold Silber Schmuck Münzen Uhren Altgold Bruchgold Zahngold Silberbesteck Orden Abzeichen Medaillen Goldmünzen Silbermünzen Goldbarren..
goldstube-hallein.at Daten Google Art Website Hallein Informationen Verarbeitung Rahmen Waren Diese Unternehmer Recht Ihren Interessen Abs
2 Goldstube Hallein Juwelier

Goldstube Hallein ihr Spezialist für Gold Silber Schmuck Münzen Uhren Altgold Bruchgold Zahngold Silberbesteck Orden Abzeichen Medaillen Goldmünzen Silbermünzen Goldbarren..
goldstube-hallein.at Daten Google Art Website Hallein Informationen Verarbeitung Rahmen Waren Diese Unternehmer Recht Ihren Interessen Abs

Der Spezialist für die Verarbeitung von thermoplastischen und duroplastischen Kunststoffen heißt MERTL Kunststoffe GmbH und hat seinen Sitz in Hallein..
duroplastix.com/ Kunststoffe Gmb Duroplaste Produkte Bindemittel Trägermaterial Mertl Kontakt Fertigteile Halbzeuge Kunststoffen Werkstoff Hallein Unsere Premium
4 Kessler Coaching c o Coaching

Affoltern am Albis
Ich begleite Dich mit einem strukturierten Prozess in deinem Anliegen. Ich unterstütze Dich dabei, Deine Lösung zu finden, die Du..
kesslercoaching.ch/ Bold Regular Italic Roboto Cormorant Garamond Montserrat Sans Open Barlow Poppins Caudex Light Play Noticia
5 Wifzack Social Media Marketing Werbeagentur

Wir sind wiff. Wir sind auf Zack. Wir sind Wifzack Marketing. Ein kleines, aber feines Team aus Marketing- und Kommunikationsprofis, das..
wifzack.com Roboto Marketing Media Social Wifzack Mystery Videoclip Hotel Website Bold Communication Design Betreuung Kampagne Neue
6 bFlow Webdesign & Online Webdesign Online

Hall in Tirol
bFlow ist der Ansprechpartner rund um Ihren Online Auftritt aus Hall in Tirol. Wir haben zahlreiche Erfahrungen und Expertise im..
bflow.at/ Webdesign Online Marketing Ihr Tirol Kunden Auswahl Cookie Demo Player Professionelles Sekunde Website Sekunden Hilfe
7 Immobilienmakler Schweiz - Real Immobilienmakler

Hilfe beim Kauf, Verkauf und Vermietung von Immobilien. Generierung von Immobilienleads für Immobilienmakler. Finden & Vergleichen Sie Immobilienmakler in der..
immobilienmakler-switzerland.ch Enim Duis Question Aenean Home Sekunde Player Sekunden We Up Me Pricing Features Conversi Immobilienmakler
8 Graf E-Com Solutions Werbeagentur

Konzeption und Umsetzung von Online Marketing- und Verkaufsmassnahmen sowie Handel von Produkten aller Art. Unsere Services: * B2B Marketing - Business-to-Business 1. Google..
seoagentur-zuerich.ch Sansfont Marketing Sansline Google Optimization Agentur Zürich Media Social Online Sansmargin Ihr Optimierung Engine Search
9 Werbetext Werbung Marketing

Puch bei Hallein
Die Texte entsprechend Inhalt Image & Zielgruppe: Ich erstelle individuelle Texte für Print und SEO-gerecht für Web, für EPUs..
makaha.at Inhalt Texte Form Salzburg Wien Mascha Horngacher Individuelle Zielgruppe Portfolio Webtexte Korrektorat Lektorat Kontakt Kultur
10 Sensimilla Affoltern am Albis Detailhandel

Affoltern am Albis
Die Sensimilla Affoltern am Albis ist ein zwei Köpfiges Team, das im Jahre 2018 als Tochterfirma der Sensimilla Trading Gmbh..
11 Lasertag & Escape Rooms Ausflüge

Grösste Lasertag Anlage der Schweiz. 6 Escape Räume und mehr. Die Action Arena in Zürich...
actionworld.ch Actionworld Home Rooms Spass Action Lasertag Escape Golf Kontakt Gutscheine Zürich Adrenalin Geburtstag Polterabend Ausflug
12 Sensimilla Affoltern am Albis CBD Produkte

Affoltern am Albis
Die Sensimilla Affoltern am Albis ist ein zwei Köpfiges Team, das im Jahre 2018 als Tochterfirma der Sensimilla Trading Gmbh..
sensimilla-affoltern.com Sensimilla Affoltern Stecklinge Hanf Shop Produkte Albis Basel Cannabis Zürich Trading Tabakersatz Bern Lieferung Studien
13 Duroplaste - Mertl Kunststoffe Kunststoff

Mertl Kunststoffe ist Spezialist für Duroplaste. Das Unternehmen liefert Fertigteile, Halbzeuge und Zuschnitte aus duroplastischen Premium Kunststoffen...
duroplastix.com/ Kunststoffe Gmb Duroplaste Produkte Mertl Bindemittel Trägermaterial Hallein Kunststoffen Halbzeuge Kontakt Hartpapier Fertigteile Werkstoff Unternehmen
14 kosmetik laser nagelpilz behandeln Fusspflege Kosmetik

Hallau Fusspflege Kosmetik laser nagelpilz behandeln Praxis für med. Fusspflege ärztlich geprüft Hausbesuche für ältere Menschen und in Altersheimen Klettgau Wilchingen..
el-beauty.ch Behandlungen Fusspflege Dermo Med Kosmetik Kosmetikstudio Peeling Beauty Gesicht Preise Fuss Mailadresse Menü Technologie Forschung
15 MindSpirit Hypnosetherapie & Mental Coaching Hypnose

WIRKSAME VERÄNDERUNG MIT EFFIZIENTEN METHODEN Erfolgreiches und nachhaltiges Coaching oder Therapie muss nicht lange dauern. Mit MindSpirit Hypnosetherapie und Mental Coaching..
mindspirit.ch Hypnosetherapie Coaching Mindspirit Mental Mich Termin Teilen Kosten Hypnorelax Kostenlosen Lange Effizienten Info[at]mindspiritch | Wirksame
16 Bücheler Werbegeschenke AG Werbeartikel

Bücheler AG - Der Werbeartikel-Spezialist mit Werbeartikeln aller Art Streuartikel, edle Werbepräsente, Kundengeschenke, Give aways, Werbeartikel für Messen und Ausstellungen Ihre..
buecheler.ch Werbeartikel Bücheler Profi Werbegeschenke Etui Streuartikel Give Farben Kunststoff Sonnenbrille Flop Trinkflasche Tasse Wwwpromotrendsch Werbeartikelprofi Kundengeschenk Ipad Hülle Werbe
17 Loogo Umzüge Österreich Umzüge

Mit LOOGO sparen Sie Zeit und Nerven. Überlassen Sie Ihren Umzug den Profis von LOOGO! Profitieren Sie von unserer Organisation und..
loogo.at Umzug Möbel Kartons Möbelküche * + Umzugsunternehmen Privatumzug Angebot Firmenumzug Verpackungsmaterial * Umzüge Loogo Kartons * Lkw * Internationaler Neumöbel Abholung Karton Rechner Demokratischevolksrepublikkorearepublikkroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmauretanienmauritiusmazedonienmexikomikronesienmoldawienmonacomongoleimontenegromosambikmyanmarnamibianaurunepalneuseelandnicaraguaniederlandenigernigerianiuenorwegenösterreichomanosttimorpakistanpalästinensischeautonomiegebie
18 Tourismusverband Region Hall-Wattens Tourismusverband

Hall in Tirol
Verbringen Sie Ihren Urlaub in Tirol in Österreich und genießen Sie zahlreiche Aktivitäten auf den Bergen, in der Natur und..
hall-wattens.at/ Hall Region Swarovski Haller Winter Urlaub Geschichte Tirol Wattens Sommer Unterkünfte Wandern Essen Nordic Sehenswürdigkeiten Incentive Angebote Kulinarik Sport Events Filmteams Klumperspaß Wellness
19 Piercingkurs.ch | Der Nr. Piercing Schule

Affoltern a.A
Piercingkurs.ch | Unsere Wochenendseminare vermitteln Dir alle nötigen Kenntnisse, um erfolgreich den Einstieg in die Welt des Piercings zu schaffen...
piercingkurs.ch Piercing Piercingkursch Workshop Kurs – Einsteiger Nr Dir Piercens Daten äusserst Praktikumsplätze Vorkenntnisse Schweiz Begehrten Y
20 professionelle Katzen&Hundepflege Steyr-Land Hundesalon

Bad Hall
Wir sind ein Familienunternehmen seit 1998 und bieten professionelle Katzen & Hundepflege an. Ob nach dem FCI Standard oder ganz nach..
profihundesalon.at Hundesalon Hall Ausbildung Hundesalonhuemer@gmxat Hundepflege Steyr Friends Kommt Huemer Leistungen Preise Hundefriseur Doch Shop Fotos Beiunseren Viel
21 Fachhochschule FH Salzburg Fachhochschule

Die Fachhochschule Salzburg bietet ein fundiertes FH Bachelor und Master Studium in den Studiengängen Informationstechnik, Multimediatechnology, Bildverarbeitung, Gesundheits- und Krankenpflege..
fh-salzburg.ac.at/ Salzburg Fh Management Smart Multimediaart Design Bewerbung Innovation Betriebswirtschaft Hebammen Master Fachhochschule Multimediatechnology Slider Partner System Kmu Gf Social Profit Sektor
22 IfM – Institut für Ausbildungsinstitute

Berufsbegleitend studieren und lebenslang von Management-Kompetenzen profitieren: Das IfM – Institut für Management mit Sitz in Salzburg bietet als renommierte..
ifm.ac/ Management Ifm Programm Finanzierung Mba Veranstaltungsort Inhouse Bachelor Consulting Kosten Fakten Vorteile Salzburg Institut Bildung Kompetenzen Kurse Bildungsangebote Portfolio Berufsbegleitend
23 Tourismusverband Region Hall-Wattens Tourismus

Hall in Tirol
Verbringen Sie Ihren Urlaub in Tirol in Österreich und genießen Sie zahlreiche Aktivitäten auf den Bergen, in der Natur und..
hall-wattens.at/ Hall Region Tirol Swarovski Sommer Geschichte Urlaub Haller Wandern Unterkünfte Wattens Nordic Museum Wallfahrten Kristallwelten Sport Events Walking Incentive Angebote Veranstaltungsräume Laufen
24 Loogo Umzug Umzug Umzüge

Jeder Umzug wird von uns mit höchster Priorität und Wichtigkeit behandelt und mit Freundlichkeit, Professionalität und vor allem kundenorientiert zum..
loogo.at Salzburg Umzug Umzugs Loogo Lagerung Mail Kontaktieren Eu Transport Kalkulator Firmenumzug Besichtigungstermin Kunden Kostenlosen Storage Self Entrümpelung
25 Hundesalon Huemer Hundesalon

Bad Hall
Ihr Vierbeiner kommt in erfahrene, geduldige Hände und wird individuell nach Ihren Vorstellungen oder nach dem FCI Standard geschnitten und..
profihundesalon.at Hundesalon Folgen Gepflegt Friends Hundepflege Hände Scheren Unterwolle Schneiden Beim Webnode Bringservice Neueröffnung Baden Preis Standard Schere Handtrimmen Border Gewinnspielenmitzumachen
26 Naturheilpraxis Heilpraktiker

