Österreich › Ort

Sankt Leonhard › Salzburg › Österreich › 5083 Erfahrungen

Branchenbuch Sankt Leonhard

5083 Salzburg

Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 GASTROdat - Hotel Software Hotelsoftware

Der Allrounder für die digitale Verwaltung von Hotels! GASTROdat bietet eine umfangreiche Hotelsoftware in Österreich unabhängig von der Betriebsgröße an...
gastrodat.com/ Hotelsoftware Cookie Name Tools Hotels Datenschutzerklärung Nutzung Anbieter Zimmer Zweck Website Marketing Inhalte Laufzeit Software
2 Dr. Molnar Lungenfacharzt Lungenfacharzt

Lungenarzt und Internist Dr. Clemens Molnar in Anif bei Salzburg bietet in seiner Praxis umfassende Behandlungen im Bereich der Pneumologie...
praxis-molnar.at/ Molnar Dr Anif Medizin Innere Facharzt Salzburg Pneumologie Praxis Clemens Kontakt Lungenfacharzt Pneumologe Pulmologe Team
3 island2go GmbH Marktplatz Für

DER kostenlose Anzeigenmarkt für ganz Mallorca: Die Verkaufsplattform island2go ist besonders für deutschsprachige Inselbewohner. Jetzt einfach online Kaufen und Verkaufen..
marktplatz-auktionen-kleinanzeigen-mallorca.com/ Mallorca Kleinanzeigen Marktplatz Auktionen Online Artikel Shops Informationen Neben Verkaufsplattform Verkäufers Top Shop Onlineshop Kontakt

Spezialisiert auf den Handel von CBD Öl und CBD Tropfen in unterschiedlicher Konzentration sind wir bestrebt die Lebensqualität unserer Kunden..
alpencbd.at Salzburg Bio Alpen Schnell Umgebung Event Stringfrom Arial Arrayflag
5 Harsch - Umzug Basel Umzug

Unsere ausgewiesene Erfahrung in den Bereichen Kunsttransport und internationale Umzüge bedeutet auch für Ihren lokalen Umzug einen echten Mehrwert. Gewiss..
harsch.ch/de/umzug-basel/ Umzüge Zug Umzug Firma Harsch Basel Schweiz Kunstwerke
6 Harsch - Umzug in Umzug

Es gibt tausenderlei Lösungen für einen Umzug in Zürich. Ohne Besichtigungstermin in Ihrem Zuhause ist es deshalb schwierig, eine genaue..
harsch.ch/de/umzug-zurich/ Umzug Zürich Harsch Umzüge Schweiz Umzugsunternehmen Kunstwerke Umz Vaud Firma Zug Basel Gland Zurich Gen
7 Stelzl Yachtcharter Yachtcharter

Mit Stelzl Yachtcharter in der Türkei, Griechenland, Kroatien sowie Mallorca, Italien und der Karibik segeln: Chartern und mieten Sie eine..
stelzl-yachtcharter.at/ Italien Stelzl Griechenland Türkei Kroatien Yachtcharter Karibik Mallorca Me Segeln Date Nexece Mieten Buchen Segelschiff
8 Müller Metall Metallbau

Seit über 15 Jahren haben wir uns auf die Metallverarbeitung spezialisiert. Dabei unterstützen wir Unternehmen u.a. aus dem Maschinen-, Anlagen-..
mueller-metall-form.de/ Metallverarbeitung Müller Metall Form Köln Spezialisten Ihr Blechverarbeitung Edelstahl Baugruppenfertigung Blech Inhaber Gehäuse Spezialist Angebot
9 Beller Hof Landwirtschaftliche Erzeugnisse

Beller Hof - der sympathische Gutshof am Rande von Köln. Frischer Spargel, Erdbeeren, Kirschen und Weihnachtsbäume direkt vom Erzeuger. Der..
beller-hof.de/ Spargel Hof Beller Erzeuger Erdbeeren Köln Gutshof Player Hofladen Saison Ende Radtour Eichholz Narzissenblüten Hofläden
10 Eintragung von Starglizz Kosmetik Hautpflege

Starglizz liefert das SPA direkt zu dir nach Hause. Mit der Schönheitsbox verwöhnst du deine Haut & lässt sie in..
starglizz.com Haut Editor Leben Zeit Balance Your Celebrate Beauty Matchen Mixen Schönheitsreinigung Streicheleinheit Peeling Du Power
11 Schorr Elektrokontrollen und Beratung Elektrokontrollen

Sie haben von Ihrem Netzbetreiber das Aufgebot zur Periodischen Elektrokontrolle erhalten? Wollen eine Liegenschaft verkaufen oder haben gegebenfalls eine gekauft?..
schorr-kontrollen.ch Elektrokontrollen Home Sicherheitsnachweis Kontrollen Periodischen Beratung Gewerbe Installationen Schorr Ihrem Periodische All Starkstromverordnung Gebäude Unslang
12 Zahnärzte Amodent Zahnarzt

Graz, 02. Bezirk: Sankt Leonhard Graz
Ihr Zahnarzt in Graz Leonhardstraße 56. Die Praxisgemeinschaft Amodent bietet allgemeine Zahnheilkunde und Kieferorthopädie unter einem Dach. Für eine optimale..
amodent.at Graz Amodent Prophylaxe Assistentin Zähne Team Zahnarzt Tage Termin Zhne Schwellungen Wunde Zahnärztliche Prof Behandlung Zahnärzte Straß Jahren Wattestbchen
13 Loogo Umzüge Österreich Umzüge

Mit LOOGO sparen Sie Zeit und Nerven. Überlassen Sie Ihren Umzug den Profis von LOOGO! Profitieren Sie von unserer Organisation und..
loogo.at Umzug Möbel Kartons Möbelküche * + Umzugsunternehmen Privatumzug Angebot Firmenumzug Verpackungsmaterial * Umzüge Loogo Kartons * Lkw * Internationaler Neumöbel Abholung Karton Rechner Demokratischevolksrepublikkorearepublikkroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmauretanienmauritiusmazedonienmexikomikronesienmoldawienmonacomongoleimontenegromosambikmyanmarnamibianaurunepalneuseelandnicaraguaniederlandenigernigerianiuenorwegenösterreichomanosttimorpakistanpalästinensischeautonomiegebie
14 Gebäude- und Liegenschaftsbetreuung Lukaroski Hausbetreuung -

Gebäude- und Liegenschaftsbetreuung Lukaroski in Grödig. Unser Unternehmen bietet allgemeine und spezielle Reinigungen aller Art für Gebäude, Liegenschaften und Grünflächen..
15 Hausbetreuung Gebäude- und

Gebäude- und Liegenschaftsbetreuung Lukaroski in Grödig. Unser Unternehmen bietet allgemeine und spezielle Reinigungen aller Art für Gebäude, Liegenschaften und Grünflächen..
16 Inter Fahnen Beachflags & Fahnen

Grödig - Fürstenbrunn
Alle Beachfahnen, Beachflags und Werbefahnen sowie Stoffbanner von Inter Fahnen in Salzburg Österreich. Dekofahnen, Transparente im Großformatdruck und Tischwimpel zählen..
interfahnen.com/ Beachflag Display Zipper Tischwimpel Fahnen Rollup Transparente Inter Beachflags Kafka Werbefahnen Startnummern Trikotnummer Fahnenmasten Stoffbanner Bowwing Dali
17 BAUFuzzi dein online Baumarkt Baustoffhandel

BAUFuzzi - Ihr Baustoffhandel Shop wenn es um Qualitätsmaterial zu günstigen Preisen geht. Wir liefern Ihnen die Baustoffe, das Baumaterial..
18 BAUFuzzi dein online Baumarkt Baustoffhandel

BAUFuzzi - Ihr Baustoffhandel Shop wenn es um Qualitätsmaterial zu günstigen Preisen geht. Wir liefern Ihnen die Baustoffe, das Baumaterial..
19 Kalender für 2017 drucken Druckerei

DruckDiscount24.de bieten verschiedene Möglichkeiten an, individuelle Kalender für 2017 drucken zu lassen. Dafür stehen unterschiedliche Produkte, Formen und Varianten zur..
druckdiscount24.de/kalender-2017 Kalender Object Druckdiscountde Drucken Gratis Mail Leistungen Warenkorb Mein Dateivorgaben Here Tischplaner Wandkalender Wandplaner Schreibunterlagen Wire Bindung Visitenkarten Format Fehler Adresse* Vorname Pdfsherunter Datenschutzerklärung
20 Inter Fahnen Beachflags & Fahnen Textildruck

interfahnen.com/ Beachflag Tischwimpel Fahnen Transparente Inter Rollup Kafka Werbefahnen Beachflags Aufnäher Startnummern Stoffbanner Beachfahnen Fahnenmasten Trikotnummer Wappenform Bowcross Zweiteilige Startnummer
21 Inter Fahnen GmbH Druckerei

Inter Fahnen Stoffbanner, Beachfahnen und Beachflags sowie Werbefahnen und Fahnen – Produkte von Meisterhand. Inter Fahnen Salzburg, Österreich fertigt Dekofahnen..
interfahnen.com/ Fahnen Werbefahnen Rollup Inter Transparente Beachflags Beachfahnen Stoffbanner Dekofahnen Display Fahnenmasten Kafka Tischwimpel Salzburg Startnummern Cross Eco Xl
22 LAND-LEBEN Suppeneinlagen und Tiefkühlprodukte Nahrungsmittel

LAND-LEBEN Nahrungsmittel, Hersteller von Suppeneinlagen wie Backerbsen und Frittaten. Neben Suppeneinlagen produziert LAND-LEBEN auch weitere Convenience-Produkte wie Semmelknödel, Knödelbrot und..
land-leben.com/ Leben Land Croutons Backerbsen Suppeneinlagen Frittaten Semmelbrösel Rezepte Knödelbrot Salat Semmelknödel Pasteten Blog Snacks Sowie Buttermilch Suppe Kalte
23 Career Based Services Österreich Personalmarketing

Frischer Wind im Personalmanagement, Recruiting und Employer Branding: Employer Brand Manager Andrea Starzer zeigt mit Career Based Services, wie Online..
career-based-services.com/ Based Career Services Personalmarketing Employer Marketing Branding Andrea Karriere News Starzer Recruiting Jobshui Social Dienste Kalender
24 Aniferhof Hotelbetriebs GmbH Hotel

Der Aniferhof ist ein Hotel & Pension vor den Toren der Stadt Salzburg. Vom Hotel Aniferhof sind es nur wenige..
aniferhof.at/ Z Permanently The Server Pension Port Hotel Anif Officeaniferhofat Apache Advice Legal Friesacherâ´s Aniferhof
25 Skidata AG

Immer auf dem neusten Stand mit den Karriere News von SKIDATA: der Innovationsführer für Zutrittslösungen, Ticketsysteme und Parksysteme mit Sitz..
skidata.com/ueber-skidata/karriere.html Skidata Karriere Unser Stellen Offene Für Einblick Software Softwareentwicklung Jobs Stellenangebote Produktübersicht über Schüler Jobportal Lehrberufe Programmierer Ihrem Informiert
26 SKIDATA Careers Jobs

The software and hardware company SKIDATA, headquartered in Grödig, near Salzburg, Austria, has software development and hardware development jobs and..
skidata.com/en/about-skidata/career.html Skidata Career Open Areas Insight Contact Product Working Apprenticeship Job Portal Positions Attractions Meet Jobs Privacy Future Espaã±a Innovative
27 Inter Fahnen GmbH Druckdienstleistungen

Alle Beachfahnen, Beachflags und Werbefahnen sowie Stoffbanner von Inter Fahnen in Salzburg Österreich. Dekofahnen, Transparente im Großformatdruck und Tischwimpel zählen..
interfahnen.com/ Fahnen Inter Rollup Werbefahnen Transparente Beachflags Stoffbanner Beachfahnen Tischwimpel Aufnäher Fahnenmasten Display Beachflag Trikotnummer Kafka Change Produkte Dekofahnen
28 Friesacher Immobilien GmbH Anif Immobilien

Die Friesacher Immobilien GmbH hat Ihren Sitz in Anif bei Salzburg Österreich. Von hier aus werden österreichweit Immobilien wie Wohnung..
friesacher-immobilien.at/ Immobilien Salzburg Kauf Häuser Miete Anif Friesacher Villen Baugrund Wohnungen Wohnen Grundstücke Immobilienangebote Mietwohnungen Eigentumswohnungen Telefon Strae
29 PromoMasters Online Marketing Suchmaschinenoptimierung SEO

PromoMasters ist Spezialist für Suchmaschinenmarketing, Suchmaschinenoptimierung SEO, Suchmaschinenwerbung SEA und AdWords. Die Agentur mit Sitz in Salzburg und Wien verbessert..
promomasters.at/ Promomasters Marketing Suchmaschinen Suchmaschinenoptimierung Blog Internet Seminare Google Employer Social Firmen Schulung Meta Branding Adwords Keyword Advertising Zahnarzt Praxis Touristiker

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Sankt Leonhard

+ Kommentar oder Kleinanzeige für Sankt Leonhard eintragen!

