Österreich › Ort

Taxach › Salzburg › Österreich › 5083 Erfahrungen

Branchenbuch Taxach

5083 Salzburg

Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 GASTROdat - Hotel Software Hotelsoftware

Der Allrounder für die digitale Verwaltung von Hotels! GASTROdat bietet eine umfangreiche Hotelsoftware in Österreich unabhängig von der Betriebsgröße an...
gastrodat.com/ Hotelsoftware Cookie Name Tools Hotels Datenschutzerklärung Nutzung Anbieter Zimmer Zweck Website Marketing Inhalte Laufzeit Software
2 Dr. Molnar Lungenfacharzt Anif Lungenfacharzt

Lungenarzt und Internist Dr. Clemens Molnar in Anif bei Salzburg bietet in seiner Praxis umfassende Behandlungen im Bereich der Pneumologie...
praxis-molnar.at/ Molnar Dr Anif Medizin Innere Facharzt Salzburg Pneumologie Praxis Clemens Kontakt Lungenfacharzt Pneumologe Pulmologe Team
3 island2go GmbH Marktplatz Für

DER kostenlose Anzeigenmarkt für ganz Mallorca: Die Verkaufsplattform island2go ist besonders für deutschsprachige Inselbewohner. Jetzt einfach online Kaufen und Verkaufen..
marktplatz-auktionen-kleinanzeigen-mallorca.com/ Mallorca Kleinanzeigen Marktplatz Auktionen Online Artikel Shops Informationen Neben Verkaufsplattform Verkäufers Top Shop Onlineshop Kontakt

Spezialisiert auf den Handel von CBD Öl und CBD Tropfen in unterschiedlicher Konzentration sind wir bestrebt die Lebensqualität unserer Kunden..
alpencbd.at Salzburg Bio Alpen Schnell Umgebung Event Stringfrom Arial Arrayflag
5 Harsch - Umzug Basel Umzug

Unsere ausgewiesene Erfahrung in den Bereichen Kunsttransport und internationale Umzüge bedeutet auch für Ihren lokalen Umzug einen echten Mehrwert. Gewiss..
harsch.ch/de/umzug-basel/ Umzüge Zug Umzug Firma Harsch Basel Schweiz Kunstwerke
6 Harsch - Umzug in Umzug

Es gibt tausenderlei Lösungen für einen Umzug in Zürich. Ohne Besichtigungstermin in Ihrem Zuhause ist es deshalb schwierig, eine genaue..
harsch.ch/de/umzug-zurich/ Umzug Zürich Harsch Umzüge Schweiz Umzugsunternehmen Kunstwerke Umz Vaud Firma Zug Basel Gland Zurich Gen
7 Stelzl Yachtcharter Yachtcharter

Mit Stelzl Yachtcharter in der Türkei, Griechenland, Kroatien sowie Mallorca, Italien und der Karibik segeln: Chartern und mieten Sie eine..
stelzl-yachtcharter.at/ Italien Stelzl Griechenland Türkei Kroatien Yachtcharter Karibik Mallorca Me Segeln Date Nexece Mieten Buchen Segelschiff
8 Müller Metall Metallbau

Seit über 15 Jahren haben wir uns auf die Metallverarbeitung spezialisiert. Dabei unterstützen wir Unternehmen u.a. aus dem Maschinen-, Anlagen-..
mueller-metall-form.de/ Metallverarbeitung Müller Metall Form Köln Spezialisten Ihr Blechverarbeitung Edelstahl Baugruppenfertigung Blech Inhaber Gehäuse Spezialist Angebot
9 Beller Hof Landwirtschaftliche Erzeugnisse

Beller Hof - der sympathische Gutshof am Rande von Köln. Frischer Spargel, Erdbeeren, Kirschen und Weihnachtsbäume direkt vom Erzeuger. Der..
beller-hof.de/ Spargel Hof Beller Erzeuger Erdbeeren Köln Gutshof Player Hofladen Saison Ende Radtour Eichholz Narzissenblüten Hofläden
10 Eintragung von Starglizz Kosmetik Hautpflege

Starglizz liefert das SPA direkt zu dir nach Hause. Mit der Schönheitsbox verwöhnst du deine Haut & lässt sie in..
starglizz.com Haut Editor Leben Zeit Balance Your Celebrate Beauty Matchen Mixen Schönheitsreinigung Streicheleinheit Peeling Du Power
11 Schorr Elektrokontrollen und Beratung Elektrokontrollen