Bad Reichenhall
Praxis für Naturheilkunde, Heilpraktiker, Chiropraktik, Akupunktur, Thymus-THX, Schmerztherapie, LWS, BWS, Migraine, Rückenschmerzen, Allergie, Stoffwechsel..
pantenburg.org Schule Leverkusende Wwwheilpraktikery
27 Gold Nagel Nails Nagelstudio

Neueröffnung! 12 Jahre Erfahrung! Fingernägel professionell und preiswert! Traumnägel voller Liebe und Eleganz. Ihre Hände sind Ihre Visitenkarte. Ich verhelfe Ihnen..
goldnagel.ch Foundguru Found Not Meditation Xiderror
28 E-Zigaretten und mehr Fachhandel

Das Thema E-Zigarette bleibt weiterhin brisant und die Meinungen driften immer noch auseinander. Leider auch schon seit längerem gibt es..
happy-smoke.ch Lager Warenkorb Vapelounge Zubehör Liquids Reinigung Mods Five Drip Pawns Tips Ersatzteile Batterien Akkuträger Zigaretten Happy Smoke Liquid Suicide Pioneeryou
29 handyshop-badhall.at - Handyreparatur Bad Handyshop

Bad Hall
Mit der Firma handyshop-badhall.at kann man sein Smartphone wieder so gut wie neu hinbringen und muss nicht viel Geld dafür..
handyshop-badhall.at Hall Handyshop Handy Reparatur Ankauf Entsperren Badhall Kunden Handyreparatur Qualität Dienstleistungen Verkäufer Handybörse Unser |
30 bobber 125 ccm Motorrad

Puch bei Hallein
Der kleine Räuber mit 125 ccm, für alle, mit FS-A und für FS-B Besitzer, mit Code 111 , bei..
ms-bikes.at Bikes Wwwmotorradat Msy
31 EMCO Werkzeugmaschinen Drehmaschinen Fräsmaschinen Fräsen

EMCO ist ein weltweit führender Werkzeugmaschinen Hersteller von Drehmaschinen und Fräsmaschinen. Der Erzeuger arbeitet nach modernsten und internationalen Standards und..
emco-world.com/ Emco Cnc [] Ausbildung News Fräsmaschinen Industrie Produkte Drehmaschinen Erzeuger Drehen Kundenservice Kundendienst Unternehmen Consulting Ersatzteile Schulungen Leistungsfähige Gebrauchtmaschinen

Hausen am Albis
Wir verfügen über viele Jahre Erfahrung in Zucht; Genetik und Ausstellungen und planen ganz bewusst eine Fremdrasseneinkreuzung; weil sich Welpen..
bollipoo-hybridzucht.ch Bollipoo Wwwbollipoo Hybridzuchtch Anzahlspiel Hunde Welpen Besucherinternetseite Spass Superplush
33 REYERlooks Designermoden Onlineshop Onlineshop Mode

Designermode im Fashion Online shop REYERlooks! Die neuesten Trends den richtigen Style und die besten Designer. Designermode ohne Kompromisse! DER..
reyerlooks.com/ Trends Designer Reyerlooks Shop Fashion Mode Kleider Taschen Designermode Urban Mäntel Bags Schuhe Röcke Jacken Passend Winter Shoes Sicher Anrede*
34 Urlaub Hall Wattens Tirol Tourismus

Hall in Tirol
Verbringen Sie Ihren Urlaub in Tirol in Österreich und genießen Sie zahlreiche Aktivitäten auf den Bergen, in der Natur und..
hall-wattens.at/ Region Hall Haller Swarovski Geschichte Urlaub Wandern Sommer Tirol Wattens Hasegg Burg Events Winter Mils Incentive Angebote Themenführungen Fitness Hund Tradition
35 PC-Reparatur COMPUTER Service

Herzlich Willkommen bei Ihrem CXPC-Service Team für Computer, Büro, Gaming, Multimedia PC´s und Ersatzteile. Wir haben unser Interesse für Computer..
cxpc-service.at Pc Computer Cxpc Finden Radeon System Amd Pc´s Budget Beratung Systeme Mini Technik Erfahrung Reparatur Kontaktformular Nutzen Edv Dienstleistung Ihrem
36 NägeleLogistics Expresstransport Botendienst

Puch bei Hallein
NägeleLogistics Expresstransport beschäftigt sich mit Termintransporte bzw. europaweiten Direktfahrten und Sonderfahrten. Zu den Kunden gehören Unternehmen aus verschiedensten Branchen. Seit 2014 betreibt..
naegele-logistics.eu Express Expresstransport Nägelelogistics Nägele Naegele Sonderfahrten Transporte Termintransporte Transportanfrage Abteilung Wwwmy Shoptoday Hotline Botendienst Freecall Transport Ihr Ngelekurier Presse Archiv
37 Helga M. Schnattinger Alternativmedizin

Kinesiologie, Tuina, Familienaufstellung sowie Schamanismus und Rückführung bietet Helga Schnattinger in Hallein bei Salzburg - Gesundheitstrainerin und Diplomtherapeutin für traditionelle..
helga-schnattinger.at/ Kinesiologie Tuina Schamanismus Rückführung Helga Schnattinger Familienaufstellung Salzburg Hallein Seminare Sowie Kintao Reinkarnation Homöopathie Familienstellen über Meiner
38 Werbeartikel Werbeartikel

Werbeartikel sind dreidimensionale Werbeträger, die Unternehmen zu Werbezwecken an Kunden und Interessenten verschenken. Klassische Werbeartikelreichen von preisgünstigen Streuartikeln und Gimmicks..
buecheler.ch Bücheler Werbeartikel Werbegeschenke Meta Alt+ Portemonnaie Taschenapotheke Feuerzeug Schreibmappe Navigation Hilfe Handy Etui Click Clack Dose Usb Stick Massband Fächer Zeckenkarte Prospekte
39 Portraitfotografie und Hochzeitsfotografie Fotografie

Affoltern am Albis
Portraitfotografie Man muss Menschen mögen um sie richtig fotografieren zu können. Emotionen bildlich festzuhalten und mit Menschen zu arbeiten erfüllt mich..
fotoartcompany.ch Company Hochzeitsfotograf Fotoart | Portraitfotografie Hochzeitsfotografie Produktfotografie Portraitfotograf Zürich Brautpaar Preise Kontaktformular Email Fotokurse Fotokurs Agb Fineart
40 Schloß - Schlüssel - Schlosserei

Puch bei Hallein
Der Schlosserei- und Metallbaubetrieb Steinhofer Markus ist bekannt, für hochwertige sowie langlebige Produkte und Dienstleistungen; Die individuellen Wünsche und Bedürfnisse der..
metall-hand-werk.at Steinhofer Schlossermeister Betrieb Salzburg Puch Pongauat Menu Fax Fusszeile Usermetall Internetagentur Login Geschftszeiten Montag
41 Mertl-Kunststoff GmbH Kunststoff und

MERTL Kunststoffe GmbH - Verschiedenste Produkte wie : Thermoplastische Werkstoffe Duroplastische Werkstoffe ICE FLOOR 365 Eislaufen ohne Eis Gleit- und Förderelemente Rammschutzleisten nach Wunsch kompetenter Partner..
mertl-kunststoff.com Kunststoffe Mertl Thermoplaste Icefloor Duroplaste Fertigteile Halbzeuge Plastix Förderelemente Erfahren Gleit Stellenanzeigen Zertifikat Kunststoff Zuschnitte Premium Werkstoffeund Hochleistungskunststoffe Sowie Pe Werkstoffe Unser
42 Sabay Sabay Thai Massage Massage

Affoltern am Albis
Neueröffnung: Entspannung pur bei Sabay Sabay Thai Massage & Kosmetik Die traditionelle Thai Massage ist eine Kombination von sanften Akupressuren sowie..
sabay-thaimassage.ch Massage Sabay Thai Reflexzonen Kosmetik Fuss Informationen Schulter Nacken Rücken Kräuterstempel Gesundheit Thailand Kopfmassage Gutschein
43 Frauenarzt Dr. med. P. Frauenarzt

Affoltern am Albis
Dr. med. Peter Dörffler ist Facharzt für Frauenheilkunde & Geburtshilfe in Affoltern am Albis. Er bietet sämtliche Gynäkologieleistungen und ist darüber..
frauenarzt-affoltern.ch/ Schwangerschaft Frauenarzt Albis Dörffler Gynäkologe Finden Person Praxis | Uns → Gynäkologische Med Web Formular Endokrinologie Hormonbehandlung Affoltern
44 Joya City Shop Schuhe

weichster Schuh der Welt ideal bei Hallux und Fersensporn schon Rücken und stärkt Muskulatur Gelenkschonend..
joya-cityshop.at Joya Schuhe Shop Gesunde Komfortschuhe City Schöninger Erfolgsgeschichte Gehen Hallein Alois Kellner Schwelle Wegbereiter Cityshopat Wwwjoya Nater Shophallein
45 Medienquartier Werbeagentur

Internetseite, Webseite, Grafiker, Webdesigner, Werbung, Visitenkarte, Plakat, Broschüre, Logo, Briefpapier, Kuverts, Postkarten, Rollups, Fahnen, Beachflag, Marketing, Social Media, Corporate Design..
medienquartier.at Project Salzburg Grafikdesign Webdesign Hallein Werbeagentur | Medienquartier Work Details Contact Print Cafe Genuss Wahre Maria Consulting
46 balsam Naturkosmetik Schönheit Wellness

Hall in Tirol
Wir führen Naturkosmetik Marken aus ganz Europa, deren Philosophie und Schwerpunkt uns überzeugen. Bevor wir uns für eine neue Marke..
naturkosmetik-tirol.at Line Naturkosmetik Natures Happy Haut Aging Seifen Beauty Tiroler Hauttyp Reine Sauna Gebhardt Accessoires Weihnachten Hände Schlafwohl Einzelöle Luke Active

Hausen a/A.
Wir verfügen über viele Jahre Erfahrung in Zucht; Genetik und Ausstellungen und planen ganz bewusst eine Fremdrasseneinkreuzung; weil sich Welpen..
bollipoo-hybridzucht.ch Wwwbollipoo Hybridzuchtch Internetseite Hundespiel Anzahl Spass Besucher Bollypoo Welpen Superplush Ueberbollipoo
48 Artistic Institut - Echallens Epilation-Massage

Toutes les epilations pour dames et messieurs par estheticienne experimentee. Technique speciale et cire LYCON, extra douce, pour une..
artistic-institut.ch Epilation De Institut Artistic Dans Les Vous Hommes See Réussir Cadeau Et Cire Bienvenue Massage Diaporama Devraient Ils Anti Poils Année Mental Pas
49 Laserer Küchenstudio Salzburg

Küchen sind nicht nur Orte, in denen man Essen zubereitet, sie sind in zahlreichen Fällen ebenfalls Begegnungsstätten. Das Abendessen, wird..
laserer.at/de/kuechen-wohnen/kuechen-kuechenplanung/kuechenstudio-salzburg/ Küchen Küchenstudio Wohnen Salzburg Gosau Hallein Laserer Tischlerei Marken Planung Anfahrt Küchenstudios Siematic Maß Traditionell Einbauküchen
50 moser - productagent Handel