30 Artikelliste ZUMBAWEAR(R) Artikel ZUMBAWEAR
Artikelliste ZUMBAWEAR(R)
zumbawear-salzburg.at ZUMBAWEAR Salzburg Zumbaklamotten Zumbakleidung
31 RetteiMaskenWillkommen Andreas

rettei-masken.at Andreas Rettenbacher Salzburg Groedig
32 Anatomie Atlas Erlebnis anatomie
St. Leonhard
Online Version des populären Anatomie Atlas Erlebnis Mensch. Eine faszinierende Darstellung des menschlichen Körpers mit
erlebnis-mensch.at Anatomie Atlas Anatomie Körper Mensch
33 Willkommen bei Gerhard Bayer Gerhard
St. Leonhard
Willkommen bei Gerhard Bayer Training
gerhard-bayer.at Gerhard Bayer Burnout Firmengesundheit Personal
34 Sägewerk und Hobelwerk Klappacher Klappacher GmbH Sägewerk
St. Leonhard
Herstellung von Bauholz für Dachstuhl Terrassenboden Gartenzaun Schalung Balkon aus Lärche ... Dr. Friedrich Ödl-Weg Grödig-St. Leonhard/Salzburg Österreich Wir verarbeiten ausschließlich
saegewerk-klappacher.at Sägewerk Hobelwerk Holz Fichte
35 LEUBE Baustoffe ? Beton Zementwerk LEUBE GmbH
St. Leonhard
LEUBE: Das größte Zementwerk und Kalkwerk im Land Salzburg. Höchste Qualität bei Beton Zement
Gartenau bei Salzburg
Die Untersbergbahn entführt Sie zu wunderschönen Aussichten Wandern Klettern Paragleiten ... Analytics und Datenschutz Schneebericht Adresse UNTERSBERGBAHN TALSTATION Dr. Ödlweg Gartenau Tel
untersbergbahn.at Untersberg Sagenhaft Untersbergbahn Hausberg
37 Kingpack Home Angebot
Kingpack Grödig ... Home Über uns Angebot Galerie Kontakt Hier finden Sie uns Quellenstr. A- Gartenau
kingpack.at Angebot Kompetenz Beratung
38 Wer sind wir?
St. Leonhard
Wir bieten Ihnen eine umfangreiche Palette an Dienstleistungen von A wie Abfallmanagement über M wie
39 Salzburg Kreativ Salzburg
St. Leonhard
Tanzkleidung Babyarktikel Geschenke und vieles mehr personalisiert! ... drucken oder sticken. Babyartikel
40 SDaisy Web Shop SKIDATA AG kite
sDaisy Stellplätze für Räder
sdaisy.at Kite Kites Kiteboarding Kiteboards
41 Freie Immobilien in Salzburg
Ihr Immobilienmakler für freie Wohnungen Häuser Ferienwohnungen Büros und Gewerbe. Ob Miet ... Informationen... Kontakt Weiss Immobilien Marianne Weiss Staufenstraße Grossgmain +
43 Hundeonlineshop.at Hundezubehör
Grossgmain bei Salzburg
Hundezubehör Hundesportartikel Hundeshop Sporthund hundesport
hundeonlineshop.at Hundezubehör Furminator Strigel Hundeführerwesten Hundesportartikel
44 Malerei Nicco Krabath Maler
Malerei Nicco Krabath colour for your home and your life.
malerdesign.at Maler Malerei Malermeister Anstreicher

46 Willkommen Barrierefrei |

47 Dvc Computing GmbH dvc Computing - Software Service GmbH dvc
Großgmain - Austria
... Verfügbarkeit. dvc Computing - Software Service GmbH Grenzweg - Großgmain - Austria +
dvc.at Dvc Computing
48 Ferienwohnungen Wegscheider Wegscheider

49 Betten Engel Betten Engel GmbH Matratzen
... Bayernweg A- Großgmain - servicebetten-engel REINIGUNG Preise
betten-engel.at Matratzen Matratzenreinigung Mobile Hausstaubmilben
50 Freie Immobilien in Salzburg
Ihr Immobilienmakler für freie Wohnungen Häuser Ferienwohnungen Büros und Gewerbe. Ob Miet ... Informationen... Kontakt Weiss Immobilien Marianne Weiss Staufenstraße Grossgmain +
51 Willkommen
... - Großgmain Österreich + - + - This e-mail
52 Resilienz im Unternehmen Resilinez
Mit Resilienz in Unternehmen kann man sich auf Krisen und Veränderungen vorbereiten.
varbene.at Resilinez Unternehmen Resilinez Organisationale Resilinez
53 Ferienwohnung Österreich Winzerhäusl
Ferienwohnung mit Sonnenterrasse in Großgmain Österreich Das Winzerhäusl
54 J.d'Art Homepage kunst
J.d'Art Schmuck ist nicht nur auf Dawanda! Die Künstlerin hat in der zwischen Zeit eine
jdart.at Kunst Jdart Jdart Schmuck Edelsteinschmuck Modeschmuck
55 Resilienz im Unternehmen Resilinez
Mit Resilienz in Unternehmen kann man sich auf Krisen und Veränderungen vorbereiten.
mein-aufschwung.at Resilinez Unternehmen Resilinez Organisationale Resilinez
56 Ausflugstipps mit Kindern in rawuza Ausflug & Medien KG Ausflugstipps
Hier findest du die besten Ausflugstipps für Familien mit Kindern in Österreich aufgegliedert in
rawuza.at Ausflugstipps Freizeittipps Familien Kinder
57 Freie Immobilien in Salzburg
Ihr Immobilienmakler für freie Wohnungen Häuser Ferienwohnungen Büros und Gewerbe. Ob Miet ... Informationen... Kontakt Weiss Immobilien Marianne Weiss Staufenstraße Grossgmain +
58 Aurasomashop.at AuraSoma® die AuraSoma
Onlineshop mit Schwerpunkt AuraSoma LichtWesen Ingrid Auer und Energetische Produkte ... - Poststrasse - A- Großgmain- + - e.Mail. infoaurasomashop
aurasomashop.at AuraSoma AuraSoma Equilibrium Pomander Quintessenz
59 Rechnungen schreiben Kassensysteme Rechnungen
Großgmain bei Salzburg
Rechnungen schreiben mit Sammelfaktura und Kassensysteme mit Kassensoftware fuer den ... kropro Am Mesnerbach Großgmain bei Salzburg Österreich + UID Nummer ATU
gastro-kasse.at Rechnungen Rechnungen Schreiben
60 IT Dienstleistungen Multimedia
IT Service more in Salzburg Ihr Fachmann für Reparatur Einrichten Installieren ... können. Kontakt Wir beraten Sie gerne! Media Handwerk IT-Service more Matthias Landauer Salzburgerstraße
61 Home Kulturkreis Grossgmain

62 Willkommen bei Austria Spedddating

63 Willkommen im Haus Knobloch ferienwohnung
... . Ferienwohnung Knobloch ? Ernst Knobloch ? Plainburgstr. ? Großgmain ? Salzburg Stadt Umgebung M +
ferienwohnung-grossgmain.at Ferienwohnung Whirlpoolwanne Ausgestattet Entspannen
... meine Praxisräume u. a. Praxis für Ergotherapie ELISABETH ZÖHRER Salzburgerstrasse Braunau zoereraon
65 Www.weinkreation.at Weinkreation e.U. weinkreation
Einzigartige Wein für einzigartige Unternehmen
weinkreation.at Weinkreation Salzburg Anif Awinco
66 Startseite Ginzinger Landmaschinen GmbH

67 HandOver Beschaffungsdienstleistungs GmbH HandOver Beschaffungsdienstleistungs GmbH Einkauf
HandOver ist eine der führenden Beschaffungsorganisationen für Betreuungs Gesundheits und Bildungseinrichtungen in Österreich. ... Sonystraße A- Anif/Niederalm T + F + officehandover
handover.at Einkauf Einkaufen Beschaffung Beschaffen
68 Kulturdesign Unternehmenskultur ::: events
Ich konzipiere für Sie das Event den Presseauftritt das Werbemittel aus der Kultur
kulturdesign.at Events Pressearbeit Prarbeit Konzeption
69 Startseite PGV Austria Trunk GmbH Magento
Herzlich willkommen auf magazinshop.at! Hier findet jeder das richtige Abo: vom Kombiabo mit Vignette über
magazinshop.at Magento Varien Ecommerce
70 Startseite maxxup

71 Home Musikkapelle Anif
Musikkapelle Anif
72 Anifer Mühlenbrot GmbH in Anifer Mühlenbrot GmbH
Herzlich willkommen beim Anifer Mühlenbrot! Als Bäckerei mit langer Tradition finden Sie bei uns hochwertige
73 H2 Atemtest Spirometrie H2
Anif Austria
H2 Atemtest bei Dr. Lahner GmbH Salzburg  Spirometrie Gastrolyzer GastroCh4eck Smoklerlyzer
lahner-medizintechnik.at H2 Atemtest Medizintechnik Austria Spirometrie Spirometrie Spirostik Complete
74 Treml Punsch Peter Treml Getränke Collection GmbH
Der köstliche Punsch aus dem Salzburger Land schenkt Lebensfreude und wärmt Leib und Seele. Für
75 Willkommen bei Yoga Trainerin
... Anif Kontakt
76 Yachtcharter Stelzl Ihr yachtcharter
Mit Stelzl Yachtcharter in der Türkei Griechenland Kroatien sowie Mallorca Italien und
stelzl-yachtcharter.at Yachtcharter Stelzl Segeln Segelyachten
77 Stranig Reaktiv Sporttherapie STRANIG
STRANIG reaktiv ist ein medizinisches Trainingszentrum für Leistungssportler Freizeitsportler Patienten mit Rücken oder
stranig-reaktiv.at STRANIG Reaktiv Stranig Reaktiv Anif
78 Tanzbar KaiserRanch KaiserRanch - J&R Absenger OG tanzbar
Tanzbar KaiserRanch in Saltzburg ... Bundesstraße A- Anif-Niederalm Salzburg Reservierungen Mi + Do - Fr
tanzbar-kaiserranch.at Tanzbar Kaiserranch Kaiser Ranch
79 Bauteam 4 Planung Planung
Bauteam 4 Planung Bauleitung Bautrauml;ger ... - officebauteam.at
bauteam4.at Planung Bauleitung Bautrauml;ger
80 Wozak Mediendesign Wozak Wozak Mediendesign KG Werbeagentur
Wozak Mediendesign die Werbeagentur in Salzburg für Print und Onlinewerbung. Die Werbespezialisten für digitale ... Adresse Dorfstrasse A- Anif +.. +.. studiowozak Navigation
wozak.at Werbeagentur Werbung Mediendesign Webdesign
81 Dr. Barbara Brunner
Niederalm b. Salzburg
... Dr. Barbara Brunner Öffentlichkeitsarbeit Kirchenstraße Niederalm b. Salzburg -(
82 Home dentallabor.knoll GmbH dentallabor zahna

dentallabor-knoll.at Dentallabor Zahnarzt Zahnersatz
83 Die Ausdauerschmiede

84 Forstinger + Stadlmann ZTGmbH
Forstinger + Stadlmann ZTGmbH Ingenieurkonsulenten für Erdwissenschaften ist Ihr Partner in Salzburg und Oberösterreich für ... Forstinger + Stadlmann ZT-GmbH A - in Anif - Achenpromenade Telefon. + Tele
85 Fotostudio Birgit Gesierich
Hochzeitsfotografin Fotostudio Birgit Gesierich in NiederalmAnif bei Salzburg Österreich Modern klassisch
86 UCM Verlag B2C Corporate Publishing GmbH verlag
Der UCMVerlag mit Sitz in Anif bei Salzburg steht für innovative Magazine. Unter dem Dach ... Publishing GmbH BB Media GmbH Co KG Salzweg A - Anif-Salzburg + - +
ucm-verlag.at Verlag Mode Lifestyle Fashion Fachmagazin Magazin Anif Salzburg
87 Home | Joachim Ortner