Rheinsulz Laufenburg
Sie haben von Ihrem Netzbetreiber das Aufgebot zur Periodischen Elektrokontrolle erhalten? Wollen eine Liegenschaft verkaufen oder haben gegebenfalls eine gekauft?..
schorr-kontrollen.ch Elektrokontrollen Home Sicherheitsnachweis Kontrollen Periodischen Beratung Gewerbe Installationen Schorr Ihrem Periodische All Starkstromverordnung Gebäude Unslang
12 Loogo Umzüge Österreich Umzüge

Mit LOOGO sparen Sie Zeit und Nerven. Überlassen Sie Ihren Umzug den Profis von LOOGO! Profitieren Sie von unserer Organisation und..
loogo.at Umzug Möbel Kartons Möbelküche * + Umzugsunternehmen Privatumzug Angebot Firmenumzug Verpackungsmaterial * Umzüge Loogo Kartons * Lkw * Internationaler Neumöbel Abholung Karton Rechner Demokratischevolksrepublikkorearepublikkroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmauretanienmauritiusmazedonienmexikomikronesienmoldawienmonacomongoleimontenegromosambikmyanmarnamibianaurunepalneuseelandnicaraguaniederlandenigernigerianiuenorwegenösterreichomanosttimorpakistanpalästinensischeautonomiegebie
13 Gebäude- und Liegenschaftsbetreuung Lukaroski Hausbetreuung -

Gebäude- und Liegenschaftsbetreuung Lukaroski in Grödig. Unser Unternehmen bietet allgemeine und spezielle Reinigungen aller Art für Gebäude, Liegenschaften und Grünflächen..
14 Hausbetreuung Gebäude- und

Gebäude- und Liegenschaftsbetreuung Lukaroski in Grödig. Unser Unternehmen bietet allgemeine und spezielle Reinigungen aller Art für Gebäude, Liegenschaften und Grünflächen..
15 Inter Fahnen Beachflags & Fahnen

Grödig - Fürstenbrunn
Alle Beachfahnen, Beachflags und Werbefahnen sowie Stoffbanner von Inter Fahnen in Salzburg Österreich. Dekofahnen, Transparente im Großformatdruck und Tischwimpel zählen..
interfahnen.com/ Beachflag Display Zipper Tischwimpel Fahnen Rollup Transparente Inter Beachflags Kafka Werbefahnen Startnummern Trikotnummer Fahnenmasten Stoffbanner Bowwing Dali
16 BAUFuzzi dein online Baumarkt Baustoffhandel

BAUFuzzi - Ihr Baustoffhandel Shop wenn es um Qualitätsmaterial zu günstigen Preisen geht. Wir liefern Ihnen die Baustoffe, das Baumaterial..
17 BAUFuzzi dein online Baumarkt Baustoffhandel

BAUFuzzi - Ihr Baustoffhandel Shop wenn es um Qualitätsmaterial zu günstigen Preisen geht. Wir liefern Ihnen die Baustoffe, das Baumaterial..
18 Kalender für 2017 drucken Druckerei

DruckDiscount24.de bieten verschiedene Möglichkeiten an, individuelle Kalender für 2017 drucken zu lassen. Dafür stehen unterschiedliche Produkte, Formen und Varianten zur..
druckdiscount24.de/kalender-2017 Kalender Object Druckdiscountde Drucken Gratis Mail Leistungen Warenkorb Mein Dateivorgaben Here Tischplaner Wandkalender Wandplaner Schreibunterlagen Wire Bindung Visitenkarten Format Fehler Adresse* Vorname Pdfsherunter Datenschutzerklärung
19 Inter Fahnen Beachflags & Fahnen Textildruck

interfahnen.com/ Beachflag Tischwimpel Fahnen Transparente Inter Rollup Kafka Werbefahnen Beachflags Aufnäher Startnummern Stoffbanner Beachfahnen Fahnenmasten Trikotnummer Wappenform Bowcross Zweiteilige Startnummer
20 Inter Fahnen GmbH Druckerei

Inter Fahnen Stoffbanner, Beachfahnen und Beachflags sowie Werbefahnen und Fahnen – Produkte von Meisterhand. Inter Fahnen Salzburg, Österreich fertigt Dekofahnen..
interfahnen.com/ Fahnen Werbefahnen Rollup Inter Transparente Beachflags Beachfahnen Stoffbanner Dekofahnen Display Fahnenmasten Kafka Tischwimpel Salzburg Startnummern Cross Eco Xl
21 LAND-LEBEN Suppeneinlagen und Tiefkühlprodukte Nahrungsmittel