Handel mit Werbemittel, Weihnachtsgeschenke, Betriebsaktionen, Produktsuche, Produktvermittlung, Hallein, Salzburg, Österreich, Producthunter,..
productagent.eu Werbegeschenke Werbemittel Werbung Betriebsaktionen Weihnachten Hallein Salzburg Präsente Wien Business Tennengau Kärnten Linz Vorarlberg Flachgau Kundengeschenke Werbemitteloberösterreich
51 S.M.C.M. international Gmbh Inkasso

S.M.C.M. International GmbH mit Sitz in der Schweiz, bietet Ihnen vielfältige und umfassende Lösungen im Bereich des nationalen und internationalen..
smcm-international.com International Debt Services Marketing Court Enforcement Sales Management Credit Address Reporting Smcm Representation Tracing National Rappresentanza Accounts
52 Videodreh-Filmproduktion Videoproduktion

Hall in Tirol
Videoproduktionen und Pressearbeit..
videodreh.at Videodrehat Sportberichte Events Pressearbeit Tirol Imagefilme Hochzeit Musikvideos Videodreh Hochzeitsfilmer Filmproduktion Film Videoproduktionen Imagefilme Halten Partnernum Artworkat Produkt Filmproduction
53 video-hochzeit.at Videoproduktion

Hall in Tirol
Hochzeitsfilme, Taufen, Firmungen..
video-hochzeit.at Hochzeitsfilm Tirol Partner Videodreh Video Philosophie Leben Hochzeit Team Preise Taufen Verfügung Wunsch Moment Videos Leidenschaft Ich Macht Videodrehat Mail Vereinbaren

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Hall

+ Kommentar oder Kleinanzeige für Hall eintragen!

54 .:STARTSEITE:.Helmuth Matzner helmuthmatzner.at Helmuth
helmuthmatzner.at Helmuth Matzner Gojibeere Wolfsbeere ätherische
55 Unser Heim :: Hauptmenu Betreuungsheim Rottensteiner GmbH
Hall bei Admont
... ist!" und dieses Zuhause wollen wir Ihnen schenken. Unser Heim Wir sind ein Betreuungsheim in Hall
56 Wohnkeramik Taferner GmbH moderne
Hall bei Admont
Peter Taferner ist Ihr Hafnerbetrieb wenn es um Kamine und Öfen aller Art geht ... Peter Taferner - Ihr Hafnermeister und Fliesenleger Hall Hall bei Admont +
taferner-wohnkeramik.at Moderne Kachelöfen Gestaltung Traditionelle Kachelöfen Hafnermeister Admont Hafn
57 Gnacht.ch | Bestellen Sie Karl-H Gmbh Satin
Hausen am Albis
Satin Bettwäsche Fischbacher und Schlossberg Hirsekissen Daunen Duvet Milbenschutz Matratzen Schutzhüllen ... Weisbrod-Areal Hausen a. A. + » Topqualität » Schnell » Preiswert
g-nacht.at Satin Bettwäsche Fischbacher Und Schlossberg Hirsekissen
58 Home page | OnlineVinothek Willkommen
Österreichs erlesene Weine sind in aller Welt bekannt! Die Vinothek Vineart in Admont bei Liezen
vinothek-vineart.at Willkommen Vinothek Vineart
59 Willkommen auf der Homepage Salz
Hall ein idyllisch gelegenes Dorf am Fuß der Haller Mauern und zum Tor des Gesäuses ... GoogleNews Low Cost Levitra Gemeinde Hall ...ist einen Besuch wert Startseite Bildergalerie
gemeinde-hall.at Salz Hall Steiermark Admont
60 News

61 Willkommen

62 Baumeister Huber Alexander Alexander
Alexander Huber Baumeister Hall bei Admont
iplan4you.at Alexander Huber Baumeister Hall Bei Admont
64 Home | PörlSportShop responsive
Responsive business template for Joomla 3.0 JA Zite. This responsive template is powered by
poerl-sport-shop.at Responsive Joomla Template Responsive Template Joomla
65 Willkommen im Gasthaus zur admont
Gasthaus zur Ennsbruecke Admont ... und Christoph Pirafelner Hall A- Admont + DW gasthaus
pirafelner.at Admont Essen Gesäuse Xeis
66 |: Alpinschule ALPINSTIL :|: Bergführer
Alpinschule Alpinstil "So draußen wie möglich" Profibergführer mit Qualitätsgarantie! Professionelle Tourenführung und Ausbildung ... >> Alpinschule Alpinstil Mag. Jürgen Reinmüller Steinfeldsiedlung Admont www.alpinstil + (
alpinstil.at Bergführer Alpinschule Bergsteigerschule Bergsport
67 Stiftskeller Admont
Stiftskeller Admont im Benediktiner Stift Admont: Restaurant für jeden Anlass Busreisen Hochzeiten ... Informationen Admont Kirchplatz + officestiftskeller-admont Betriebsurlaub
68 |: Alpinschule ALPINSTIL :|: Bergführer
Alpinschule Alpinstil "So draußen wie möglich" Profibergführer mit Qualitätsgarantie! Professionelle Tourenführung und Ausbildung ... >> Alpinschule Alpinstil Mag. Jürgen Reinmüller Steinfeldsiedlung Admont www.alpinstil + (
alpinklettern.at Bergführer Alpinschule Bergsteigerschule Bergsport
69 Home

70 Willkommen auf der Homepage: ENVESTA Energie- und Dienstleistungs GmbH
Die ENVESTA Energie und Dienstleistungs GmbH als Tochterunternehmen des Benediktinerstiftes Admont versteht sich mit ihren ... Hauptstraße A- Admont T + - F + - www.envesta officeno
71 Freiwillige Feuerwehr und Rettungsabteilung Freiwillige
Freiwillige Feuerwehr und Rettungsabteilung Admont
feuerwehr-admont.at Freiwillige Feuerwehr Feuerwehr FF Admont
72 AktivGsund Laktattest
Durchführen von Laktattest Gehtest Leistungsdiagnostik Feldstufentest HRVMessung sowie Trainingsbegleitung
aktiv-gsund.at Laktattest Training Sport Leistungsdiagnostik
73 Gesäuse Perle Natur Limonade

74 Glumpad
glumpad ...nur so... ... wir uns am Radrennen durch Wien. zu den Fotos ? Back to Top Admont Austria+ gott.maurerglumpad
75 JOHANN REINALTER KG Johann Reinalter KG johann
Willkommen bei Johann Reinalter KG :: Heizung Sanitär Klima Spenglerei Elektro ... . Heizung Klima Sanitär Elektro und Spenglerei aus einer Hand! Johann Reinalter KG Bachgasse
reinalter.at Johann Reinalter Kg Johann Reinalter
76 Marktgemeinde Admont
... Chronik Was ist los im Gesäuse Bewegungsarena Admont-Hall-Weng Amtsstunden Montag . bis . Dienstag
77 Franz Tschitschko Lederhosenerzeuger Lederhose
Franz Tschitschko Lederhosenerzeuger aus Admont
die-lederhose.at Lederhose Leder Hose Tracht
78 Klosterladen Weinshop Online Wein
DveriPax Weinshop dem online Weinhandel des Benediktinerstifts Admont. Erlesene Weine zu AbHofPreisen bequem online
dveripax-austria.at Wein DveriPax Weinshop Online Versand
79 Www.f5d.teamaustria.at Startseite
F5D Austria Team 2012
80 Villa Elisabeth Willkommen Privatzimmer;Zimm
Villa Elisabeth ist das Hotel in Admont in Österreich in dem Sie von einem ... Elisabeth Kontakt und Reservierung Villa Elisabeth Paradiesstraße Admont Österreich Rufen
villa-elisabeth.at Privatzimmer;Zimmer Admont;Urlaub Admont;Fremdenzimmer;Admont Zimmer Villa Elisa
81 Blumenstube Sabine Sabine
Die Website von Blumenstube Sabine ist eine Präsentation des Blumen und Floristik Fachgeschäftes von Sabine ... Frühjahr Anfahrt Disclaimer Kontakt Sabine Zechner Willkommen auf meiner Homepage Hall
blumenstube-sabine.at Sabine Zechner Blumenstube Floristik Blumenhandel
82 Freiwillige Feuerwehr HALL Bezirk
Admont - Austria
Freiwillige Feuerwehr Hall bei Admont! Bezirk Liezen Admont Hall Weng Ardning ... ; Admont Steiermark Österreich Copyright Freiwillige Feuerwehr HALL. Alle Rechte
ff-hall.at Bezirk Liezen Admont Hall Weng
83 HomepageTitel Startseite Kosmetik
HomepageTitel in Admont bietet als Ihr modernes Kosmetikstudio alle Leistungen rund ums Wohlfühlen von ... Verwöhnstudio Alice Steiner Hier finden Sie mich Verwöhnstudio Alice Steiner Hauptstraße Admont Kontakt
kosmetik-admont.at Kosmetik Beauty
84 Supervision Hofer

85 Admont Blumen Blumenladen
Alles über Blumen und dem traditionellen Blumenladen des Stiftes Admont sowie dem Weinverkauf des
admont-blumen.at Blumenladen Stiftsgärtnerei Stift Admont Dveripax
86 Willkommen
... fahren ab der Schule Richtung Hall Weng und Johnsbach um. Nach Ardning um ab der Schule
87 Unser Kindergarten kindergartenadmont

88 Home Bergholz Admont GmbH Bergholz
Die Firma Bergholz Admont GmbH ist ein traditionelles Sägewerk und Hobelwerk in Admont. ... Paradiesstraße Admont Austria Anfahrt Bürozeiten Montag - Donnerstag von - Uhr Freitag von
bergholz-admont.at Bergholz Admont Sägewerk Hobelwerk
89 Fellnasenstudio Home Angebot
Fellnasenstudio Hall ... Sie hier . In unsererTierarztpraxis Dr. Hans Weißensteiner Hall A- Admont werden regelmässig "Erste-Hilfe-Kurse
fellnasenstudio.at Angebot Kompetenz Beratung
90 Home Ferienwonungen
Startseite Ferienwohnungen Lep Admont Unterkunft Admont ... A- Admont / Diese -Adresse ist vor Spambots geschützt
ferienwohnungen-lep.at Ferienwonungen Lep Admont Zimmer Admont Privatzimmer Lep AdmontUnterkunft
91 Schutzhütte Gesäuse Home grabner
Weng im Gesäuse
Grabneralmhaus 1395m Gesäuse ... zu den erreichbaren Gipfel Unterkunft im bis Bettzimmer und Lager möglich Home Zustiege Buchauer Sattel Hall
grabneralmhaus.at Grabner Alm Grabneralmhaus Gesäuse Schutzhütte
92 Start Nationalpark Gesäuse Nationalpark Gesäuse GmbH
Weng im Gesäuse
... if sufficient participants of these languages. The workshops at the second day will take place
93 Junior Ranger Nationalpark Gesäuse GmbH Junior
Weng im Gesäuse
Junior Rangers ... für Jugendliche bewusst und spannend erlebbar zu machen. Nationalpark Gesäuse Junior Ranger Weng
junior-ranger.at Junior Rangers
94 List Rechtsanwalts GmbH Rechtsanwalt
Weng im Gesäuse
Durch die Verkn?pfung zwischen l?sungsorientiertem Problembewusstsein und f?cher?bergreifendem KnowHow bietet die List Rechtsanwälte GmbH den
ralist.at Rechtsanwalt List Wien Öffentliches Recht
95 Start Nationalpark Gesäuse Nationalpark Gesäuse GmbH
Weng im Gesäuse
... or English on demand if sufficient participants of these languages. The workshops at the second day
96 Start Alpenregion Nationalpark Gesäuse
Weng im Gesäuse
Urlaub und Ferien in der Alpenregion Nationalpark Gesäuse. Sommer und Winter Routenplaner zu Wandern ... Saisonale Highlights Gseispur TVB - Alpenregion Nationalpark Gesäuse Hauptstraße A - Admont
gesaeuse.at Gesäuse Energiequelle Europa Festival St.
97 Start Nationalpark Gesäuse Nationalpark Gesäuse GmbH
Weng im Gesäuse
... workshops at the second day will take place in English language without translation. Registration The
98 Heinz Weiler