89 AtelierAnif Auer
Atelier Anif bietet künstlerische Wandgestaltung und schöne Dinge für Wand und Wohnen. Mit über 30
atelier-anif.at Auer Wandgestaltung Wandmalerei Fresko
90 Reschbergerhof: Appartments Zimmer

91 Schober Zelte Grillgeräte
... Schober Zelte Grillgeräte Tiergartenstr. A- Anif Telefon + Mobil +
92 PromoMasters Suchmaschinenoptimierung SEO PromoMasters Online Marketing Ges.m.b.H. suchmaschinenopti
Anif bei Salzburg
Die Suchmaschinenmarketing Spezialisten von PromoMasters führen Suchmaschinenoptimierung von Tourismus Industrie und Handel durch. In ... ¼rst - Waldbadstraße A- Anif Salzburg Österreich Telefon + - - +
promomasters.at Suchmaschinenoptimierung Seo Suchmaschinenmarketing Suchmaschinen Optimierung
93 Facecam Live Fotocontent
Anif bei Salzburg

94 Drkrueger.at Dr.
Arzt für Allgemeinmedizin ... sind jederzeit möglich) Fremdsprache Englisch Dr. Martin Krüger Mischlgutweg Anif
dr-krueger.at Dr. Krüger Anif Arzt Allgemeinmedizin
95 Verlag Anton Pustet | Pustet
Salzburgs ältester Buchverlag Verlag Anton Pustet exklusive Bücher zu Architektur Geschichte Neue Ethik
pustet.at Pustet Anton Pustet Verlag Salzburg Buch Architektur Geschichte
96 Cafe Wenger: Home
... -Garten. + infocafe-wenger
97 Chirurgie Rettenbacher

98 Architekt DI Christian Gneist Gneist
Architekt Architekturbüro Ziviltechniker ZT Architekt Gneist Christian Gneist Architektur ... Home Projekte Kontakt Atelier Alpenstraße im Silgmann Office A- Anif Anschrift
cg-architektur.at Gneist Architekt Architekt DI Christian Gneist
99 Legasthenie LRS

100 LaFIT Langmayr Fitness LaMED GmbH Training
Das LaFIT Trainingsprogramm kombiniert moderne Trainingslehre mit State of the ArtMedizin in Anif bei Salzburg. ... Langmayr mit Team LaFIT - Langmayr Fitness Hellbrunnerstraße Anif + Diese E
lafit.at Training Lafit Langmayr Trainingsprogramm
101 :: Pichler Media Trans Erika
Anif bei Salzburg
:: Pichler Media Trans :: Erika Pichler Dolmetschen und Übersetzen Anif bei Salzburg
pichler-media-trans.at Erika Pichler Dolmetschen Übersetzen Anif Salzburg Austria Dolmetscherin
102 Steuerberater Leitgeb Leitgeb Steuerberater

steuerberater-leitgeb.at Steuerberater Wirtschaftstreuhänder Steuer Buchhaltung
103 Bau deine Zukunft

105 Stonemotion bringt den Stein stonemotion e.U.
stonemotion bringt den Stein in Ihrem Unternehmen ins Rollen und entfaltet das gesamte Potenzial Ihrer
106 Arite design: projekt wg

107 Was die Politikwissenschafterin Kunst
Barbara WolfWicha PolitikWissenschaftKunst Politikwissenschafterin Herausgeberin Künstlerin Wort Schrift Bild Werdegang
barbara-wolf-wicha.at Kunst Kunstwerke Künstlerin Vielfalt Der
108 Cocktailtraum Startseite Partyservice
Cocktailtraum Ihr Party und Lieferservice in Anif gestaltet Ihre Partys professionell und kreativ
cocktailtraum.at Partyservice Lieferservice Feier Veranstaltung
109 Willkommen beim USK Anif
... Follow via Instagram Mail to USK Anif Schulweg Anif infousk-anif Anfahrt - Kontakt
110 Anif RiSKommunal Anif
Anif ... ) zum Seitenanfang Kontakt Gemeinde Anif Aniferstraße A- Anif T + F + DW
anif.gv.at Anif SalzburgSüd Schloss Anif Hellbrunn
111 Hotel Gastro Pool GmbH Hotel Gastro Pool GmbH HGP
Hotel Gastro Pool ist ein Unternehmen der hogastGruppe und auf die klein und mittelständische Hotellerie ... /So/Feiertag - + HGP Hotel Gastro Pool GmbH Sonystraße A- Anif/Niederalm T
hotelgastropool.at HGP Hotel Gastro Pool Gastro Pool
112 Hogast Einkaufsgenossenschaft für das hogast
hogast ist die führende Einkaufsorganisation der Hotellerie und Gastronomie. Sie ist genossenschaftlich organisiert und bietet ... für das Hotel- Gastgewerbe regGenmbH Sonystraße A- Anif/Niederalm T + F +
hogast.at Hogast Anif Einkaufen Einkauf
113 AnfahrPuffer zum Patent angemeldetes

114 Gerl Autoschaden Grödig Gerl GmbH Grödig
Firma Gerl Grödig Ihre Werkstatt zwischen Salzburg und Hallein nähe Berchtesgaden KFZ Lackiererei ... Sie gerne! Gerl GmbH Gartenauer a A- Grödig Diese -Adresse
unfallreparatur.at Grödig Salzburg Hallein Berchtesgaden
115 Willkommen im Schlaraffenland! SCHLARAFFENLAND GmbH
Willkommen im Schlaraffenland!
116 Home Körper
KoerperKult my body my Time
koerper-kult.at Körper Kult Miha Bodytec Powerplate
117 Hotels im Salzburger Land
Verbringen Sie Ihren Urlaub im Salzburger Land. Auf dieser Plattform werden zahlreiche Hotels im Salzburger
118 Peter kerschhofer | petigrafix.at

119 Hotel "DER HECHL" GASTROdat® Ges.m.b.H. Hotel
Das Hotel
hotel-hechl.at Hotel Hechl Tauplitz Skigebiet
120 GasthausFassl

121 Gerl Autoschaden Grödig Gerl GmbH Grödig
Firma Gerl Grödig Ihre Werkstatt zwischen Salzburg und Hallein nähe Berchtesgaden KFZ Lackiererei ... Sie gerne! Gerl GmbH Gartenauer a A- Grödig Diese -Adresse
pannendienst.at Grödig Salzburg Hallein Berchtesgaden
122 OSCG | Offshore Segelclub segel
Grödig - Salzburg
Willkommen beim OSCG dem Offshore Segelclub in Grödig bei Salzburg
oscg.at Segel Segeln Oscg Osc
123 Home: GuS Hausbetreuung

124 Invest ConceptManagement GmbH | its
Grödig - Salzburg
...its time to exchange...
roehrl.ic-m.at Its Time Exchange
125 Ideenpark

126 Kinder Spiel JUPIDU GmbH

127 Jujutsu Hebi /home.php

128 Journalist Translator Interpreter Elizabeth translation
Grödig bei Salzburg
Elizabeth Mortimer?austriabased translator and journalist offers professional language services english/german translations audioguides for
mortimer.at Translation Translations English German Journalism
129 Mybodycoach Mag. Sonja Fitness

mybodycoach.at Fitness Salzburg Personal Coaching Training
130 NEWS von MEV Neuigkeiten
NEUE Produkte von MEV ... ! Sonderpreis auf Anfrage!!!! Link To Detail Page ? Franz Hagenauer Oberfeldstraße A- Grödig Mail office
landmaschinenersatzteile.at Neuigkeiten MEV Neue Produkte
131 Gerl Autoschaden Grödig Gerl GmbH Grödig
Firma Gerl Grödig Ihre Werkstatt zwischen Salzburg und Hallein nähe Berchtesgaden KFZ Lackiererei ... Sie gerne! Gerl GmbH Gartenauer a A- Grödig Diese -Adresse
leihwagen.at Grödig Salzburg Hallein Berchtesgaden
132 Loxbox: Inside

133 Phönix Laboratorium GmbH Spagyra GmbH&Co KG phoenix
Phönix Laboratorium GmbH biologische Arzneimittel seit 1925. Spagyrische und homöopathische Produkte in Österreich
phoenix-lab.at Phoenix Laboratorium Arzneimittel Pharma
... im Gasthof - die Pflegerbrücke GASTHOF DIE PLEGERBRÜCKE IMPRESSUM Fam. Kohlstätter Pflegerstraße A-
135 Betreuung mit Herz Altenpflege
24 Stunden Betreuung für die eigenen vier Wände ... Text version Herzlich willkommen... ...bei www.Seniorenbetreuung.at -Stunden-Betreuung nach Maß
seniorenbetreuung24.at Altenpflege Seniorenbetreuung Häusliche Altenpflege 24
136 SMKKRAN SMK Vermietungs GMBH www.smkkran.at
SMK KRAN Vermietungs GMBH ... Copyright SMK-KRAN SMK Vermietungs GMBH Adresse A - Grödig Gewerbestrasse
smk-kran.at Www.smkkran.at Smk Kran Baumaschine
137 Huemer Onlineshop für PKW
... -Adresse Passwort Passwort vergessen? Kontakt HUEMER Ersatzteilshop Gewerbestrasse
138 Home bhb
bhb ... für Ihre Hilfe und Unterstützung! Unsere Bankdaten Raiffeisenbank Grödig Bauern helfen Bauern IBAN AT
bhb-sbg.at Bhb
139 Mybodycoach Mag. Sonja Fitness

aerobicinfo.at Fitness Salzburg Personal Coaching Training
140 Realtime.at Domain Services realtime.at Domain Services GmbH catch
We catch or snap your expired domain domain ... deleted .at domain names deleted domain names ... in the current auction list. Copyright
realtime.at Catch Doman Snap Domain Snap
141 Zauchensee Liftgesellschaft und Ski
Zauchensee Liftgesellschaft Veronika Scheffer Zauchensee in Verbund mit Ski Amade Altenmarkt Salzburger Land Alkohol am ... Peter Url geboren am .. Grödig Göllstraße vertreten durch Dr. Clemens Thiele
142 Die Psychotherapeutische Praxis Salzburg