LAND-LEBEN Nahrungsmittel, Hersteller von Suppeneinlagen wie Backerbsen und Frittaten. Neben Suppeneinlagen produziert LAND-LEBEN auch weitere Convenience-Produkte wie Semmelknödel, Knödelbrot und..
land-leben.com/ Leben Land Croutons Backerbsen Suppeneinlagen Frittaten Semmelbrösel Rezepte Knödelbrot Salat Semmelknödel Pasteten Blog Snacks Sowie Buttermilch Suppe Kalte
22 Career Based Services Österreich Personalmarketing

Frischer Wind im Personalmanagement, Recruiting und Employer Branding: Employer Brand Manager Andrea Starzer zeigt mit Career Based Services, wie Online..
career-based-services.com/ Based Career Services Personalmarketing Employer Marketing Branding Andrea Karriere News Starzer Recruiting Jobshui Social Dienste Kalender
23 Aniferhof Hotelbetriebs GmbH Hotel

Der Aniferhof ist ein Hotel & Pension vor den Toren der Stadt Salzburg. Vom Hotel Aniferhof sind es nur wenige..
aniferhof.at/ Z Permanently The Server Pension Port Hotel Anif Officeaniferhofat Apache Advice Legal Friesacherâ´s Aniferhof
24 Skidata AG

Immer auf dem neusten Stand mit den Karriere News von SKIDATA: der Innovationsführer für Zutrittslösungen, Ticketsysteme und Parksysteme mit Sitz..
skidata.com/ueber-skidata/karriere.html Skidata Karriere Unser Stellen Offene Für Einblick Software Softwareentwicklung Jobs Stellenangebote Produktübersicht über Schüler Jobportal Lehrberufe Programmierer Ihrem Informiert
25 SKIDATA Careers Jobs

The software and hardware company SKIDATA, headquartered in Grödig, near Salzburg, Austria, has software development and hardware development jobs and..
skidata.com/en/about-skidata/career.html Skidata Career Open Areas Insight Contact Product Working Apprenticeship Job Portal Positions Attractions Meet Jobs Privacy Future Espaã±a Innovative
26 Inter Fahnen GmbH Druckdienstleistungen

Alle Beachfahnen, Beachflags und Werbefahnen sowie Stoffbanner von Inter Fahnen in Salzburg Österreich. Dekofahnen, Transparente im Großformatdruck und Tischwimpel zählen..
interfahnen.com/ Fahnen Inter Rollup Werbefahnen Transparente Beachflags Stoffbanner Beachfahnen Tischwimpel Aufnäher Fahnenmasten Display Beachflag Trikotnummer Kafka Change Produkte Dekofahnen
27 Friesacher Immobilien GmbH Anif Immobilien

Die Friesacher Immobilien GmbH hat Ihren Sitz in Anif bei Salzburg Österreich. Von hier aus werden österreichweit Immobilien wie Wohnung..
friesacher-immobilien.at/ Immobilien Salzburg Kauf Häuser Miete Anif Friesacher Villen Baugrund Wohnungen Wohnen Grundstücke Immobilienangebote Mietwohnungen Eigentumswohnungen Telefon Strae
28 PromoMasters Online Marketing Suchmaschinenoptimierung SEO

PromoMasters ist Spezialist für Suchmaschinenmarketing, Suchmaschinenoptimierung SEO, Suchmaschinenwerbung SEA und AdWords. Die Agentur mit Sitz in Salzburg und Wien verbessert..
promomasters.at/ Promomasters Marketing Suchmaschinen Suchmaschinenoptimierung Blog Internet Seminare Google Employer Social Firmen Schulung Meta Branding Adwords Keyword Advertising Zahnarzt Praxis Touristiker

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Taxach

+ Kommentar oder Kleinanzeige für Taxach eintragen!

29 Home Galeria Venti Dekoration
Dekorationen aller Art für Ihr Zuhause Ihre Firma Ihren Gastrobetrieb. Der persönliche Wein ... einzeln und eine an petra.koeniggaleria.at senden. Sie bekommen dann sofort die Kontodaten
galeria20.at Dekoration Wein Floristik Blumen Naturschalen Feng Shui
30 Artikelliste ZUMBAWEAR(R) Artikel ZUMBAWEAR
Artikelliste ZUMBAWEAR(R)
zumbawear-salzburg.at ZUMBAWEAR Salzburg Zumbaklamotten Zumbakleidung
31 RetteiMaskenWillkommen Andreas