99 Verein VAGET
... . Infoblatt memory download Verein VAGET - Schmiedtorgasse Hall Kontakt
100 Kur und Stadtapotheke Hall apotheke
Die Apotheke am oberen Stadtplatz in Hall ist um Ihre Gesundheit bemüht. ... zu fühlen- abnehmen wollen viele.... mehr... Hall in Tirol Oberer Stadtplatz -
stadtapotheke-hall.at Apotheke Hall Stadtapotheke Pollack Medikament Berggeist Knoblauchdragees Heilpf
101 News Fröschl AG & Co KG
... Kontakt Aktuelle Seite Home Segnung FRÖSCHL HAUS Das neue Fröschl Haus am Haller Brockenweg wurde
102 Red Lionettes: Hintergrund
... Lionettes Cheerleading und Cheerdancing der Red Lions Hall Home Team Kampfmannschaft Juniors Verein
103 Red Lions: Home
... Hall in Tirol
104 Rauchfutter | Anton Rauch
... Adresse Rauchfutter Innsbrucker Hall Telefon + +
105 Verein VAGET
... . Infoblatt memory download Verein VAGET - Schmiedtorgasse Hall Kontakt
106 News Fröschl AG & Co KG
... Kontakt Aktuelle Seite Home Segnung FRÖSCHL HAUS Das neue Fröschl Haus am Haller Brockenweg wurde
107 Veranstaltungstechnik Lichttechnik Crossfade GmbH Veranstaltungstec
Crossfade Veranstaltungstechnik Krippgasse 8 6060 Hall in Tirol
x-fade.at Veranstaltungstechnik Lichttechnik Bühnentechnik Tontechnik
108 Historica Historische Forschungen

109 Willkommen | Hörtnagl Andrä Hörtnagl Produktion und Handel GmbH
Hörtnagl ist der Tiroler Marktführer in der Erzeugung und Veredelung von hochwertigen Wurst und Fleischwaren. ... zweimal jährlich abgebildet. Weiterlesen Genussstation in Hall Der Hörtnagl-Standort in Hall in Tirol darf
110 Kunterbunter Laden Kinder
im ... Kunterbunter Laden - Kinder Second Hand Schmiedgasse Hall in Tirol Öffnungszeiten DO
111 News Fröschl AG & Co KG
... der Gemeinde Tulfes Träger des Ehrenzeichens des Landes Tirol und der Stadt Hall sowie zahlreicher weiterer
112 Bäckerei Zöhrmühle aus Bad Zöhrmühle GmbH
Bad Hall
Die Bäckerei Zöhrmühle aus Bad Hall bäckt ausschließlich nach eigenen Rezepten Ihr Steinofenbrot ... Bäckerei Zöhrmühle Startseite Filialen Backwaren Rückblicke Info Point Filiale Bad Hall Hauptplatz
113 IPC Verpackungen und Logistik IPC
Bad Hall
IPC Verpackungen und Logistik GmbH bietet Flugfrachtverpackung Sonderverpackung Gefahrengutverpackung LKW Verpackung
karopack.at IPC Verpackungen Verpackung Logistik
114 Startseite Ökergo Unternehmensberatung Service-Team GesmbH Unternehmensberat
Bad Hall
Wir sind eine Unternehmensberatungsfirma bei der die ProzessOptimierung durch ein ExpertenTeam im Vordergrund steht. Ökergo UnternehmensberatungsServiceTeamGesmbH
netzwerk-zeitwirtschaft.at Unternehmensberatung Arbeitsvorbereitung Arbeitssicherheit Lohnsysteme
116 IPC Verpackungen und Logistik IPC
Bad Hall
IPC Verpackungen und Logistik GmbH bietet Flugfrachtverpackung Sonderverpackung Gefahrengutverpackung LKW Verpackung
ipc-verpackungen.at IPC Verpackungen Verpackung Logistik
117 CellaApotheke Die Quelle Cella
Bad Hall
Die CellaApotheke in Bad Zell bietet Ihnen ein großes Leistungsspektrum von Bachblütenberatung bis hin zu
cella-apotheke.at Cella Apotheke Zell Bad Zell
118 Willkommen! Kinderwerkstatt Grillenbichl e.V.
Hall i.T.
... . Badgasse A- Hall i.T. kinderwerkstatt grillenbichl
119 Autohaus Gegenleitner und Lang Gegenleitner & Lang GmbH Autohaus
Bad Hall
Autohaus Gegenleitner und Lang Ihr Spezialist für seat gebwseat Autohaus Auto Carconfigurator ... Unsere Anschrift Gegenleitner Lang GmbH Bad Hall Steyrer Telefon Tele
gegenleitner-lang.at Autohaus Gegenleitner Und Lang Seat Gebwseat Autohaus
120 Die Gesundheitsdienstleister :: Baden Gesundheit
Bad Hall
Die Gesundheitsdienstleister in Baden sind spezialisiert auf Kurmedizin Sportmedizin Homöopathie Akupunktur
gesundheitsdienstleister.at Gesundheit Medizin Ganzheitsmedizin Kur
121 Startseite Ökergo Unternehmensberatung Service-Team GesmbH Unternehmensberat
Bad Hall
Wir sind eine Unternehmensberatungsfirma bei der die ProzessOptimierung durch ein ExpertenTeam im Vordergrund steht. Ökergo UnternehmensberatungsServiceTeamGesmbH
oekergo.at Unternehmensberatung Arbeitsvorbereitung Arbeitssicherheit Lohnsysteme
122 ParkpensionBillroth.at Parkpension
Bad Hall
... sagt liegt dieses gepflegte Haus direkt am Kurpark von Bad Hall einer der schönsten Parks von ganz
parkpension-billroth.at Parkpension Billroth Gegenhuber Pension
123 Hochbeete | Terrassen | Hochbeete
Bad Hall
Ortner Holz in Oberösterreich bietet Hochbeete Fassaden und viele weitere Produkte aus Holz.
ortner-holz.at Hochbeete Hochbeet Ortner Holz Sägewerk
124 Jausenstation Eisenhuber | Bad Jausenstation
Bad Hall
Jausenstation Eisenhuber | Bad Hall | Furtberg ... herunterladen Jausenstation Eisenhuber Furtberg Bad Hall; +
jausenstation-eisenhuber.at Jausenstation Eisenhuber Bad Hall Furtberg Schmankerl Most Schweine
125 Startseite Klinikum Bad
Bad Hall
Das Klinikum Bad Hall ist ein modernes Kompetenzzentrum für HerzKreislauf und neurologische Rehabilitation. ... Schriftgröße A A A Klinikum Bad Hall Parkstraße Bad Hall Telefon + -
126 Vereinigung österreichischer Kurorchester orchester
Bad Hall
... Bad Hall Bad Hofgastein Bad Ischl und Bad Schallerbach zusammengeschlossen zur ?Vereinigung
kurorchester.at Orchester Kurorchester österreichische Kurorcheser Musikinstrumente Kurchorchest
127 Monika Neudecker ::
Bad Hall