144 :: EHC SALZBURGSUED eishockey
Ehc SalzburgSüd
ehc-salzburgsued.at Eishockey Ehc Salzburgsüd Volksgarten Klausner
145 Freiwillige Feuerwehr Grödig Freiwillige
Informationsportal rund um das Feuerwehrwesen in Grödig. ... Kontakt Erreichbarkeit Adresse Freiwillige Feuerwehr Grödig Gartenauerstraße A- Grödig
feuerwehr-groedig.at Freiwillige Feuerwehr Grödig FF Grödig Brand
146 Löschzug FürstenbrunnGlanegg Freiwillige
Informationsportal rund um das Feuerwehrwesen in Fürstenbrunn/Glanegg. ... Kontakt Erreichbarkeit Adresse LZ Fürstenbrunn-Glanegg Fürstenbrunnerstraße A- Grödig
ff-fuerstenbrunn.at Freiwillige Feuerwehr Fürstenbrunn/Glanegg FF Fürstenbrunn Brand
147 Fotograf mathias mandl actionfotos
Fotos von Fotograf Mathias Mandl Actionfotos Landschaften Sportbilder Fotograf in Salzburg
148 Gerl Autoschaden Grödig Gerl GmbH karosserie
25 Jahre Erfahrung haben uns zu einem Musterbetrieb im Raum Salzburg Hallein Grödig und ... Gerl GmbH Gartenauer a A- Grödig infogerl Partnerbetriebe Gerl Autoschaden Grödig
gerl.at Karosserie Center Süden Salzburgs Jahre Erfahrung Musterbetrieb Raum
149 Herzlich Willkommen! | GmachlCoaching herzlich
Dipl. Lebensund Sozialberaterin EMMTECH Tutorin Anwenderin Trainerin Coach Organisationsberaterin Ich glaube an Dich
gmachl-coaching.at Herzlich Willkommen Dipl Lebens Sozialberaterin Emm Tech Tutorin
150 Ing. Müller Kabelfernsehen Kabelfernsehen
Ing. Müller Kabelfernsehen Internet Elektro in Grödig ... Uhr und nach tel. Vereinbarung Kontakt Firma Ing. Herwig Müller Eichetstraße a A- Grödig Tel+
redzac-mueller.at Kabelfernsehen Internet Elektro Grödig
151 Schwab Reisen Schwab Reisen GmbH
... Herrenslalom Schwab Reisen Jahresprogramm Schwab KEG . Gangsteig . A- Grödig . -
152 Wiebecke GmbH in Grödig abgehängten

wiebecke.at Abgehängten Zwischendecken Wiebecke Salzburg Grödig Decken Systemdecken Akustikd
153 Babsi Winzer wibagrafix
... wibagrafix Barbara Winzer Marktstraße Grödig officewibagrafix +
154 HAMOTEK Montagetechnik HAMOTEK Montagetechnik GmbH Hassler
hamotek montagetechnik ein neuer Name mit vertrauten Werten
hamotek.at Hassler Oliver Hassler Hamotek United
155 Untersberg Apotheke | Ihre UNTERSBERG-APOTHEKE Schiebel KG
... Apotheke. Untersberg-Apotheke Mag. Karin Schiebel Marktstraße Grödig +
156 Businesscenter Grödig bcG Businesscenter
Das Businesscenter Grödig vermietet hochwertige Büros. ... lifestyle seminarraeume ueber wasserschutzgebiet werden businesscenter grödig ? Friedensstrasse ? A-
buero-vermietung-salzburg.at Businesscenter Grödig Vermietung
157 Mission Statement | B.A.U.M. mission
Grödig - Salzburg
Sustainable Development B.A.U.M. das Austrian Network for Sustainable Leadership und seine Mitglieder und
baumaustria.at Mission Statement Sustainable Development Austrian Network Leadership Mitglieder
158 Willkommen bei GE Art Kunstfels
... verstärkten Kunststoffen! Kontakt TEL +.. infoge-design Anschrift Buchbichl Grödig
ge-design.at Kunstfels Kunstfelsen GFK Glasfaser
159 Löschzug FürstenbrunnGlanegg Freiwillige
Informationsportal rund um das Feuerwehrwesen in Fürstenbrunn/Glanegg. ... Kontakt Erreichbarkeit Adresse LZ Fürstenbrunn-Glanegg Fürstenbrunnerstraße A- Grödig
feuerwehr-fuerstenbrunn.at Freiwillige Feuerwehr Fürstenbrunn/Glanegg FF Fürstenbrunn Brand
160 Weratech Software GmbH weratech GmbH newsroom
Weratech entwickelt Software Lösungen im Bereich Tourismus und Social Media ... Büro Geschäftsstelle Friedensstraße A- Grödig TEL + FAX + -
wohnbau-news.at Newsroom Weratech Socialmedia Social
161 Gerl Autoschaden Grödig Gerl GmbH Grödig
Firma Gerl Grödig Ihre Werkstatt zwischen Salzburg und Hallein nähe Berchtesgaden KFZ Lackiererei ... Sie gerne! Gerl GmbH Gartenauer a A- Grödig Diese -Adresse
lackiererei.at Grödig Salzburg Hallein Berchtesgaden
162 Kirchgasser Furniere Grödig KIRCHGASSER Furniere GmbH
Furniere Dünn geschnittenes Edelholz in bester Qualität für Ihre Möbel oder Musikinstrumente. Exklusiv aus ... . Erleben Sie Kostbarkeiten zum Anfassen! Kontakt Kirchgasser Furniere GmbH Neue-Heimat-
163 Mybodycoach Mag. Sonja Fitness

kinesis.at Fitness Salzburg Personal Coaching Training
164 Wir sind Ihr Ifor

165 Megabusiness
166 Michael Sieberer Mein Zinsen
Die Geschäftspraktiken einer Salzburger Bank ließen den Lebenstraum der Familie des Fleischhauers Michael Sieberer aus
mein-verlorenes-vertrauen.at Zinsen Liegenschaft Ruin Buch
167 Energethikerin Rositta Dolliner
Rositta Dolliner ist eine Energethikerin mit Herz. Rositta Dolliner arbeitet neben mit Engelenergie PranaVita ... da sie die Energiearbeit dankbar annehmen. Rositta Dolliner · Glanegger · Grödig +
168 Paxnatura Naturbestattung in paxnatura Naturbestattungs GmbH
paxnatura bietet eine würdevolle Alternative zum Friedhof. paxnatura informiert über Naturbestattungen in Österreich: Alle Infos ... A- Grödig Presse Kontakt Sitemap Facebook
169 ShowArts Lausenhammer Rene e.U. ShowArts Lausenhammer Rene e.U. Eventgestaltung
ShowArts Lausenhammer Rene e.U. Grödig ... .? Hier finden Sie uns ShowArts Lausenhammer Rene e.U. Oberfeldstraße Grödig Kontakt Rufen Sie einfach
showarts.at Eventgestaltung Event Veranstalter Party
170 MOR Photodesign photography
Architektur und Landschaft Privat und Businessportraits Fotografin und Photodesign Salzburg
orsinirosenberg.at Photography Marie OrsiniRosenberg Fotografin Photodesign
171 Home Original-Gletscherschliff e.U.

172 Mybodycoach Mag. Sonja Fitness

personaltrainingstudio.at Fitness Salzburg Personal Coaching Training
173 Weratech Software GmbH weratech GmbH newsroom
Weratech entwickelt Software Lösungen im Bereich Tourismus und Social Media ... Büro Geschäftsstelle Friedensstraße A- Grödig TEL + FAX + -
headline.co.at Newsroom Weratech Socialmedia Social
174 Hotel Der Königsleitner GASTROdat® Ges.m.b.H. königsleiten
Neues 4 Sterne Hotel Der Königsleitner und Ferienwohnungen Astn Hütten in Königsleiten. Die perfekte Unterkunft
koenigsleiten.at Königsleiten Nebelfrei Pollenfrei Kitzbüheler Alpen
175 NEWS von MEV Neuigkeiten
NEUE Produkte von MEV ... ! Sonderpreis auf Anfrage!!!! Link To Detail Page ? Franz Hagenauer Oberfeldstraße A- Grödig Mail office
mev.co.at Neuigkeiten MEV Neue Produkte
176 SpotOn Marketing GmbH SpotOn Marketing GmbH spoton
Grödig bei Salzburg
Makes you move! ... . Herausgeber SpotOn Marketing GmbH Friedensstraße Grödig bei Salzburg Österreich GESCHÄFTSFÜHRER
spoton-management.at Spoton Motorsport Dtm Susie Wolff
177 Kirchgasser Furniere Grödig KIRCHGASSER Furniere GmbH
Furniere Dünn geschnittenes Edelholz in bester Qualität für Ihre Möbel oder Musikinstrumente. Exklusiv aus ... . Erleben Sie Kostbarkeiten zum Anfassen! Kontakt Kirchgasser Furniere GmbH Neue-Heimat-
178 Weratech Software GmbH weratech GmbH newsroom
Weratech entwickelt Software Lösungen im Bereich Tourismus und Social Media ... Büro Geschäftsstelle Friedensstraße A- Grödig TEL + FAX + -
headline.or.at Newsroom Weratech Socialmedia Social
179 Werbegrafik Mühlbacher
... . Für ein unverbindliches Gespräch stehen wir Ihnen gerne zur Verfügung. Top Gewerbestraße Grödig
180 Trennungsagentur.at Powerd by trennungsagentur
Warum auch immer Sie sich trennen möchten wir helfen Ihnen dabei! Wir machen aus
trennungs-agentur.at Trennungsagentur Glückliche Unglücklichen Singles
181 Wittronik GmbH Home Wittronik GmbH Wittronik
Startseite ... ) Dokumente Broschüre Wittronik GmbH Hauptstrasse Grödig Austria + - +
wittronik.at Wittronik GmbH Startseite Home
182 OutdoorDesign Pflaster | outdoordesign.at
outdoordesign.at Pflaster | Naturstein | Garten | Grödig bei Salzburg ... - Pflaster Naturstein Garten Franz Peyerl Grödig Inhaber Reinhold Hinterberger
outdoor-design.at Outdoordesign.at Pflaster | Naturstein | Garten
183 Nuun
... Prötschhofstraße b Grödig Salzburg Telefon + infonuun www.nuun
184 Manufaktur2 für Werbung
Grödig bei Salzburg
Die Werbeagentur Salzburg Manufaktur2 eine Fullservice Agentur mit Standort in Grödig Salzburg ... Manufaktur² für Werbung und Design Neue Heimat . Grödig + officemanufaktur.at
185 Hobbyfotograf Markus Jäckel Hobbyfotograf
Grödig bei Salzburg
Portfolio von Salzburgs Hobbyfotografen Markus Jäckel. Feinste Fotografie in den Bereichen Akt Teilakt
mj-photography.at Hobbyfotograf Fotograf Markus Jäckel
186 Jagdwissen.at Jagdwissen

jagdwissen.at Jagdwissen Jagd ELearning Prüfung
187 Sat+kabel müller satanlagen
Ihr Spezialist für SATAnlagen KabelTV und Internet in Grödig und Umgebung ? Salzburg ... im Kabelnetz Previous Next Telefon + . kontaktsat-kabel-mueller Eichetstraße a Grödig
sat-kabel-mueller.at Satanlagen Satelliten Anlagen Kabeltv Kabelfernsehen
188 SUB Unternehmensberatung Sulzbacher Unternehmensberatung GmbH
... Unternehmen Leistungen Kunden Partner Sulzbacher Unternehmensberatung GmbH Göllstrasse C
189 Ferienhaus ?Haus Salzburg? Ferienwohnung
Glanegg bei Salzburg
Das Ferienhaus "Haus Salzburg" ist der perfekte Platz für Ihren Urlaub mit der ganzen ... ! Hier finden Sie uns Ferienhaus "Haus Salzburg" Jagerbauernweg Glanegg bei Salzburg Kontakt Rufen
ferienhaus-haussalzburg.at Ferienwohnung Salzburg Ferien Österreich Glanegg Urlaub
190 NEWS von MEV Neuigkeiten
NEUE Produkte von MEV ... Aktuelle Angebote ? Franz Hagenauer Oberfeldstraße A- Grödig Mail officemev.co
landmaschinen.co.at Neuigkeiten MEV Neue Produkte
191 VollSOLAR Ingenieurbüro vollSOLAR GmbH