rettei-masken.at Andreas Rettenbacher Salzburg Groedig
32 Anatomie Atlas Erlebnis anatomie
St. Leonhard
Online Version des populären Anatomie Atlas Erlebnis Mensch. Eine faszinierende Darstellung des menschlichen Körpers mit
erlebnis-mensch.at Anatomie Atlas Anatomie Körper Mensch
33 Willkommen bei Gerhard Bayer Gerhard
St. Leonhard
Willkommen bei Gerhard Bayer Training
gerhard-bayer.at Gerhard Bayer Burnout Firmengesundheit Personal
34 Sägewerk und Hobelwerk Klappacher Klappacher GmbH Sägewerk
St. Leonhard
Herstellung von Bauholz für Dachstuhl Terrassenboden Gartenzaun Schalung Balkon aus Lärche ... Dr. Friedrich Ödl-Weg Grödig-St. Leonhard/Salzburg Österreich Wir verarbeiten ausschließlich
saegewerk-klappacher.at Sägewerk Hobelwerk Holz Fichte
35 LEUBE Baustoffe ? Beton Zementwerk LEUBE GmbH
St. Leonhard
LEUBE: Das größte Zementwerk und Kalkwerk im Land Salzburg. Höchste Qualität bei Beton Zement
Gartenau bei Salzburg
Die Untersbergbahn entführt Sie zu wunderschönen Aussichten Wandern Klettern Paragleiten ... Analytics und Datenschutz Schneebericht Adresse UNTERSBERGBAHN TALSTATION Dr. Ödlweg Gartenau Tel
untersbergbahn.at Untersberg Sagenhaft Untersbergbahn Hausberg
37 Kingpack Home Angebot
Kingpack Grödig ... Home Über uns Angebot Galerie Kontakt Hier finden Sie uns Quellenstr. A- Gartenau
kingpack.at Angebot Kompetenz Beratung
38 Wer sind wir?
St. Leonhard
Wir bieten Ihnen eine umfangreiche Palette an Dienstleistungen von A wie Abfallmanagement über M wie
39 Salzburg Kreativ Salzburg
St. Leonhard
Tanzkleidung Babyarktikel Geschenke und vieles mehr personalisiert! ... drucken oder sticken. Babyartikel
40 SDaisy Web Shop SKIDATA AG kite
sDaisy Stellplätze für Räder
sdaisy.at Kite Kites Kiteboarding Kiteboards
41 Freie Immobilien in Salzburg
Ihr Immobilienmakler für freie Wohnungen Häuser Ferienwohnungen Büros und Gewerbe. Ob Miet ... Informationen... Kontakt Weiss Immobilien Marianne Weiss Staufenstraße Grossgmain +
43 Hundeonlineshop.at Hundezubehör
Grossgmain bei Salzburg
Hundezubehör Hundesportartikel Hundeshop Sporthund hundesport
hundeonlineshop.at Hundezubehör Furminator Strigel Hundeführerwesten Hundesportartikel
44 Malerei Nicco Krabath Maler
Malerei Nicco Krabath colour for your home and your life.
malerdesign.at Maler Malerei Malermeister Anstreicher

46 Willkommen Barrierefrei |

47 Dvc Computing GmbH dvc Computing - Software Service GmbH dvc
Großgmain - Austria
... Verfügbarkeit. dvc Computing - Software Service GmbH Grenzweg - Großgmain - Austria +
dvc.at Dvc Computing
48 Ferienwohnungen Wegscheider Wegscheider