128 Home | ModellFOX OnlineShop
Bad Hall
Alles muss raus! Rasch zuschlagen nur begrenzte Stückzahlen.Teilen ... % Spw mm Anzahl AT- Texan Produktdetails... Artikel Nummer AN ? ? Sie sparen
modellfox.at OnlineShop Modellbau Modellflug Regler BEC
Bad Hall
... . Wilhelm Tischler Feldgasse Bad Hall + + Design
130 Dr. Blaha Wirtschaftstreuhänder wirtschaftstreuhä
Bad Hall
Wirtschaftstreuhänder Steuerberater Blaha in Bad Hall Linz Oberösterreich Ratgeber in allen steuerlichen Angelegenheiten ... . Wirtschaftstreuhänder - Steuerberater Dr. Blaha in Bad Hall A- Bad Hall Hauptplatz Telefon +
stb-blaha.at Wirtschaftstreuhänder Steuerberater Blaha Bad Hall
131 über Uns dynamic-extrusion.com GmbH Handwerk
Bad Hall
Steinkorbsystem bad hall ... -extrusion GmbH Mühlgruberstrasse Bad Hall + + ? officesteinkorbsystem
steinkorbsystem.at Handwerk Gold Silber Gold
132 S.S.T. Security sst
Bad Hall
S.S.T. Security ... bei Unser Unternehmen mit Sitz in Bad Hall bietet Ihnen professionelle Dienstleistungen im Discotheken
sst-security.at Sst SST S.s.t. S.S.T. Security Security Sicherheitsdienst Bewachung
133 Home www.stodo.at
Hall i.T.
Marketing und Kommunikation Webdesign Graphikdesign Geschäftsausstattung Kongressmanagement Events ... Fotogallerie Über mich Anfrage Doris Stolz ? Thurnfeldgasse a ? A Hall in Tirol
134 TGNMaschinenvertrieb TGN
Bad Hall
Ihr Partner in Sachen Blechbearbeitung und Rohrbearbeitung Spenglerei Lufttechnik und Klimatechnik ... Kanallängen TGN Maschinenvertrieb Steyrer Str a Bad Hall + - + - E
tgn.at TGN Goldschald Steyr Bad Hall
135 Startseite Tomic TEC Tomic TEC Austria GmbH Industrieller
Bad Hall
Konzeption Planung und Realisierung von Industrieanlagen bis hin zur schlüsselfertigen Übergabe einzelner Systeme. ... Stellenangebote KONTAKT Standorte Anfrage Kontakt Tomic TEC Austria GmbH Tischlerstr. A- Bad Hall
tomic.at Industrieller Anlagenbau TGA Schleifkabinen Versorgungstechnik
136 Austrowaren Alphapack Nagel und Nagel
Bad Hall
Austrowaren Alphapack bietet seinen Kunden Produkte aus den Bereichen der Befestigungstechnik Schmelzklebetechnik
austrowaren.at Nagel Und Klammersysteme Kartonheftprogramme Baubeschläge
137 Willkommen | Home |
Bad Hall
... ! Dreifaltigkeitsapotheke Bad Hall Hauptplatz Bad Hall + + Mail office
138 Home
Bad Hall
... wir! Beate Wetzlmayer - Cosmetic Institute Steyrer Bad Hall Austria + (
139 Lebensmitteltechnologie Lebensmittelhygiene EuroConcept
Bad Hall
Lebensmitteltechnologie Lebensmittelhygiene | EuroConcept unterstützt Lebensmittelbetriebe und verarbeiter bei neuen Innovationen.
euro-concept.at EuroConcept Lebensmitteltechnologie Lebensmittelhygiene Lebensmittel
140 Gruber Elektrotechnik Bad Hall Franz Gruber GesmbH & Co KG Elektroinstallati
Bad Hall
Platz für Ihren Slogan
elektro-gruber.at Elektroinstallation Elektrotechnik Elektrogeräte Alarmanlagen
141 FF Bad Hall
Bad Hall
... Freiwillige Feuerwehr Bad Hall retten - schützen - bergen - löschen - seit geben wir unsere
142 FUSE Elektrotechnik GmbH in Fuse
Bad Hall
FUSE Elektrotechnik GmbH in St. Marien bietet Beleuchtungsanlagen Energieverwaltungssysteme Sicherheitsbeleuchtungsanlagen Notrufanlagen und
fuse.at Fuse Elektrotechnik St. Marien ElektroFachbetrieb
143 Golfclub Herzog Tassilo golf;bad
Bad Hall
... uns auf Sie! Der Vorstand des GC Herzog Tassilo Druckbare Version GC Herzog Tassilo Blankenberger Bad Hall
gcherzogtassilo.at Golf;bad Hall;herzog Tassilo;gc;golfclub;club;golfplatz;oberösterreich;
144 Tischlerei Küchenstudio Franz
Bad Hall
... Adlwangerstraße Bad Hall Route berechnen Telefon Mobil office
145 Alfred Scheich MAS Alfred
Bad Hall
Alfred Scheich MAS. International Consulting. Mayrbäurlweg 14 4540 Bad Hall Oberösterreich ... Mayrbäurlweg A- Bad Hall officeasfs Internet www.international-consulting . Benutzername
international-consulting.at Alfred Scheich MAS International
146 RS Tore Industrietore RSTORE
Bad Hall
... Hall Hehenberg - officerstore
rstore.at RSTORE Rührlinger Planung Bauplanung Industrietore
147 Der Schnürerhof die Pension
Bad Hall
Herzlich Willkommen beim Schnürerhof die Frühstückspension und Jausenstation im Herzen Oberösterreichs. Ausspannen Ruhe ... im Herzen Oberösterreichs! Feyreggerstraße - A- Pfarrkirchen b. Bad Hall DIENSTAG u
schnuererhof.at Pension Urlaub Unterkunft Bad Hall
148 DER ALARM PROFI Ihr AirControlSystem
Bad Hall
Ihr Berater für Sicherheitstechnische Fragen rund um das Thema Alarmsicherung.
deralarmprofi.at AirControlSystem Alarmanlage AlarmierungsSystem Außenbewegungsmelder
149 Praxis PD Dr. Heinrich Lenders
Schwäbisch Hall
Praxis PD Dr. Heinrich Lenders
lenders.at Lenders Heinrich Lenders Praxis Praxis
150 Langerweg28.at Home H & H Immobilien und Projektentwicklung GmbH Langerweg
Hall i.T.
Langerweg Innsbruck Büro und Geschäftsflächen Mietflächen HH Immobilien und Projektentwicklung
langerweg28.at Langerweg Innsbruck Büro Und Geschäftsflächen
151 Lebensmitteltechnologie Lebensmittelhygiene EuroConcept
Bad Hall
Lebensmitteltechnologie Lebensmittelhygiene | EuroConcept unterstützt Lebensmittelbetriebe und verarbeiter bei neuen Innovationen.
hygienix.at EuroConcept Lebensmitteltechnologie Lebensmittelhygiene Lebensmittel
152 Leben kann mehr sein workshops
Bad Hall
Home Angebot Philosophie Über uns Die 3 Termine Aktuelles Kontakt einzelbalancen ? gruppenarbeit ? workshops
lkms.at Workshops Gruppenarbeit Seminare Ausbildungen
153 Pepi Personaleinsatzplaner
Bad Hall
Optimieren Sie Ihre Personaleinsatzplanung!
154 HOME Postfuchs Postfuchs
Hall i.T.
Die FCG Post Tirol übernimmt Verantwortung für zahlreiche Christgewerkschafterinnen und Christgewerkschafter die das Wertefundament ... HOME TEAM NEWS POSTFUCHS SERVICE FORMULARE FCG POST POST SOZIAL KONTAKT FCG - Tirol
postfuchs.at Postfuchs Postfuchs Fcg Fraktion
155 Willkommen bei SerVers! Ihr SerVers GmbH
Bad Hall

156 Branchenbuch Firmen branchenbuch
Schwäbisch Hall

aligo.at Branchenbuch Branchen Branchen Verzeichnis Firmenverzeichnis Firmen Verzeichnis
157 HonigManufaktur Binder Startseite Honig
Schwäbisch Hall
Bio Honig ... die am Anfang stehen ... Weiterlesen... Einführungskurs Schwäbisch Hall Einführungskurs ?Arbeiten im Angepassten
angepasster-brutraum.at Honig Manufaktur
158 Mcexpert Apple Beratung Apple
Bad Hall
Apple Autorisierter Händler Mac OSX Beratung Support Service Reparatur Verkauf Linz Wels Steyr Ihr ... Home Shop Support Service Autorisierter Händler In Bad Hall und Online. Shop Bad Hall Online
mcexpert.at Apple Autorisierter Händler Mac OSX Beratung Support
159 Mehler Elektrotechnik Mehler
Bad Hall
Mehler Mehler Elektrotechnik
160 Die Keynote zum Erfolg! Lichtkoppler Unternehmensberatung GmbH
Bad Hall
Sie suchen einen begeisternden KeynoteSpeaker für Ihre Veranstaltung? Hier sind Sie richtig! ... Lichtkoppler Lichtkoppler Unternehmensberatung GmbH Habichtstraße Bad Hall info
161 Ägypten Infos
Bad Hall
Hier finden Sie Ägypten Infos.
162 Bluebird tattoo Startseite Tättowierer
Bad Hall
Manuel Aumüller BLUEBIRD Tattoo Piercing aus Bad Hall findet mit Ihnen das ideale ... Freehand Tattoos Willkommen bei BLUEBIRD Tattoo Piercing in Bad Hall Termine für sind alle vergeben
bluebird-tattoo.at Tättowierer Tätowierungen Tattoo Piercing
163 English Day | Bad
Bad Hall
Herzlich willkommen bei English Day dem Sprachinstitut von Susan Geiblinger ihres Zeichens Native ... Sie Englisch mit Susan Geiblinger von English Day aus Bad Hall! Kontaktieren Sie mich gleich hier! Kompetente
164 Teambuilding Teamworkshops Lichtkoppler Unternehmensberatung GmbH
Bad Hall
Workshops mit dem Ziel Ihr Team erfolgreicher zu machen! ... Unternehmensberatung GmbH infolichtkoppler Dr.-Karl-Renner- c Bad Hall + Laufend aktuelle
165 Hubert Metzler Steuerberater Steuerberater
Hall in Tirol
Hubert Metzler Stadtgraben 25 A6060 Hall in Tirol T: 0 52 23 ... Stadtgraben Hall in Tirol www.wtmetzler fon + - - + - -
wtmetzler.at Steuerberater Hall In Tirol Steuerberatung Hall In
166 Startseite Haller Lend Apotheke Mag. pharm. Vinzenz Krug e.U. Haller
Hall in Tirol
Haller Lend Apotheke
haller-lend-apotheke.at Haller Lend Apotheke Apotheke Hall Apotheke
167 BIO Anbieter in Österreich
Hall in Tirol
... - woran erkennt man BIO? Kropsch und Krajnc GnbR · Eugenstraße · Hall · - · Mobil
168 Otto's Fliesen
Hall in Tirol
... Gerbergasse A- Hall in Tirol . hribarottos-fliesen Öffnungszeiten
169 Private Banking Hall in Vermögensmanegeme
Hall in Tirol
Private Banking der Raiffeisen Regionalbank Hall: persönliche Vermögensberatung Vermögensmanagement Anlagestrategien und Investmentansatz. ... Sie sich jetzt für den kostenlosen Newsletter des Private Banking Teams der Raiffeisen Regionalbank Hall in Tirol an und profitieren
privatebanking-hall.at Vermögensmanegement Vermögensberatung Vermögensverwaltung Vermögensplanung
170 Startseite Plappermaul OG
Pfarrkirchen bei Bad Hall
... bei Bad Hall + Diese -Adresse ist vor Spambots geschützt! Zur Anzeige
171 Salvatori Home
Hall in Tirol

172 Balsam Naturkosmetik #IndexMetaKeyword
Hall in Tirol
naturkosmetik-tirol.at #IndexMetaKeywordsStandard#
173 Elektro Anlagen Bau Elektro Pickl GmbH
Hall in Tirol
... Home Geschichte Referenzen Leistungen Anfahrt Kontakt Elektro Anlagen Pickl Hall in Tirol
174 Nudeln und Teigwaren von
Hall in Tirol
... finden Sie im ARCHIV . Recheis Teigwaren GmbH Fassergasse - A- Hall in Tirol kostenlose
175 Bestattung Ebenbichler
Hall i. Tirol

176 Bergerlebniswelt "Kugelwald am Glungezer"
Hall in Tirol
... + officehall-wattens Galerie Region Hall Wattens Social Media
177 Urlaub Österreich Tirol Region Urlaub
Hall in Tirol
Urlaub in den Tiroler Alpen: Hotels und Ausflugsziele in der Region HallWattens in Tirol / ... Kristallwelten RiesenKinderSpiel Geschichte der Fa. Swarovski Haller Münze Burg Hasegg Museum Münze Hall Burg
hall-wattens.at Urlaub Tiroler Alpen Hotels
178 Home | Projekt Tirol Harley Davidson
Hall in Tirol
Harley Davidson Innsbruck jetzt neu und endlich wieder in Tirol!
179 Hall in Tirol
Hall in Tirol
... Hall in Tirol - Haller Stadtrundgänge Seit gibt es die beliebten Haller Stadtrundgänge
180 Einkaufen in Hall in
Hall in Tirol
181 Hotel GARNI GRANAT der PRESSETEXTER Text- und Kommunikationsagentur GmbH Ötztal
Hall in Tirol
Willkommen auf der Startseite des Hotels Granat in Soelden im Ötztal!
hotel-granat.at Ötztal Soelden Tirol Hotel
182 HOME Immobilien Huber Immobilien Huber GmbH Hausverwaltung
Mils bei Hall i.T.
Wir beschäftigen uns mit dem Hausverwaltungsgewerbe und verwalten als Immobilientreuhänder und Gebäudedienstleister Wohnanlagen und ... GmbH A Mils bei Hall i.T. Gewerbepark officeimmobilienhuber
immobilienhuber.at Hausverwaltung Immobilienverwaltung Immobilien Wohnanlagen
183 Pension Griebler: Willkommen Pfarrkirchen
Pfarrkirchen bei Bad Hall
Gaestehaus Griebler Urlaub zum Wohlfühlen! ... des Kurbezirks Bad Hall. Eine große Anzahl von immer wieder kommenden Stammgästen zeigt uns die Zufriedenheit
griebler.at Pfarrkirchen Bad Hall Kremsmünster Kremsmuenster Urlaub Erholung Kur
184 Grossholzner HOME Über
Pfarrkirchen bei Bad Hall
Ich bin Christian Grossholzner aus Pfarrkirchen bei Bad Hall und erzähle euch auf dieser Webseite ... Pfarrkirchen bei Bad Hall + + ch.grossholzneraon FOHLENAUFZUCHT GASTSTUTEN
grossholzner.at Über Mich Hobby Fotos
185 Gaber Backwaren
Hall in Tirol