192 KAN Kommission Arbeitsschutz 0
Sankt Augustin
KAN Kommission Arbeitsschutz und Normung ... concerns to be addressed during standards development. Who is your contact at the KAN Secretariat? Consult
human-factor-services.at 0
193 Willkommen auf der Startseite Motorrad
Sankt Pantaleon
Hompage MSCPumpenkammer St. Pantaleon Oberoesterreich
pumpenkammer.at Motorrad Racing Pumpenkammer St.Pantaleon
194 Startseite CAFE HAIDER
Sankt Agatha
... HAIDER Etzinger Sankt Agatha Telefon + haider.rolandaon Nutzen
195 Aktuelles Leguano leguano GmbH
Sankt Augustin

196 Home Werkzeuge rund Restsauerstoffmes
Sankt Sebastian
Werkzeuge rund ums Orbitalschweißen
orbitalshop.at Restsauerstoffmessgeräte Oxy 2 Oxy Intergral
197 Http://www.purplestage.at News und Thomas
Sankt Wolfgang
Thomas Szvetecz Ihre professionelle Veranstaltungstechnik im Salzkammergut. Als erfahrener Tontechniker im Salzkammergut bzw. ... FOLKSTROTT Live at the Orpheum Graz ././ Endlich ist es für die Fans der Grazer Irish Folk Band
purplestage.at Thomas Szvetecz Thomas Szvetecz Veranstaltungstechnik Salzkammergut
198 Fleischer | Nahversorger | Heinisch GmbH & Co KG Nahversorger
Sankt Florian
Herzlich willkommen bei Heinisch! Als modernes Unternehmen bieten wir Ihnen kompetent und absolut zuverlässig beste ... GmbH Co KG Marktpl Sankt Florian Sitemap Kontakt %%%%E%%%%
fleischerei-heinisch.at Nahversorger Hofkirchen Fleischer St. Florian
199 Zahnarztpraxis Dr. med. dent Zahnarzt
Sankt Gilgen
Zahnarztpraxis Dr. Kohnhauser in St. Gilgen Wir bieten folgende Leistungen wie Kronen Protesen ... - und Abendtermine möglich! Dr. med. dent. Lorenz Kohnhauser Schwarzenbrunner A- Sankt Gilgen (
zahn-kohnhauser.at Zahnarzt Dr. Kohnhauser St. Gilgen
200 Parfümerie Rüdell parfümerie
Sankt Augustin
Besuchen Sie die Website der Parfümerie Rüdell im Internet! Vielleicht sehen wir uns dann ja
ruedell-shop.at Parfümerie Bonn Bad Godesberg Troisdorf
201 Paintball23.at Home paintball
Sankt Pölten
Paintballverein bei St.Pölten. Paintball spielen auf der Area 23. Wir bieten die Möglichkeit Paintballausrüstung auszuleihen. ... . Unsere Partner Kranmpus Verein Locos Diavolos paintball paintball.at Privacy Policy Scroll to
paintball23.at Paintball Gotcha Paintball St.pölten Paintball
202 Willkommen
Sankt Pölten
... Ausbildungen Mitgliedschaften Tätigkeiten Kontakt Wien Sankt Pölten Postadresse Herzlich willkommen
Sankt Gilgen

204 Jausenstation Knölli knoelli
Sankt Blasen

knoelli.at Knoelli Knölli Jausenstation Paintball
205 JUST LIFE Ausbildungszentrum JUST
Sankt Pantaleon
JUST LIFE Praxis für Energethik Sankt Pantaleon Maria Roithinger Reiki 2 ... JUSTLIFE Ausbildungszentrum Praxis für ganzheitliche Energethik Pantaleoner Sankt
just-life.at JUST LIFE Praxis Für Energethik Sankt Pantaleon
206 Lechner Textil Mietberufskleidung Mietmatten Lechner Textile Solutions GmbH Lechner
Sankt Florian
Lechner Textil
lechner-textil.at Lechner Textil
207 Home
Sankt Georgen

208 Pferdeklinik Tillysburg Home Pferdeklinik Tillysburg GmbH & Co KG Tierarzt
Sankt Florian
Pferdeklinik Tillysburg in Sankt Florian ist die Tierarztpraxis für Ihre Kleintiere ob Hund
pferdeklinik.at Tierarzt Praxis Hund Katze
209 ART OF TIME ART OF TIME Innovative Products GmbH
Sankt Valentin

210 TakaTukaLand
Sankt Valentin
... Sankt Valentin Herzograd DW
211 Teichfilter Der richtige Kontakt Czebra Versand GmbH
Sankt Julian

212 Stadtmuseum St. Pölten
Sankt Pölten

213 Urlaub am Bauernhof Salzburg Alpen
Sankt Martin
Gemütlicher Biobauernhof für Wanderurlaub Erlebnisurlaub Urlaub am Bauernhof Tradition Sehenswürdigkeiten ... Maria und Josef Hagn Wildental Sankt Martin +-- Navigation Biobergbauernhof
migglgut.at Alpen Almen Wandern Biobauernhof
214 Dieflieger.at
Sankt Valentin
... ASKÖ Flugsportverein Sankt Valentin Flugzeugreservierung Homebriefing Flugwetter ORF Wetter
215 Startseite Fasthuber Baubedarf GmbH joomla
Sankt Florian
Joomla! dynamische PortalEngine und ContentManagementSystem
fasthuber.at Joomla Joomla
216 Freiwillige Feuerwehr Harmanschlag feuerwehr
Sankt Martin
Die Freiwillige Feuerwehr Harmanschlag Immer für Sie da!
ff-harmanschlag.at Feuerwehr Freiwillige Feuerwehr Harmanschlag Ff
217 ART OF TIME ART OF TIME Innovative Products GmbH
Sankt Valentin

218 JobSuche: jobtop Personalbereitste
Sankt Valentin
Hier folgt eine Beschreibung
topjob.at Personalbereitstellung Personaldienstliestung Arbeitskräfteüberlassung Zeitar
219 Kolping Ferienkurse Kolping
Sankt Pölten
Kolping Ferienkurse Nachhilfe in Deutsch Englisch Französisch Mathematik Rechnungswesen
kolping-ferienkurse.at Kolping Kolpinghaus Sankt Pölten Kolpingsfamilie
220 Radioking Austria hier finden Alles
Sankt Christophen
Alles über Portableradios Taschenradios Pocketradios Radiomarkt Grundig Eumig Hea
radioking.at Alles über Portableradios Taschenradios Pocketradios
Sankt Gallenkirch

222 OK Möbel Home Schreiner
Sankt Gilgen
OK Möbel Sankt Gilgen ... nach Mass Sie haben Fragen? O.K. Möbel Othmar Kemmler Hochreitstraße Sankt Gilgen Telefon
ok-moebel.at Schreiner Schreinerei Tischler Möbel
223 Freiwillige Feuerwehr Rohrbach
Sankt Florian
... ... Wo Sie uns finden Freiwillige Feuerwehr Rohrbach Wolferner a Sankt Florian Telefon +
224 24StundenBetreuung Hilfe Günstige 24
Sankt Willibald
Wir sorgen für 24StundenPflege mit echter Fürsorge: qualifizierte Fachkräfte für die 24StundenPflege zu Hause. Ihre
24stunden-betreuung-hilfe.at 24 Stunden Pflege 24 Stunden Betreuung
225 SU Falkensteiner Katschberg
Sankt Pölten
Die offizielle Seite des Handballvereins SU Falkensteiner Katschberg St. Pölten. ... Spielplan Tabelle U Spenglerei Kögl Organisatorisches Kader Spielplan Tabelle U Sparkasse Sankt
226 Gusenleitner computerkassen abrechnungssysteme
Sankt Florian
... Gusenleitner Leitnerberg Sankt Florian Telefon + Druckversion Sitemap Diese Seite
227 Fortuna Arts Atelier Kunst
Sankt Florian
HomepageTitel Sankt Florian Kunstwerke und kreative Arbeit! ... auf oder rufen Sie an. FORTUNA ARTS Iris Lehner Sankt Florian Telefon + +
fortuna-arts.at Kunst Kunstwerke Künstler
228 Willkommen
Sankt Pölten
... Ausbildungen Mitgliedschaften Tätigkeiten Kontakt Wien Sankt Pölten Postadresse Herzlich willkommen
229 Bodyform Luftbett AirLine Prestige C.Hey & T.Piert GbR Bodyform
Sankt Augustin
Bodyform AirLine Prestige Luftbetten ... Streckung der Wirbelsäule Bodyform Westerwaldstraße Sankt Augustin
luftgefederte-matratzen.at Bodyform AirLine Prestige Luftbetten
230 Sport Stenzer Dein Fischer
Sankt Englmar
Skiverleih Skiverkauf Skiservice und Skischule ín 94379 Sankt Englmar. Wir sind Ihr Wintersportpartner ... Dein Sportgeschäft. Skiverleih in St. Englmar. Onlineshop Netsport. Skischule Sankt Englmar. Information Neuheit
netsport24.at Fischer Ski Völkl Ski Rossignol Ski
231 Photo Fashion Startseite
Sankt Konrad
... Sankt Konrad Telefon + Öffnungszeiten Termin nach Vereinbarung Aktuelles Seid Juni
232 Jausenstation Knölli knoelli
Sankt Blasen

xn--knlli-kua.at Knoelli Knölli Jausenstation Paintball
233 Tischlerei Martin Ebner
Sankt Lorenz
... Ebner Willkommen bei Tischlerei Martin Ebner in Sankt Lorenz Unsere Schreinerei zeichnet
234 Herzlich Willkommen TJ
Sankt Marien
... Seite als PDF speichern TJ Sonnenschutz Lärchenweg Sankt Marien + +
235 Willkommen
Sankt Pölten
... Ausbildungen Mitgliedschaften Tätigkeiten Kontakt Wien Sankt Pölten Postadresse Herzlich willkommen
236 Gasthof St. Egydenerhof (gemeinde Van der Meer & Struik KG Velden
Sankt Egyden
Urlaub in Kärnten Gasthof Hotel Pension (Gemeinde Velden am Wörthersee) ... Davidson Egyden GPS touren Karawanken Klagenfurt Kärnten Live Webcam Obir Sankt Sankt Egyden Velden Velden
worthersee.at Velden Velden Am Wörthersee Wörthersee
237 Startseite  Pro Adventures
Sankt Pankraz

238 MMHundetraining Startseite Hundeerziehung
Sankt Florian

mm-hundetraining.at Hundeerziehung Schwer Erziehbarer Hund Gewaltfreie Erziehung
239 Musikverein St. Lambrecht
Sankt Lambrecht
... . Lambrecht Spitalberg Sankt Lambrecht Telefon + Unsere nächsten Termine Sonntag
240 ZUKUNFTJUGEND Home jugend
Sankt Marien
... Wir beraten Sie gern ZUKUNFT-JUGEND Kimmersdorfer Sankt Marien infozukunft
zukunft-jugend.at Jugend Jugendzentrum Projekt Workshops
241 Zeiler Ges.m.b.H. Startseite Zeiler Ges.m.b.H.
Sankt Blasen
... . Thajagraben Sankt Blasen Telefon + + Zeiler sen. Zeiler
242 Fotografin Startseite
Sankt Johann-Köppling
... Willkommen bei Andrea Bauer Fotografie Mein Name ist Andrea Bauer. Ich bin Fotografin in Sankt Johann o. H
243 Willkommen Leguano.eu leguano GmbH
Sankt Augustin