186 Home Park In
Hall in Tirol

187 Panorama Bauobjekt GmbH der Panorama Bauobjekt GmbH panoramabau
Hall in Tirol
panorama Bauobjekt und Panorama Projektentwicklung Karl Heinz Schlechter Bauträger Immobilientreuhänder und Projektentwicklung. ... Rudolfstraße a A- Hall in Tirol ? ? ? objektpanoramabau
panoramabau.at Panoramabau Bauträger Immobilientreuhänder ökologisches Bauen
188 Webdesign EDV Technik web
Hall in Tirol
Professionelles kostengünstiges Webdesign sowie Consulting bezüglich Internetanbindung Multimedia Internet Technik
hoema.at Web Design Webpräsentationen Webdesigner Webspaxe
189 Halbmarathon Hall in Tirol
Hall in Tirol
... Lauftreff Hall Sommacampagna Sportveranstaltungen Gästebuch Haftungsausschluss italiano webdesign
190 KFZ Servicewerkstätte Hausbichler
Hall in Tirol
... KFZ Meisterbetrieb. Unsere Anschrift KFZ Meisterbetrieb S. Hausbichler Lorettostr. a Hall
Hall in Tirol
jenewein-exclusive.at Home
192 Isuzu ISUZU Hollaus
Hall in Tirol
... Vertragspartner der neue D-Max Alles rund um ISUZU finden Sie bei der Firma Auto Hollaus - Hall Verkauf (ISUZU D
193 Kreativtischler Spötl Küchen Innsbruck
Hall in Tirol
Ob neue Küche Renovierung oder Ausbau: Wir achten auf gute Qualität spitzen Service ... Unsere Marken Unsere Leistungen Kontakt -/- Anfahrt Kreativtischlerei Spötl in Hall
kuechen-hall-innsbruck.at Innsbruck Hall Thaur Absam
194 KulturmacherInnen ? das österreichische Verlag Ablinger & Garber GmbH kulturmacherInnen
Hall in Tirol
das kulturhandbuch für österreich und südtirol : Kulturinitiativen / KulturveranstalterInnen Kultur und Kunstfestivals ... Hall in Tirol fon +--- +--- send mail top kulturmacherinnenablinger
kulturmacherinnen.at KulturmacherInnen österreich Austria Kulturinitiativen Festivals Theatergruppen
195 Willkommen
Hall in Tirol
... Skip to the navigation . Skip to the content . KLARAHEIM ? Hall in Tirol Wohn- und Pflegeheim
196 Lebensberatung Hall
Hall in Tirol
... ? Lebensberatung Hall für Einzelpersonen Paare Beziehungen Design by Mauenbert Co. Template design by
197 Home
Hall in Tirol
... Home Im Aufbau Links Vereinschronik Modellbaugemeinschaft Hall i. Tirol Nur fliegen
198 Welcome to the Frontpage joomla
Hall in Tirol
Joomla! dynamische PortalEngine und ContentManagementSystem ... Unterer Stadtplatz A- Hall in Tirol + Home Anmeldung Chronik
musikschule-hall.at Joomla Joomla
199 Metallbau Hofmann Home Metallbau
Hall in Tirol
Metallbau Hofmann Home
m.metallbauhofmann.at Metallbau Hofmann Home
200 Mykon Technisches Büro MYKON OG
Hall in Tirol

201 Maschinenverleih LeihMair Geräteverleih Leihmaschinen
Hall in Tirol
... Geräteverleih in Hall in Tirol! Nur km östlich von Innsbruck sind wir sehr zentral gelegen. Wir möchten
Hall in Tirol
Physio Central Praxis für Physiotherapie und Osteopathie im Herzen von Hall. Ihre erste Adresse ... Osteopathie Global Diagnostics in Hall ? HiTech im ganzheitlichen Gesundheitsbereich Massage Atemtherapie
physio-central.at Peter Geisler Physiotherapie Physiotherapie Hall
203 Pharmador.at ? Startpage
Hall in Tirol
... · A- Hall in Tirol
204 Tiroler Rohre  TRM Tiroler Rohre GmbH Willkommen
Hall in Tirol
Tiroler Rohre entwickelt produziert und vermarktet Systeme aus duktilem Guss für den Wassertransport und ... einsetzbare Pfahlsysteme für den Spezialtiefbau gefertigt. An unserem Produktionsstandort in Hall in Tirol
pfahl-trm.at Willkommen Beim Spezialisten Für Duktilen Guss!
205 Spenglerei Glaserei Posch Klaus Spenglerei
Hall i. T.
Spenglerei Glaserei Posch Innsbruck Tirol Absam Hall Blechbearbeitung Blechd�cher Dachrinnen Handwerker Blechdachanstrich Verglasung Korrosionsschutz Fensterbleche
posch-klaus.at Spenglerei Glaserei Posch Innsbruck Tirol Absam Hall Blechbearbeitung
206 Home  PER TUTTI Cafe Pizzeria per
Hall in Tirol
PER TUTTI Cafe Pizzeria Ristorante Wir bieten Ihnen erstklassige italienische Küche in der schönen ... uns Sie in unserem wunderschönen Lokal in Hall in Tirol begrüßen zu dürfen. Erstklassige original italienische Küche
per-tutti.at Per Tutti Altstadt Hall In Tirol
207 Über mich
Hall in Tirol

Hall in Tirol
... Home über uns OJA in Tirol Kontakt Saline A Hall in Tirol officepojat www.pojat
209 Home Startseite Kaffeevertrieb Praxmarer GmbH
Hall in Tirol
Die Startseite des Kaffeevertriebs Praxmarer GmbH. ... Adresse lautet Löfflerweg Hall in Tirol Kontakt Praxmarer Kaffeevertreb GesmbH
210 Versicherungsmakler PF Hall in
Hall in Tirol
... Fleischmann OEG Weinfeldstrasse a A- Hall in Tirol T - F --
211 Mihalits Piroche Cosmetiques
Hall in Tirol

212 Willkommen auf der Startseite Psychologie
Hall in Tirol
Ing.Dr.Ulrike Hanko Systemische Praxis Coaching Supervision und Therapie
psychologie-tirol.at Psychologie Klinische Psychologie Gesundheitspsychologie Antiaggressionstrain
213 Shoes n feet ?
Hall in Tirol
Besuchen Sie shoes n feet in 6060 Hall in Tirol. In unserem Schuhgeschäft finden Sie ... Innsbruckerstr. Hall in Tirol
214 G.Moser Söhne
Hall in Tirol
... Schreibwaren G. Moser Söhne Oberer Stadtplatz A- Hall in Tirol Mo-Fr
215 Dinkhauser Kartonagen verpacken Dinkhauser Kartonagen GmbH Dinkhauser
Hall in Tirol
Dinkhauser ... packaging .. Weltkunstschau Datenschutzerklärung AGB Dinkhauser Kartonagen GMBH Hall
showpac.at Dinkhauser Verpackungen Verpackung Displays
216 Die Sprachdienstleister : Übersetzung
Hall in Tirol

217 TBE Hager Home Joomla
Hall in Tirol
Joomla the dynamic portal engine and content management system ... gutachtentbe-hagerat TBE Hager Joomla! is Free Software released under the GNU/GPL License.
tbe-hager.at Joomla Joomla
218 Terschl CNC Rohrbearbeitung
Bad Hall - Adlwang
... Gesellschaft m.b.H. Co KG - CNC Blech- Rohrbearbeitung - Terschlplatz - A- Bad Hall - Adlwang - Tel
219 Home
Hall in Tirol
... wurde am . September am Kurhausplatz in Hall durchgeführt. Kostenlos konnten dabei Jugendliche ihr Rad
220 Straub Schützen Hall
Hall in Tirol
... Hall INFOS .. Straubball mehr .. Schützenheim-INFO mehr
221 TKIES Schotterwerk Absam T-Kies GmbH & Co KG TKIES
Hall in Tirol
Wir betreiben an 2 Standorten (Absam und Ebbs) in Tirol einen Abbau von mineralischen Rohstoffen
t-kies.at TKIES Kies Steinbruch Absam
222 Die Sprachdienstleister : Übersetzung
Hall in Tirol

223 Aktuelle Theater Neuigkeiten
Hall in Tirol
... Kontakt Aktuelles vom Haller Theaterhaufen Casting Der Haller Theaterhaufen veranstaltet
224 STARTSEITE: Speckbacher Schützenkompanie Hall Josef
Hall in Tirol
Speckbacher Schützenkompanie Hall in Tirol ... Haller StaTTfest In Gedenken an Fred Hafner Leider müssen wir euch die traurige Nachricht
speckbacher-schuetzen.at Josef Speckbacher Schützen Schützenkompanie Hall
225 Theaterpädagogisches Zentrum Hall
Hall in Tirol

226 Alena Obleitner Künstlerin
Hall in Tirol
Sie finden auf dieser Seite Informationen rund um die akademische Malerin Alena Obleitner. ... der Haller Künstlerin. Diese Seite kann nur mit aktiviertem JavaScript korrekt angezeigt werden. kontakt Ã
227 Home TCC Studentenheim GmbH
Hall in Tirol
... Herzlich Willkommen im Studentenheim am Universitätscampus in Hall in Tirol! Wohnen und Studieren
228 Canal Co. Aktuell CANAL & Co. KG
Hall in Tirol
Canal Co. Alles für den Bau. Der Tiroler BauwarenProfi mit Baufachmärkten in Hall ... gerecht werden. Unsere Baumärkte in Hall in Tirol und Pfaffenhofen runden das Angebot für unsere Kunden
229 Pizza Hall in Tirol
Hall in Tirol
... PIZZA UND KEBAP in Hall in Tirol Bitte installieren Sie den Flash Player und aktivieren
230 Startseite Tickets London
Hall in Tirol
... Warteliste! FC Bayern München Alle Spiele erhältlich! Tickets Tours ? Thaurer ? A- Hall
bundesligakarten.at London 2012 Tickets Olympia
231 Home Cashcom Abrechnungssysteme GmbH
Mils bei Hall i.T.

232 Hall AG Camping Stadt Hall in Tirol Immobilien GmbH Schwimmbad
Hall in Tirol
... Sie in unmittelbarer Nähe der historischen Altstadt Hall in Tirol Stellplätze im Grünen auf insgesamt . m
camping-hall.at Schwimmbad Camping Hall In Tirol Camping Hall
233 Mike Brötz mike
Hall in Tirol

broetz.at Mike Brötz Architekt Design Möbel
234 ATUM Ensemble
Hall in Tirol

235 Auto Hollaus Auto
Hall in Tirol
... Auto Hollaus - Hall - Tirol Navigation überspringen Auto Hollaus Über uns Fahrzeughandel
236 Hotel Garni Bergheim in der PRESSETEXTER Text- und Kommunikationsagentur GmbH Hotel
Hall in Tirol
Urlaub im Hotel Garni Bergheim in Sölden Ötztal. Buchen Sie Ihren Skiurlaub in Sölden
bergheim-soelden.at Hotel Garni Bergheim Sölden Ötztal Tirol Oesterreich Österreich
237 Bezirkskrankenhaus Hall Anästhesie Bezirkskrankenhau
Hall in Tirol
Anaesthesie Bezirkskrankenhaus Krankenhaus BKH Hall Intensivmedizin öffentlich allgemein Medizin Klinik Genesung Schmerztherapie Tirol
anaesthesie-hall.at Bezirkskrankenhaus Hall Tirol
238 Country Home Style Schloss Mühlgrub Betriebs GesmbH
Pfarrkirchen bei Bad Hall
Im Schloss Mühlgrub in Pfarrkirchen bei Bad Hall/Oberösterreich finden Sie COUNTRY HOME STYLE. In diesem außergewöhnlichen ... Trendset München . ? . Jänner Halle B Stand B Creativ Salzburg . Februar ? . März
239 ORDINATION Dr. Christoph Harpf
Hall in Tirol
Dr. Harpf Venen Ästhetik Chirurgie aus Hall in Tirol meine Schwerpunkte Plastische ... für Plastische Chirurgie Facharzt für Gefäß-Chirurgie Gerbergasse Hall in Tirol T +
dr-harpf.at Harpf Hall Tirol Chirurg
240 Cultuhr wir drehen für
Hall in Tirol
... nicht für bereits ermäßigte Tarife. Münze Hall Münzerturm - Museum Goldenes Dachl Innsbruck - Silberbergwerk
Hall in Tirol
... Auto Hollaus Burgfrieden Hall in Tirol Willkommen ISUZU D-Max SingleCab
242 Der Hundeladen
Hall in Tirol
... DAS ANGEBOT KONTAKT Schlossergasse A - Hall in Tirol Öffnungszeiten MO Ruhetag DI-FR
Hall in Tirol

244 Über mich
Hall in Tirol

245 Feuerwerk und Raketen
Hall i. Tirol
... über für sie auf Lager. Unser Feuerwerk-Verkaufsstand in Hall in Tirol ist ab . Dezember wieder für Sie geöffnet
246 Flörl :: Metallbau und FLÖRL Ges.m.b.H.
Hall in Tirol
Metallbau und Kunstschlosserei. ... Ges.m.b.H. Metallbau + Kunstschlosserei Kugelanger A- Hall in Tirol t. + f. + (
247 Tiefkühlservice Freund Eskimo
Hall in Tirol
... ? A- Hall in Tirol ? - - ? . - - ? verkauffreund
248 Feuerwehr Pfarrkirchen Feuerwehr
Pfarrkirchen bei Bad Hall
Feuerwehr Pfarrkirchen Worauf du dich verlassen kannst. ... unserer Wehr absolvierten die Atemschutz-Leistungsprüfung der höchsten Stufe in Gold in Bad Hall
ff-pfarrkirchen.at Feuerwehr Pfarrkirchen FF Pfarrkirchen Freiwillige Feuerwehr
249 HOME Aristos Druckzentrum GmbH
Hall in Tirol

250 Alpenhelis Projektpage
Hall in Tirol

251 Home keywords1
Hall in Tirol
description of the website ... geologen Saline Hall in Tirol + + - officegeo-zt
geo-zt.at Keywords1 Keywords2 Keywords3 Keywords4 Keywords5
252 Mode von Feucht  Mode von Mode von Feucht GmbH
Hall in Tirol
... Mode von Feucht GmbH Zentrale Schergentorgasse · A- Hall in Tirol Telefon +
253 Fotograf markus mair :: fotografie
Hall in Tirol
fotografie markus mair innsbruck spezialfotografie ... aus der Baustellenpraxis >>> www.fotograf-mair Hall Bei der Säule infofotograf-mair + (
fotograf-mair.at Fotografie Spezialfotografie Hochbildfotografie Aug Am Stiel Hochstsativ Hall
254 Tierarzt Anker Hall
Hall in Tirol
... - Röntgen Labor Chirurgie Komplementärmedizin Zähne; Bruckergasse - A- Hall i.T. - +
255 Salzraum hall Stadt Hall in Tirol Beteiligungs AG
Hall in Tirol
... start salzlager kurhaus burg hasegg münze hall anreise links kontakt impressum deutsch ? englisch
256 Scheinwerfer Licht + Scheinwerfer
Hall in Tirol
... Kontakt Ing. Michael Cazzonelli Eugenstraße A- Hall in Tirol T + Mob + (
scheinwerfer-c.at Scheinwerfer Licht + Beratung Ing. Michael
257 SCHLOSS MÜHLGRUB Schönes Schloss Mühlgrub Betriebs GesmbH
Pfarrkirchen bei Bad Hall
Im Schloss Mühlgrub in Pfarrkirchen bei Bad Hall/Oberösterreich finden Sie COUNTRY HOME STYLE. In diesem außergewöhnlichen
258 Univ. Prof. Dr. Dr.
Hall in Tirol
bei Univ. Prof. Dr. Dr. Siegfried Jank Facharzt fü Mund Kiefer und Gesichtschirurgie. ... Jank Facharzt für Mund- Kiefer und Gesichtschirurgie Behaimstr. A- Hall in Tirol
259 Grußkarten Trauerbillets Grußkarten
Hall in Tirol
... weiter zum Shop Firmenkunden Passwort Passwort anfordern Watzek Photografie Salvatorgasse Hall
kikicard.at Grußkarten Grußbilletts GrußKarten GrußBilletts
260 Round Table 25
Hall in Tirol
... überspringen Round Table Charity Ball am Samstag den .. im Kurhaus Hall Seit mehr als Jahren feiert
261 Restaurant Restaurant Schwarzer Adler
Hall in Tirol
... Speisekarte Öffnungszeiten Kontakt Restaurant Schwarzer Adler - Hall in Tirol Bereits ab
262 Videodreh Filmproductions Ihr
Hall in Tirol
Home ... ist eine Videoproduktionsfirma mit Sitz in Hall in Tirol. Unser Produktionsteam besteht aus mehreren erfahrenen Kameramännern
videodreh.at Ihr Ansprechpartner Für Fimproduktionen
263 WESTCAM Datentechnik Technologien WESTCAM Datentechnik GmbH
Mils bei Hall
Die WESTCAM Datentechnik unterstützt seit fast 25 Jahren Unternehmen die innovative Produkte entwickeln oder
264 Home
Bad Hall - Adlwang
Willkommen bei Wolf Historc Racing
265 Installateur TUSCH Hall TUSCH Installations Ges.m.b.H.
Hall in Tirol
Installateur TUSCH Ihr Meisterbetrieb seit über 120 Jahren im Herzen von Hall in Tirol ... HALL in TIROL ? ZOLLSTRASSE TEL. ? FAX - officetusch-hall Sie befinden
266 Homepage Glungezer Gastronomie KG
Hall in Tirol
... sich Hannes nach einer "Dependance" in Hall in Tirol um Hier ergriff der Zufall das Zepter
267 Kühltransporte Martin Wegscheider in Martin Wegscheider e.U.
Hall in Tirol
... in Hall i. T. können wir sämtliche Transporte innerhalb von bis Stunden garantieren
268 Union Innsbruck / upc
Hall in Tirol

269 Klasseneinteilung Turmlauf Hall in
Hall in Tirol
... und Video Kontakt Gästebuch Newsletter Haftungsausschluss webdesign . Raiffeisen Turmlauf Hall
270 Blumen Neuner joomla
Hall in Tirol
Joomla! dynamische PortalEngine und ContentManagementSystem ... Über uns Kontakt Home / Blumen Neuner Krippg Hall in Tirol Copyright . All Rights Reserved. powerd
blumenneuner.at Joomla Joomla
271 Dinkhauser Kartonagen verpacken Dinkhauser Kartonagen GmbH Dinkhauser
Hall in Tirol
Dinkhauser ... packaging .. Weltkunstschau Datenschutzerklärung AGB Dinkhauser Kartonagen GMBH Hall
boxanova.at Dinkhauser Verpackungen Verpackung Displays
272 Univ. Prof. Dr. Dr.
Hall in Tirol
bei Univ. Prof. Dr. Dr. Siegfried Jank Facharzt fü Mund Kiefer und Gesichtschirurgie. ... Jank Facharzt für Mund- Kiefer und Gesichtschirurgie Behaimstr. A- Hall in Tirol
273 Wohnskulptur Wolfgang Wallner Möbel
Hall in Tirol
wolfgang-wallner.at Möbel Lichtobjekt Vintage Skulptur
274 Home Zimmerei Thurner Thurner Zimmereiunternehmen GesmbH
Hall in Tirol
... Schlöglstraße Hall in Tirol + officezimmerei-thurner
275 Kolpingsfamilie Hall in Tirol
Hall in Tirol
... Kolpingsfamilie Hall in Tirol verantwortlich leben ? solidarisch handeln Home Wer
276 Univ. Prof. Dr. Dr.
Hall in Tirol
bei Univ. Prof. Dr. Dr. Siegfried Jank Facharzt fü Mund Kiefer und Gesichtschirurgie. ... Jank Facharzt für Mund- Kiefer und Gesichtschirurgie Behaimstr. A- Hall in Tirol
277 Aktuelles hak
Hall in Tirol
Die Handelsakademie Hall ist eine Wirtschaftsschule welche nach 5 jähriger Vorbereitung aufs Wirtschaftsleben mit ... Erstellt . November Weiterlesen... Absolventin der HAK Hall unter den Preisträgern ..r BTV Dr
hak-hall.at Hak Has Hall Ausbildung
278 Ideenweberei OG Ideenweberei OG Ideenweberei
- Hall in Tirol
ideenweberei OG eine full service Werbeagentur mit dem Schwerpunkt "Web" und dem Fokus auf open ... in einem kurzen Video zusammen. Read More... Ideenweberei OG Saline Hall i. Tirol +
ideenweberei.at Ideenweberei Ideenweberei Ideenweberei OG Ideen
279 Metallbau Hofmann Home Metallbau
Hall in Tirol
Metallbau Hofmann Home
m.metallbau-hofmann.at Metallbau Hofmann Home
280 Mammagyn ? Univ. Prof. Mamma
Hall in Tirol
Homepage von Univ. Prof. Dr. Susanne Taucher Fachärztin für Gynäkologie und Geburtshilfe Fachärztin für Chirurgie
mammagyn.at Mamma Taucher Susanne Gynäkologie Geburtshilfe Gynäkologie Gyn Chirurgie
281 Mihalits Piroche Cosmetiques Anna Mihalits OG
Hall in Tirol