244 Start pizzamios Webseite!
Sankt Margarethen
... . Allergen Informationen erhalten Sie beim Personal hier sind wir Eisenstädterstrasse a Sankt
245 Praxis Maria Lichtenauer
Sankt Florian
Startseite Praxis Maria Lichtenauer
246 MobileXpert Handyshop St.Pölten |
Sankt Pölten
... unsere Handy Reparatur Sankt Pölten nicht viel Geld im Vergleich zu jedem anderen Händler
247 Goldglocke selfmade Naturkosmetik Kosmetik
Sankt Florian
HomepageTitel Sankt Florian Selfmade Naturkosmetik Rohstoffe ... Microsoft Excel-Dokument KONTAKT Goldglocke Kosmetische Rohstoffe Iris Lehner Sankt Florian
goldglocke.at Kosmetik Natur Naturkosmetik Rohstoffe
248 Personaltraining Selbstverteidigung
Sankt Poelten
Personaltraining Selbstverteidigung Gesundheits und Fitnesskurse Qi Gong Pilates Yoga
249 LovelyRose Online Shop LovelyRose
Sankt Florian
LovelyRose Online Shop
lovelyrose.at LovelyRose Online Shop
250 KFZ Werkstatt Home Kfz
Sankt Lambrecht
KFZ Werkstatt Sankt Lambrecht ... Sie uns KFZ Werkstatt Leitnersiedlung Sankt Lambrecht Rufen Sie einfach an unter
kfz-gerold.at Kfz Reparatur Werkstatt Auto
251 Bernhard Reiter Bilddruck GmbH BILDDRUCK GMBH
Sankt Florian
Hochwertige Photokunst gedruckt auf außergewöhnlichen Materialien.
252 Welcome to the official
Sankt Pölten-Traisenpark
Welcome to the official Contao Demo Site
253 Fischen in Österreich inklusive Fishery Steffan GmbH
Sankt Kanzian
Ein einzigartiges Fischerparadies im Süden Österreichs. Wir bieten Anglern und Naturliebhabern moderne Blockholzhütten direkt am
254 Work4life Personalservice Qualifiziertes work4life Personalservice GmbH Personalservice
Sankt Marien
Qualifiziertes Personal und motivierte Mitarbeiter. Effiziente Jobsuche und unbefristete Jobangebote. ... Alle Tischler Sankt Marien LKW- Fahrer mit Kranschein Oberndorf an der Melk Verfügbare
work4life.at Personalservice Work4life Work Life
255 KFZ Werkstatt Cimen KWC
Sankt Pölten
Autowerkstatt für alle Marken Fachwerkstatt Sankt Pölten ... kwc.co Weinviertelstrasse Sankt Pölten Pickerl Jahresservice Bremsen Windschutzsscheibe Reifen
kwc.co.at KWC Kwc KFZ Autowerkstatt Autoreparatur Fachwerkstatt 'Autowerkstatt Sankt
256 Zimmerei Jöchl St. Zimmerei Jöchl KG
Sankt Johann in Tirol
Die Zimmerei Jöchl in St. Johann/Tirol ist Ihr Partner rund um Dachstuhl Carport ... über unser Unternehmen. Kontakt Anfahrt Zimmerei Jöchl KG Paß-Thurn- a A- Sankt Johann in Tirol Tel
257 Bestattung Tischlerei Parapatits
Markt Sankt Martin

258 Musikverein Heimatklang Sankt Marein Musikverein
Sankt Marein im Mürztal
Musikverein Heimatklang Sankt Marein im Mürztal
mv-heimatklang.at Musikverein Blasmusik Konzert Blaskapelle
259 Www.natierlich.at Tiermassage
Markt Sankt Martin
Unsere vierbeinigen Lieblinge bereichern unser Leben und bringen uns viel Glück und Freude ? wenn
natierlich.at Tiermassage Tierbehandlungen Kinesiologie Ernährungsberatung
260 Herzlich willkommen! Seniorencomputer
Sankt Michael im Lungau
Computer für Senioren und Einsteiger
mugle.at Seniorencomputer Anfänger Einsteiger Einfacher PC
261 RM ? Computer ? RM-Computer-Technik GmbH
Sankt Georgen im Attergau
Willkommen bei RM ? Computer ? Technik im Attergau Ihrem professionellen Ansprechpartner für: Netwerkdesign
262 Kunstmalerei Andreas Steinert
Sankt Johann im Pongau
... Sie Kontakt auf oder rufen Sie an. Andreas Steinert Pöllnstraße Sankt Johann im Pongau Telefon +
263 LightFrazzle Startseite Gesundheitswesen
Sankt Marein im Mürztal
Platz für Ihren Slogan
lightfrazzle.at Gesundheitswesen Lichtarbeit Heilarbeit Geistiges Heilen
264 Herzlich willkommen bierbaumerbuam
Klein Sankt Paul
DIE BIERBAUMER BUAM Herzlich Willkommen auf unserer Website www.bierbaumerbuam.at
diebierbaumerbuam.at Bierbaumerbuam Die Bierbaumerbuam Die Bierbaumer Buam
265 Herzlich Willkommen Ferienhaus
Sankt Nikolai im Sausal
Ferienhaus in der Südsteiermark Winzerhaus in der Südsteiermark Urlaubsziel in der Südsteiermak
winzerhaus-windisch.at Ferienhaus Winzerhaus Südsteiermark Übernachtung
266 Pension St. Martin am Pension
Sankt Martin am Tennengebirge
Haus Verena Zentral gelegene Pension in St. Martin am Tennengebirge im Salzburger Lande. Familie ... am Tennengebirge    Advent facebook fan box top Pension Haus Verena Oberstein Sankt Martin
haus-verena.at Pension St. Martin Am Tennengebirge
267 St. Johann im Pongau Hotel
Sankt Johann im Pongau
... Aufenthalt ein. Unser Haus ist ein kleines feines Berghotel über den Dächern von Sankt Johann im Pongau
hotel-hahnbaum.at Hotel Nächtigung Schlafen St. Johann
268 Willkommen am Urlaubsbauernhof Großreithner ferienwohnung
Sankt Georgen am Walde
Großreithner Hof Familie Binder bietet Urlaub am Bauernhof in komfortablen Ferienwohnungen in der
groszreithner.at Ferienwohnung Reiten Bauernhof Urlaub
269 GTS Handel und GTS Handel und Service GmbH
Sankt Ulrich bei Steyr

270 Gasthof Hagmann | 3572 Gasthof
Sankt Leonhard am Hornerwald
Gasthof Hagmann im Waldviertel 3572 Sankt Leonhard am Hornerwald 36 ... . Leonhard Sankt Leonhard am Hornerwald Telefon/ Mobil e-Mail
gasthof-hagmann.at Gasthof Gasthaus Wirtshaus Unterkunft
271 Palfnerhof | BioBauernhof Palfner
Sankt Johann im Pongau

palfnerhof.at Palfner Palfnerhof Palfneralm Wölfler Appartements Appartement Apartment Apartme
272 I.e.p. Elektro Waha GmbH i.e.p. Elektro Waha GmbH
Sankt Margarethen im Burgenland
Die i.e.p. Elektro Waha GmbH ist in 7062 Sankt Margarethen im Burgenland Ihr professioneller Ansprechpartner ... anrufen. i.e.p. Elektro Waha GmbH Eisenstädter Sankt Margarethen im Burgenland Tel
273 HochalmRauris
Sankt Joahann Pongau

274 Hanfwelt RieglerNurscher
Sankt Leonhard am Forst

275 Willkommen Appartement Aloisia st
Sankt Johann in Tirol
Haus Aloisia in Sankt Johann in Tirol. Das Feriendomizil mitten im Ort. Idealer Ausgangspunkt für ihre
haus-aloisia.at St Johann Tirol Allgemein
276 Italiabenetti.com Herzlich Willkommen Italien
Sankt Johann in Tirol
Sie suchen einen erfahrenen und zuverlässigen Spezialisten im deutschitalienischen Sprachumfeld dann sind Sie hier
italiabenetti.at Italien Sprachen Sprachen Italien Italien Lernen Lernen Italien
277 Juwelier Lackner in St. Juwelier Lackner GmbH
Sankt Marein im Mürztal
... Sankt Marein im Mürztal Telefon + Tele + office?juwelier
278 Start LEBER Installationstechnik GmbH
Sankt Stefan im Rosental

279 :::MAD Events Verein
Sankt Valentin - AUSTRIA

280 Gartner Johann e.U. Gartner Johann e.U.
Sankt Martin im Sulmtal
... Gartner Johann e.U. Sankt Martin im Sulmtal Home Modelle Mazda Ab ?. -Türer Neuer Mazda Ab
281 MentalErfolgstrainingakademie Startseite innere
Sankt Magdalena am Lemberg
... du hier . Ich bin für Sie da! Mental-Erfolgstrainingakademie Buchberg Sankt Magdalena am Lemberg Telefon + Handy
mental-erfolgstrainingakademie.at Innere Kraft Mentaltraining Feuerlauf Sport
282 Michael Lamp | Kontakt werbung
Sankt Johann im Pongau
Michael Lamp grafik|werbung|design
michaellamp.at Werbung Michael Lamp Grafik Design
283 MGV St. Peter am
Sankt Peter am Ottersbach
... MGV St. Peter am Ottersbach Josef Haiden Jaun Sankt Peter am Ottersbach Telefon +
284 Austria Car Import
Groß Sankt Florian
... - Groß Sankt Florian Mobil + + Mail verkauf
285 Willkommen am Mitterbichlhof! Mitterbichl
Sankt Johann im Pongau
... einen herrlichen Blick auf den inmitten der Skiwelt Amadé liegendem Ort Sankt Johann im Pongau. Genießen
mitterbichlhof.at Mitterbichl Mitterbichlhof Vötter Toni Urlaub Pension Appartements Appartments
286 Herzlich willkommen! Seniorencomputer
Sankt Michael im Lungau
Computer für Senioren und Einsteiger
mymugle.at Seniorencomputer Anfänger Einsteiger Einfacher PC
287 Home Maschinen Prattes Prattes Maschinen-Handels GmbH
Sankt Peter im Sulmtal

288 Home RoverSepp Motor ÖMSV
Groß Sankt Florian
uf Roversepp gibt es Berichte Fotos und Videos zum österreichischen Motorsport. Schwerpunkte sind die
roversepp.at ÖMSV Driftchallenge Autocross Video
289 Lyonimmobilien.at LoftFactory Lyon Immobilien KG
Sankt Martin am Grimming

290 Polyesterverarbeitung Marx Marx GmbH
Sankt Martin im Sulmtal
Polyesterverarbeitung Marx
291 Katholische Pfarre Sankt Wolfgang
Sankt Wolfgang i.S.
... Bibliothek Kindergärten Links Kirche Sankt Wolfgang Copyright - Katholische Pfarre
292 Die Sonnenheimat Sonnenheimat St. Lorenzen GmbH Sonnenheimat
Sankt Lorenzen bei Knittelfeld
Sonnenheimat Pflegeheim St. Lorenzen bei Knittelfeld
sonnenheimat.at Sonnenheimat Pflegeheim Seniorenheim Pflegen Altersheim Steiermark St. Lorenzen
293 SOOL Salzquellwasser SOOL GmbH
Sankt Wolfgang im Salzkammergut