282 Www.sachverständigerunfallchirurgie.at Sachverständiger
Hall in Tirol
Sachverständiger Unfallchirurgie Dr. med. R. Hrubesch
sachverstaendiger-unfallchirurgie.at Sachverständiger Unfallchirurgie Gutachten Hrubesch
283 Über mich Hall
Hall in Tirol
Über den Haller Künstler Siegfried Obleitner
siegfriedobleitner.at Hall In Tirol Malerei Plastik
284 Salzraum hall Stadt Hall in Tirol Beteiligungs AG
Hall in Tirol
... start salzlager kurhaus burg hasegg münze hall anreise links kontakt impressum deutsch ? englisch
285 Dr. Christian und Ursula Knie
Hall in Tirol
Dr. Christian Zangl Facharzt für Orthopädie und orthopädische Chirurgie Schwerpunkt: Arthroskopie minimalinvasive
orthoclinic.at Knie Hüfte Knieprothese Hüftprothese
286 Rathauscafe Hall Hall Kili Gastro GmbH
Hall in Tirol
... HOME HOCHZEITEN FOTOS KONTAKT HOME Willkommen im Rathaus Cafe Hall in Tirol Wir freuen
287 ELkinet Mauertrockenlegung Mauerentfeuchtung Mauertrockenlegun
Hall in Tirol
Firma zur professionellen Mauerentfeuchtung und Mauertrockenlegung mit Elektroosmose. HOTLINE: +43 (0)5223 90 344. ELkinet Mauertrockenlegung ... )das erfolgreiche Traditionsunternehmen mit Sitz in Hall in Tirol. Zufriedene ELkinet-Kunden anmehr als .
elkinet-mauertrockenlegung.at Mauertrockenlegung Elektroosmoose Mauerentfeuchtung ELkinet Mauertrockenlegung
288 Home joomla
Hall in Tirol
Joomla! dynamische PortalEngine und ContentManagementSystem ... ein Unternehmen der SCHMIDT´S Gruppe Schlöglstraße A- Hall in Tirol ++ ++(
hb-technik.co.at Joomla Joomla
289 Fertighaus in Massivbauweise | Massivhaus GmbH
Hall in Tirol
Das Bauunternehmen in Innsbruck bietet schlüsselfertige Häuser in Massivbauweise. Kompetent schnell fixtermin ... MASSIVHAUS GmbH Obere Lend Hall in Tirol + + info
290 Hall in Tirol
Hall in Tirol
... Hall in Tirol - Haller Stadtrundgänge Seit gibt es die beliebten Haller Stadtrundgänge
291 Tirolinside.at Home ideenweberei OG
Hall i. T.
... ? SOUNDKILLAZ X-MAS SPECIAL Kulturlabor Stromboli Hall in Tirol Österreich Kulturlabor Stromboli Last
292 WALCH music Home Eventgestaltung
Hall in Tirol
WALCH music Aldrans ... Home Salinenmusik Hall Ensembles Videos Bildergalerien Termine Downloads Gästebuch Kontakt
walch-music.at Eventgestaltung Event Veranstalter Party
293 Dr. Christian und Ursula Knie
Hall in Tirol
Dr. Christian Zangl Facharzt für Orthopädie und orthopädische Chirurgie Schwerpunkt: Arthroskopie minimalinvasive
sportho.at Knie Hüfte Knieprothese Hüftprothese
294 . : S T
Hall in Tirol

295 UnternehmensberatungHall Startseite
Hall in Tirol
... Willkommen bei der Unternehmensberatung-Hall Unternehmensberatung-Hall steht für qualifizierte
296 Event Catering Partyservice Menüservice Mohr KG Menüservice
Hall in Tirol
Express Event Catering Partyservice in Innsbruck in Tirol. Wir bieten Catering für Events ... Partyservice Essen Online Bestellen Kontakt Menüservice Mohr KG Schopperweg A- Hall in Tirol +
msmohr.at Menüservice Mohr
297 Mag. Monika Planer
Hall in Tirol
... Mag. MONIKAÂ PLANERÂ Lendgasse a Hall in Tirol officemonikaplaner + (
298 Home mtb
Hall in Tirol
mountainbike-innsbruck.at Mtb
Hall in Tirol
... Auto Hollaus Burgfrieden Hall in Tirol Willkommen ISUZU D-Max SingleCab
300 AAB Hall in Tirol
Hall in Tirol
... Suchbegriff Startseite Inhalt Kontakt Datenschutz Druckansicht AAB-Info AAB-Info (Hall
301 Home MultipleVoices Hall
Hall in Tirol
... Vorstand Unser Repertoire Unsere Förderer Kontakt Kalender Anfrage Home Chor Multiple Voices Hall in Tirol
302 Home MTP - Medizin Technik Planungs GmbH MTP
Hall in Tirol
MTP Medizintechnik Planungs GmbH Planung und Beratung für Einrichtungen des Gesundheitswesens
mtpgmbh.at MTP MTPGmbH Mtpgmbh Mtp Medizintechnikplanung Medizin Medizintechnik Planung
303 Münze Home Hall.AG
Hall in Tirol
Hall.AG ... A A A Webcam Falken Toursimusverband Hall-Wattens facebook Media Presse Münze Hall AG
muenze-hall.at Hall.AG
304 Huber Schaltanlagen Startseite Huber Schaltanlagen Ges.m.b.H. & Co KG
Hall in Tirol
... von Schaltanlagen. Huber Schaltanlagen Ges.m.b.H Co. KG Kugelanger Hall in Tirol Österreich Telefon +
305 Startseite Pfarrkirche St.
Hall in Tirol
Sanierung Pfarrkirche St. Nikolaus Hall in Tirol. ... Navigation überspringen Homestartseite Kulturgutherzstück-geschichte-hall in tirol
306 Kultur ist unsere Natur
Hall in Tirol
... im Riesen? in den Swarovski Kristallwelten. >> mehr Sprachsalz Hall Bei den Internationalen
307 Herzlich willkommen ? Immoblienpickerl
Hall in Tirol

308 Arbeits und Organisationspsychologie
Hall in Tirol
Arbeitspsychologie BurnoutPrävention Stressbewältigung Kommunikation Kurse Trainings und Coachings für Firmen ... .-Prof. Bernhard Güntert Leiter Institut für Management und Ökonomie im Gesundheitswesen der UMIT Hall
309 KISStroyer Österreichs heißeste
Hall in Tirol
KISStroyer! Die Adresse wenn es um die beste Kiss Coverband aus Tirol in Österreich
310 PizzaKebapBurger Restaurant il
Hall in Tirol
... Kunden Aktuelles Kontakt Online-Bestellung Restaurant il Mondo Hall in Tirol Besuchen Sie uns in unserem
311 EDV Stognief EDV
Hall in Tirol
Stefan Stognief Hall in Tirol ... -Dienstleistungen Galgenfeldstraße Hall in Tirol Austria Kontakt Rufen Sie einfach an unter +
stognief.at EDV IT Service Computer
312 Barrierefreie Kommunikation und barrierearme Text- und Kommunikationsagentur GmbH
Hall in Tirol
b'kom steht für barrierefreie Kommunikation und hilft Ihnen bei der barrierefreien und barrierearmen Aufbereitung Ihrer
313 Beside me Zuchtstätte Beside
- Hall in Tirol
Hundezucht Labrador Züchter Retriever
beside-me.at Beside Me Hall In Tirol Zuchtstätte
314 Psychologin Coaching
Hall in Tirol
Wohlbefinden Glück Zufriedenheit Erfolg Selbstvertrauen und emotionale Balance sind Ziel meiner ... in Hall in Tirol MAG. JULIA GHERI Klinische und Gesundheitspsychologin Arbeitspsychologin Mentalcoach info
315 Die Sprachdienstleister : Übersetzung
Hall in Tirol

316 Bellness Oase
Hall in Tirol
Home/ Sie suchen einen Hundesalon Katzensalon bzw. Hundefriseur in Tirol? Innsbruck Schwaz ... und sich nicht auf einer einmaligen Ausbildung ausruht? Dann sind Sie in Hall in Tirol richtig! Informieren Sie sich auf folgenden
317 B.R. Logistik | Transport B.R. Logistik International GmbH Hall
Hall in Tirol
Wenn Sie ein zuverlässiges Logistikunternehmen suchen wenden Sie sich an B.R. Logistik. Das Team ... auch Sie auf B.R. Logistik mit Sitz in Hall in Tirol. Aufgrund unserer langjährigen Erfahrung in Bereichen
brlogistik.at Hall In Tirol 6060
318 Willkommen bei Dialogo Logopädie
Hall in Tirol
Praxis für Logopädie und Lektorat in Hall in Tirol. Das Therapieangebot umfasst alle Störungsbilder. ... Schinderegg Hall in Tirol Telefon + infodialogo Dialogo
dialogo.at Logopädie Innsbruck Hall Wattens
319 Home Permanent
Hall in Tirol
Permanent Make up Microblading Visagistik Ich habe mich als Permanent Stylistin/Visagistin weitergebildet
elras.at Permanent Make Up Microbladin Visagist
320 Die Sprachdienstleister : Übersetzung
Hall in Tirol

321 Home Duftatelier
Hall in Tirol
... View the embedded image gallery online at http//www.duft-atelier/#sigProIdccee
322 Fischschmied'n fischschmiedn
Pfarrkirchen bei Bad Hall
Neben dem Verkauf von vielen Fischarten bieten wir Ihnen genauso Hilfe und Informationen Rund um
fischschmiedn.at Fischschmiedn Besatzfische Fische
323 Willkommen
Hall in Tirol
... . Aktuelles Ihre Kinderzahnärztin in Hall in Tirol Dr. med. dent. Brigitte Brückner Zahnärztin für Kinder
324 VocHall Kolpingchor homepage
Hall in Tirol
homepage dokument webpage page web netz ... aus Hall in Tirol ! Der Kolpingchor Hall entstand im Jahre die Chorleitung und die Zusammensetzung
vochall.at Homepage Vochall Chor Chor Aus Hall
325 TAXI Hall in Tirol
Hall in Tirol
... Fuhrpark Region Hall-Wattens Partner Kontakt Taxi Hall in Tirol - Robert Rohregger Ihr Taxi
326 Citynet Home Stadtwerke Hall in Tirol GmbH Internet
Hall in Tirol
Internet Tirol Citynet Telefonie virtuelle Server Homepage Domain Tyrol Fernsehen Regional lokal schnell flexibel ... A A A Privat Business Kundenportal Webmail Media Presse Downloads Citynet Hall AG
citynet.at Internet Tirol Citynet Telefonie Virtuelle Server Homepage Domain
327 Canal Co. Aktuell CANAL & Co. KG
Hall in Tirol
Canal Co. Alles für den Bau. Der Tiroler BauwarenProfi mit Baufachmärkten in Hall ... Baugewerbe gerecht werden. Unsere Baumärkte in Hall in Tirol und Pfaffenhofen runden das Angebot für unsere
328 Mode von Feucht  Mode von Mode von Feucht GmbH
Hall in Tirol
... Zentrale Schergentorgasse · A- Hall in Tirol Telefon + +
329 Immobilien Tirol Wohnanlage Immo-Bau Vermietungs und Verpachtungs GmbH
Mils bei Hall in Tirol
... - Wir machen Menschen glücklich! Willkommen beim Immobilien-Spezialisten Immobau GmbH in Mils bei Hall in Tirol nähe
330 Dr.med.univ. Klemens Trojer ::: klemens
Hall i. Tirol - Austria
Praxis fuer Psychiatrie
psychiater-trojer.at Klemens Trojer Praxis Psychiatrie Gesundheit
331 AS Electronicdesign Ing. AS Electronicdesign ? Ing. Andreas Schinner e.U.
Hall in Tirol - Austria

332 Plus Kassenservice GmbH Plus Kassenservice GmbH
Mils bei Hall in Tirol


Ergebnisse der Bewertungen für die Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Hall:
128 Bewertungen ergeben 4 StadtBranche Punkte

Steiermark ▪ 8911

Hall steht für:

Weng bei Admont8911
Hall Stadtplan Steiermark