294 TF Versicherungs Vermögens GmbH TF Versicherungs- Vermögens GmbH Versicherungsmakl
Sankt Magdalena am Lemberg
TF Versicherungs Vermögens GmbH in Sankt Magdalena am Lemberg ist Ihr Versicherungsmakler mit einem breiten ... Versicherungs- Vermögens GmbH Buchberg Sankt Magdalena am Lemberg Kontakt Rufen Sie einfach an unter +
tfgmbh.at Versicherungsmakler Haftpflichtversicherung Unfallversicherung Lebensversiche
295 Solar Plus Home Elektroinstallate
Sankt Florian am Inn
Solar Plus Sankt Florian am Inn ... Plus Haid Sankt Florian am Inn Telefon + poettler.abgmx Verwenden
solar-plus.at Elektroinstallateur Strom Elektro Installation
296 Caravan Prattes Vermietung und Vermietung
Sankt Peter im Sulmtal
Wir Vermieten und Verkaufen Wohnwagen aller Art und Hersteller Neu und Gebraucht Österreich. Zubehör sowie ... Kerschbaum Sankt Peter im Sulmtal Telefon + Telefon +
caravan-prattes.at Vermietung Wohnwagenverleih Wohnwagenvermietung Wohnwagen
297 Blumen Egger Meisterfloristik Blumen
Sankt Johann im Pongau
... oo Sankt Johann im Pongau Telefon + o officeblumen-egger Öffnungszeiten
blumen-egger.at Blumen Florist Floristik BlumenEgger
298 Chiptuning OBD Tuning Softwareoptimierung PKW
Sankt Martin im Innkreis
OBD DPF LKW PKW Economy TuningGarantie Chiptuning Oberösterreich Chiptuning Innviertel Chiptuning Ried ... Sankt Martin i.I. Bernhard.Schilchergmx + auch Abends oder Samstag!!! Bitte
bsp-tuning.at PKW Chiptuning LKW Chiptuning Traktor Chiptuning Motorrad Chiptuning
299 Home
Sankt Georgen im Attergau

300 Versicherungsmakler in St. Johann Bommer & Partner
Sankt Johann im Pongau
Mit dem Versicherungsmarkler Bommer Partner steht Ihnen ein Team von Spezialisten zur Seite ... - für Ihre sichere Zukunft! Bommer Partner Versicherungsmakler GmbH Co KG - Hauptstraße - A- Sankt Johann
301 Startseite ATTLAS e.U. ATTLAS e.U.
Sankt Wolfgang im Salzkammergut
... e.U. - Weinbach Sankt Wolfgang im Salzkammergut .
Sankt Johann im Pongau
Wohlfühlappartement im Alpendorf Sanktjohann im pongau ski amade sportwelt amade bergfex. ... -Alpendorf Sankt Johann im Pongau Kontakt und Reservierung Nr. + +
appartement-alpendorf.at Appartement Ferienwohnung Urlaub Bergfex
303 Bäckerei Hauer Home Bäckerei
Sankt Martin im Innkreis
Die Bäckerei Hauer aus St. Martin heißt sie herzlich willkommen auf unserer neuen Website! Bei
baeckerei-hauer.at Bäckerei Konditorei Familie Hauer St.
304 BillardPub BALL'AZZO Home Pub
Sankt Johann im Pongau
Kommen Sie doch einfach bei BillardPub BALL'AZZO in Sankt Johann im Pongau vorbei! ... BALL'AZZO Über uns ... Billard-Pub BALL'AZZO Färbergasse Sankt Johann im Pongau Telefon +
ballazzo.at Pub Lokal Kneipe
305 Autoklinik Schneck Willkommen Autoklinik
Sankt Lorenzen im Mürztal
Die KfzReparaturwerkstatt Autoklinik Schneck in Sankt Lorenzen wartet repariert Ihr Auto. Erfahren Sie hier ... in Ihrer Kfz-Reparaturwerkstatt Autoklinik-Schneck in Sankt Lorenzen im Mürztal Sie suchen
autoklinik-schneck.at Autoklinik Schneck Kfz Reparaturwerkstatt Sankt Lorenzen
306 Home Customparts Indian custom
Sankt Peter im Sulmtal
Customparts für Victory Motorcycles und Sonderanfertigungen nach Kundenwunsch weiters sind ab 10/2013 Indian Motorräder und
customparts.at Custom Made Custom Bike Customchromeeurope.com Victory Motorcycles Custom
307 Fachplanungsbüro Ladenbau
Sankt Peter im Sulmtal
Beschreibung der Seite
fach-plan.at Ladenbau Geschäftseinrichtung Projektleitung
308 Home joomla
Sankt Stefan ob Leoben
Joomla! dynamische PortalEngine und ContentManagementSystem
drschmatz.at Joomla Joomla
309 El Akim Arabiens / Reitsport
Groß Sankt Florian
... weiter. Telefonberatung + EL AKIM ARABIENS Rassach A- Groß Sankt Florian +
el-akim-arabiens.at Reitsport Onlineshop Pferd Reiten
310 Espressoklaus
Sankt Magdalena a. Lemberg

311 Willkommen auf der Startseite FSEGR
Sankt Gotthard im Mühlkreis
FSEG Rottenegg St. Gotthard
fsegr.at FSEGR Fernsehempfangsgemeinschaft TV Fernsehen
312 Home
Sankt Georgen im Attergau

313 Herzlich Willkommen beim Ferienhaus Ferienhaus
Sankt Martin bei Lofer
Ferienhaus in St. Martin bei Lofer im Salzburger Saalachtal. Holiday House in St. Martin near
ferienhaus-stmartin.at Ferienhaus Lofer 'Holiday House' St. Martin
314 FF Eching Sankt Verein
Sankt Georgen bei Salzburg
Alles Wissenswerte von der Historie über Ergebnisse Veranstaltungen und neueste Trends bis hin zur
ffeching.at Verein Mitgliedschaft Beitrittserklärung Vereinsgeschichte
315 Willkommen | Rainers Modellbau
Sankt Leonhard am Forst

316 Stahlbau Metallbau
Groß Sankt Florian
... Sankt Florian A officeschlosserei-sturm
317 KFZ Werkstattausrüstung | Seilfett DANDLER e.U. KFZ
Altenmarkt bei Sankt Gallen
Bestellen Sie eine hochwertige KFZ Werkstattausrüstung in unserem Shop: Hebebühnen Kamasa Tools und vieles ... in Altenmarkt bei Sankt Gallen steht seit vielen Jahren für Produkte die höchsten Qualitätsansprüchen gerecht
kfz-dandler.at KFZ Werkstattausrüstung Seilfett Kaufen KFZ Hebebühne
318 Restaurant Kristall
Sankt Paul im Lavanttal
... Google+ Page und geben Sie eine Bewertung ab! Restaurant Kristall Sportplatzsiedlung Sankt
319 Warengruppen Artikel NUSANA
Sankt Peter am Hart
nusana.at NUSANA Gesundkostladen Vegetarische Lebensmittel Vegane Lebensmittel
320 Schoergialm Filzmoos
Sankt Joahann Pongau

321 Schuhhaus St.Johann im Pongau
Sankt Johann Pongau
... Daddy's Money Tamaris Schuhe MarcoTozzi Als Fachgeschäft in Sankt Johann/Pongau bieten
322 Willkommen
Klein Sankt Paul
3 Wendl Buam Unterhaltungsmusik Tanzmusik für viele Anlässe.
323 Vermessungskanzlei Dr. Hochstöger Dipl.Ing.
Sankt Georgen am Walde
Vermessungskanzlei Dr. Hochstöger Startseite/Begrüßungsseite
vermessung-hochstoeger.at Dipl.Ing. Dr. Franz Hochstöger Vermessung Vermessungskanzlei
324 Gerhard Lepschy Home
Sankt Oswald bei Freistadt

326 Home
Markt Sankt Martin

327 Wohnstudioresch Startseite Bauen
Sankt Johann im Pongau
Wohnstudioresch in Sankt Johann im Pongau bietet Leistungen zum Thema Bauen und Wohnen an. ... Sie uns Wohnstudioresch Hauptstraße Sankt Johann im Pongau Kontakt Rufen Sie einfach an unter +
wohnstudioresch.at Bauen Wohnen Leistungen Professionell
328 Kindergarten St. Peter: Kindergarten
Sankt Peter am Wimberg
... . Peter Pfarrerberg Sankt Peter am Wimberg Sitemap
329 Italiabenetti.com Herzlich Willkommen Italien
Sankt Johann in Tirol
Sie suchen einen erfahrenen und zuverlässigen Spezialisten im deutschitalienischen Sprachumfeld dann sind Sie hier
italienisch-lernen.at Italien Sprachen Sprachen Italien Italien Lernen Lernen Italien
330 Agrarhandel Lorber Karl Junior
Sankt Veit am Vogau
... Sie doch mal vorbei! Leistungen Produkte Aktionen Agrarhandel Lorber Karl Junior Wagendorfer Sankt
331 Home Maler
Sankt Martin im Sulmtal
Malerbetrieb Werner Koch Sankt Martin im Sulmtal ... Referenzen Aktuelles Kontakt Sie haben Fragen? Malerbetrieb Werner Koch Sulb Sankt Martin
malerkoch.at Maler Tapezierer Lackierer Betrieb
332 Mattexobjektausstattung mattexobjektausstattungs Webseite hotelbedarf
Sankt Johann im Pongau
Willkommen bei MattexObjektausstattung. Seit 1997 beraten wir unsere Kunden im Bereich Hotelmatratzen Bettwaren.
mattex-objektausstattung.at Hotelbedarf Hotelqualität Hotelmatratzen Objektausstattung
333 NaikidoShiatsu Startseite
Sankt Johann am Walde

334 Seniorenwohnheim Waldhof GmbH Seniorenwohnheim Waldhof GmbH Seniorenheim
Sankt Martin im Sulmtal
Seniorenwohnheim aus Otternitz lädt Sie herzlich ein.
seniorenheim-waldhof.at Seniorenheim Waldhof Seniorenwohnheim Waldhof Otternitz
335 Herzlich willkommen! | QLM
Sankt Michael in Obersteiermark
... ¼r Lebens- mitteluntersuchung und Umweltanalytik Bundesstr. A- Sankt Michael in Obersteiermark
336 Home
Sankt Nikolai im Sausal
... Hermann St. Nikolai i. Sausal Sankt Nikolai i. S Diese -Adresse
337 Partnervermittlung Scarlett Finde partnervermittlun
Sankt Johann im Pongau
Partnervermittlung Scarlett Finde Deinen Traumpartner Online aus der ganzen Welt
liebe.co.at Partnervermittlung Scarlett Online Traumaprtner
338 Home
Sankt Lorenzen am Wechsel

339 Tischlerei Gamsjäger Home
Sankt Nikolai im Sölktal
... Tischlerei Gamsjäger Sie haben Fragen? Tischlerei Gamsjäger Mößna Sankt Nikolai im Sölktal Telefon
340 Möbel Planungsbüro Auer Team A+S, Auer + Schwarzenbacher OG
Villach Sankt Ulrich
... - zur Verstärkung unseres Teams hinzuziehen. Team A+S Wernberger Villach Sankt Ulrich Telefon
341 Herzlich Willkommen! | Bernhard
Sankt Leonhard am Hornerwald
Bernhard Knapp bietet seit 1996 hochwertige Beratungsdienstleistungen für nationale und internationale Unternehmen.
342 Traze Startseite
Sankt Veit im Pongau

343 Hausbetreuung Mösl Mösl Markus Service GmbH Hausbetreuung
Sankt Georgen bei Salzburg
nbsp; ... und flexiblen Partner für die Reinigung Ihrer Gebäude in Sankt Georgen bei Salzburg und Umgebung? Herzlich
moesl-gmbh.at Hausbetreuung Mösl Mösl Markus Service GmbH
344 Home
Bad Sankt Leonhard
... Klagenfurtnerstraße Bad Sankt Leonhard / Termine erhalten Sie nach telefonischer Vereinbarung
345 Kürbishof Koch Home
Sankt Martin im Sulmtal
... machen. Mehr Hier finden Sie uns Kürbishof Koch Sulb Sankt Martin im Sulmtal Telefon +
346 Vermessungskanzlei Dr. Hochstöger Dipl.Ing.
Sankt Georgen am Walde
Vermessungskanzlei Dr. Hochstöger Startseite/Begrüßungsseite
xn--hochstger-57a.at Dipl.Ing. Dr. Franz Hochstöger Vermessung Vermessungskanzlei
347 Willkommen bei Ernährungsberatung Miriam Gesundheit
Sankt Georgen bei Salzburg
Ernährungsberatung Miriam Schaufler in Sankt Georgen bei Salzburg bietet Leistungen rund um das Thema Ernährung ... Lindenstraße A - Sankt Georgen bei Salzburg Kontakt Rufen Sie einfach an unter +
xn--ernhrungsprofi-7hb.at Gesundheit Kurse Hilfe Ernährung
348 Startseite
Sankt Michael im Lungau

349 ASTROENGEL Astrologie und
Sankt Ulrich am Pillersee

350 PdPhotography Bilder für
Sankt Aegyd am Neuwalde

351 Aufnäher Patches
Sankt Martin a. W.
Aufnäher für Vereine Clubs Behörden Privat. Schnelle Fertigung und Lieferung
352 Home Angebot
Sankt Martin im Mühlkreis
Muehl Quarter Games Ihr Entwicklerstudio ... uns auf Sie! Hier finden Sie uns Oberhart Sankt Martin im Mühlkreis Kontakt Rufen Sie einfach an unter +
pa-performance.at Angebot Kompetenz Beratung
353 Hubarbeitsbühnen Verleih Arbeitsbühne
Sankt Georgen am Walde
Willkommen bei den Hubsteigern von Wepper in Sankt Georgen am Walde. Vermietung von Arbeitsbühnen
354 Ganzheitliche Krebsberatung
Sankt Peter am Hart

355 Schneeweiss Landtechnik Kfz
Sankt Georgen im Attergau
Schneeweiss Landtechnik Metallbau Sankt Georgen im Attergau ... Sie uns Schneeweiss - Landtechnik - Metallbau Stelzhamerstraße Sankt Georgen im Attergau Kontakt Rufen
schneeweiss-landtechnik-metallbau.at Kfz Reparatur Werkstatt Auto
356 Strommer: Fliesen Feinsteinzeug M. Strommer Fliesen & Stein GmbH strommer
Söding - Sankt Johann
Strommer: Fliesen Feinsteinzeug Pflasterungen Bad Sanierungen und Steine jeder Art und Weise. ... strommer-fliesen Köppling A- Söding-Sankt Johann FN g ATU Layout Grafik
strommer-pflaster.at Strommer Fliesen Feinsteinzeug Pflasterung
357 Allesshirt.at Startseite Alles
Sankt Stefan im Rosental
Wir veredeln Ihre Textilien. Textildruck Paier
alles-shirt.at Alles Shirt Textildruck Paier
358 Autohaus H. Resch GmbH Autohaus H. Resch GmbH
Sankt Florian bei Linz
Herzlich Willkommen bei Autohaus H. Resch GmbH in 4490 Sankt Florian bei Linz Wir ... . Resch GmbH Wiener Sankt Florian bei Linz Telefon + Handy +
359 ATO GmbH Startseite ATO GmbH Autohaus
Sankt Stefan im Rosental
Das Autohaus ATO GmbH in Sankt Stefan im Rosental bietet eine großes Angebot an Neu
ato-shop.at Autohaus ATO GmbH City}} Großes Fahrzeugangebot
360 Alpenladys
Sankt Georgen im Lavanttal

361 Anhängerübersicht Anhängersortiment DANDLER e.U. PKW
Altenmarkt bei Sankt Gallen
Anhängerübersicht Anhängersortiment
d-trailer.at PKW Anhänger Anhänger AHV Montage
362 Apartment Müller Startseite Tourismus
Sankt Michael im Lungau
Apartment Müller in Sankt Michael im Lungau bietet Leistungen und Services zum Thema Tourismus an. ... Sankt Michael im Lungau heißt Sie willkommen! Verbringen Sie im Apartment Müller in Sankt Michael
apartment-mueller.at Tourismus Reisen Experte Professionell
363 Lerncoaching und Lernberatung
Sankt Margarethen im Burgenland
Lerncoaching für SchülerInnen StudentInnen Eltern PädagogInnen Firmen und SeniorInnen. Hilfe bei
364 Christa's Kerzendesign Galerie Handel
Sankt Johann im Pongau
Sankt Johann im Pongau
christas-kerzen.at Handel Großhandel Second Hand
365 Ferienspass Startseite Betreuung
Sankt Georgen am Kreischberg
die Ferienbetreuung für Kids von 4 14 Jahren
ferien-spass.at Betreuung
366 Polyesterverarbeitung Marx Polyester GFK Fibertech GmbH Polyesterverarbei
Sankt Martin im Sulmtal
Marx GmbH Polyester GFK Verarbeitung Sonderfertigung Beschichtungen Glasfaserverstärkte Kunststoffe Handlaminate
fibertech.at Polyesterverarbeitung GFK Verarbeitung Polyester Sonderfertigung
367 Zimmerei Gruber Startseite Zimmerei Johann Gruber GmbH Zimmerer
Sankt Johann im Pongau
Willkommen bei Ihrem Zimmerer Zimmerei Gruber ... Industriestraße Sankt Johann im Pongau Telefon + + holzbauzimmerei
zimmereigruber.at Zimmerer Zimmerei
368 Geführte Schitourenwoche im Lungau geführte
Sankt Andrä im Lungau
Langlaufschule Lungau geführte Skitouren im Lungau Freeriding im Lungau Schneeschuhwandern
xn--gefhrte-skitouren-42b.at Geführte Schitouren Geführte Schitouren Im Lungau
369 Attergau im Salzkammergut in
Sankt Georgen im Attergau
Der Attergau im Salzkammergut eingebettet zwischen Mondsee und Attersee bietet für den Urlaub ... Sonstiger Unterkunftsbetrieb Ort auswählen ... Ort auswählen ... Berg im Attergau Sankt Georgen im Attergau
370 Juwelier Kärnten Goldschmied Juwelier
Sankt Veit an der Glan
Goldschmiedemeister Uhrmachermeister und Juwelier Woschank aus Kärnten ist für seine Arbeit international beliebt und ... Eigenprodukte! top Juwelier Woschank Hauptpl Sankt Veit an der Glan Sitemap Kontakt
juwelier-woschank.at Juwelier Kärnten Juwelen Kärnten Schmuck Kärnten
371 Reisen24Online | günstig reisen günstig
Sankt Martin an der Raab
Reisesuchmaschine günstig Reisen | Preisvergleich und Angebote für Flüge Hotels und Ferienwohnungen
reisen24online.at Günstig Reisen Billige Flüge Billige Hotels
372 Home kamay.at Home
Sankt Peter in der Au
kamay.at Home
373 Gasthaus Ellinger
Sankt Peter in der Au

374 Herwig's Cafe Central
Sankt Ruprecht an der Raab
... Kontakt RSS Facebook Untere Hauptstraße Sankt Ruprecht an der Raab
375 Jägerwirt | Dreifaltigkeit am
Sankt Veit an der Glan
Das Forsthaus steht als Ferienhaus in Jägerstyling mit 4 Doppelzimmern Saunaanlage Kräutergarten zur ... und Dienstag Ruhetag! Adressdaten Gasthaus Jägerwirt Dreifaltigkeit Sankt Veit an der Glan Telefon
376 STHG Sturmer Handels GesmbH Impressum - STHG Sturmer Handels GesmbH
Bad Sankt Leonhard im Lavanttal
... Bad Sankt Leonhard im Lavanttal + - + - E
377 Personal Training Institut BODY & MOTION PT GmbH
Sankt Veit an der Glan
Willkommen im BODYmotion Personal Training Institut in St. Veit in Kärnten Ihrem Personal Fitness ... BODY MOTION PT GmbH Kirchgasse A Sankt Veit an der Glan Telefon + . E
378 Gärtnerei Sattler St. Sattler
Sankt Veit an der Glan
Gärtnerei Sattler St. Veit
blumen-sattler.at Sattler St. Veit
379 Klopeinersee Ferienwohnungen DULLER in Klopeinersee
Sankt Kanzian am Klopeiner See
Urlaub am Klopeiner See in Österreich Klopeinersee Ferienwohnungen DULLER in Kärnten Apartement ... Gregor Duller Unterburg Georgibergstraße A- Sankt Kanzian am Klopeiner See Kärnten
duller.at Klopeinersee Klopeiner See Ferienwohnungen Am Klopeiner
380 Homepage der Mühlviertler RauhTeufel Rauh
Sankt Georgen an der Gusen
Hier erfahren Sie alles über unseren Verein Mühlviertler RauhTeufel
rauhteufel.at Rauh RauhTeufel Teufel Mühlviertel
381 EMXPark | Elektro Motocross Emx
Sankt Margarethen an der Raab
EMXPark St. Margarethen an der Raab
emx-park.at Emx Park Elektro Motocross KTM
382 Startseite | Zimmerei +
- Sankt Michael im Burgenland
... Zimmerei + Holzbau WEBER Z+H Weber auf Facebook Deutsch Tschantschendorf A- Sankt Michael
383 Willkommen Wirtshaus Steirerhof steirerhof
Sankt Veit an der Glan
Wirtshaus Steirerhof das Bierlokal in Sankt Veit. Hausmannskost bodenständige Küche Mittagsmenü ... Sie uns Kontakt Wirtshaus Steirerhof das Bierlokal in Sankt Veit Hier geht´s zum Mittagsmenü Flashplayer
wirtshaus-steirerhof.at Steirerhof Sankt Veit Wirtshaussteirerhof Steyrerhof
384 Kuschlmonster Home Katinka kuschlmonster
Sankt Veit an der Glan
Hey! Ich bin ein Kuschlmonster / Kuschelmonster. Sei mein Monsterfreund und kümmere dich gut um
kuschlmonster.at Kuschlmonster Kuschelmonster Kuschlmonsta Kuschelmonsta österreich Katinka Greno
385 Betrieb | Der Rinderbaron
Sankt Martin an der Raab

386 ZÖHRER Home
Sankt Ruprecht an der Raab
... ZÖHRER KG ZÖHRER KG Willkommen bei ZÖHRER in Sankt Ruprecht an der Raab Unsere Tischlerei zeichnet
387 Gästehaus Steinmetz Hotel
Sankt Martin an der Raab
Gästehaus Steinmetz ist eine Pension in Sankt Martin an der Raab in der Sie
rainer-steinmetz.at Hotel Übernachtung Zimmer Buchen
388 REM Auto KG REM Auto KG
Sankt Veit an der Glan
Herzlich Willkommen bei REM Auto KG in 9300 Sankt Veit an der Glan Wir ... Auto KG Klagenfurter Sankt Veit an der Glan Telefon + Handy + (
389 Grüß Gott St.
Sankt Georgen an der Stiefing

390 Www.FlorianMori.at | | Gesellschaftsevents Portfolio
Sankt Kanzian am Klopeiner See
Startseite der Seite www.FlorianMori.at. Hier stellt der Fotograf Florian Mori seine Fotos und Composings vor.
florianmori.at Portfolio Florian Mori Fotografie Kärnten
391 Softwareoptimierung/ Chiptuning Chiptuning
Sankt Peter in der Au
tuningpower.at Chiptuning Softwareoptimierung Motortuning Kefer Reinhard Tuning OBD Tuning

Ergebnisse der Bewertungen für die Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Sankt Leonhard:
130 Bewertungen ergeben 3 StadtBranche Punkte

Sankt Leonhard
Salzburg ▪ 5083

Sankt ist ein vorangestellter Namenszusatz, der eine Person als Heiligen kennzeichnet. Es handelt sich um die eingedeutschte Form des lateinischen sanctus, sancta, sanctum, heilig. Dem entspricht ital. san, santo, santa, santi; franz. saint, sainte, saints, saintes; engl. saint, neugriech. ????? ágios, ???? agía. Das lateinische Wort sanctus bedeutete ursprünglich ? abgegrenzt? und bezog sich auf Tempel und heilige Bezirke .

Grödig5082, 5083
Taxach5083, 5400
Sankt Stadtplan Salzburg