49 Betten Engel Betten Engel GmbH Matratzen
... Bayernweg A- Großgmain - servicebetten-engel REINIGUNG Preise
betten-engel.at Matratzen Matratzenreinigung Mobile Hausstaubmilben
50 Freie Immobilien in Salzburg
Ihr Immobilienmakler für freie Wohnungen Häuser Ferienwohnungen Büros und Gewerbe. Ob Miet ... Informationen... Kontakt Weiss Immobilien Marianne Weiss Staufenstraße Grossgmain +
51 Willkommen
... - Großgmain Österreich + - + - This e-mail
52 Resilienz im Unternehmen Resilinez
Mit Resilienz in Unternehmen kann man sich auf Krisen und Veränderungen vorbereiten.
varbene.at Resilinez Unternehmen Resilinez Organisationale Resilinez
53 Ferienwohnung Österreich Winzerhäusl
Ferienwohnung mit Sonnenterrasse in Großgmain Österreich Das Winzerhäusl
54 J.d'Art Homepage kunst
J.d'Art Schmuck ist nicht nur auf Dawanda! Die Künstlerin hat in der zwischen Zeit eine
jdart.at Kunst Jdart Jdart Schmuck Edelsteinschmuck Modeschmuck
55 Resilienz im Unternehmen Resilinez
Mit Resilienz in Unternehmen kann man sich auf Krisen und Veränderungen vorbereiten.
mein-aufschwung.at Resilinez Unternehmen Resilinez Organisationale Resilinez
56 Ausflugstipps mit Kindern in rawuza Ausflug & Medien KG Ausflugstipps
Hier findest du die besten Ausflugstipps für Familien mit Kindern in Österreich aufgegliedert in
rawuza.at Ausflugstipps Freizeittipps Familien Kinder
57 Freie Immobilien in Salzburg
Ihr Immobilienmakler für freie Wohnungen Häuser Ferienwohnungen Büros und Gewerbe. Ob Miet ... Informationen... Kontakt Weiss Immobilien Marianne Weiss Staufenstraße Grossgmain +
58 Aurasomashop.at AuraSoma® die AuraSoma
Onlineshop mit Schwerpunkt AuraSoma LichtWesen Ingrid Auer und Energetische Produkte ... - Poststrasse - A- Großgmain- + - e.Mail. infoaurasomashop
aurasomashop.at AuraSoma AuraSoma Equilibrium Pomander Quintessenz
59 Rechnungen schreiben Kassensysteme Rechnungen
Großgmain bei Salzburg
Rechnungen schreiben mit Sammelfaktura und Kassensysteme mit Kassensoftware fuer den ... kropro Am Mesnerbach Großgmain bei Salzburg Österreich + UID Nummer ATU
gastro-kasse.at Rechnungen Rechnungen Schreiben
60 IT Dienstleistungen Multimedia
IT Service more in Salzburg Ihr Fachmann für Reparatur Einrichten Installieren ... können. Kontakt Wir beraten Sie gerne! Media Handwerk IT-Service more Matthias Landauer Salzburgerstraße
61 Home Kulturkreis Grossgmain

62 Willkommen bei Austria Spedddating

63 Willkommen im Haus Knobloch ferienwohnung
... . Ferienwohnung Knobloch ? Ernst Knobloch ? Plainburgstr. ? Großgmain ? Salzburg Stadt Umgebung M +
ferienwohnung-grossgmain.at Ferienwohnung Whirlpoolwanne Ausgestattet Entspannen
... meine Praxisräume u. a. Praxis für Ergotherapie ELISABETH ZÖHRER Salzburgerstrasse Braunau zoereraon
65 Www.weinkreation.at Weinkreation e.U. weinkreation
Einzigartige Wein für einzigartige Unternehmen
weinkreation.at Weinkreation Salzburg Anif Awinco
66 Startseite Ginzinger Landmaschinen GmbH

67 HandOver Beschaffungsdienstleistungs GmbH HandOver Beschaffungsdienstleistungs GmbH Einkauf
HandOver ist eine der führenden Beschaffungsorganisationen für Betreuungs Gesundheits und Bildungseinrichtungen in Österreich. ... Sonystraße A- Anif/Niederalm T + F + officehandover
handover.at Einkauf Einkaufen Beschaffung Beschaffen
68 Kulturdesign Unternehmenskultur ::: events
Ich konzipiere für Sie das Event den Presseauftritt das Werbemittel aus der Kultur
kulturdesign.at Events Pressearbeit Prarbeit Konzeption
69 Startseite PGV Austria Trunk GmbH Magento
Herzlich willkommen auf magazinshop.at! Hier findet jeder das richtige Abo: vom Kombiabo mit Vignette über
magazinshop.at Magento Varien Ecommerce
70 Startseite maxxup

71 Home Musikkapelle Anif
Musikkapelle Anif
72 Anifer Mühlenbrot GmbH in Anifer Mühlenbrot GmbH
Herzlich willkommen beim Anifer Mühlenbrot! Als Bäckerei mit langer Tradition finden Sie bei uns hochwertige
73 H2 Atemtest Spirometrie H2
Anif Austria
H2 Atemtest bei Dr. Lahner GmbH Salzburg  Spirometrie Gastrolyzer GastroCh4eck Smoklerlyzer
lahner-medizintechnik.at H2 Atemtest Medizintechnik Austria Spirometrie Spirometrie Spirostik Complete
74 Treml Punsch Peter Treml Getränke Collection GmbH
Der köstliche Punsch aus dem Salzburger Land schenkt Lebensfreude und wärmt Leib und Seele. Für
75 Willkommen bei Yoga Trainerin
... Anif Kontakt
76 Yachtcharter Stelzl Ihr yachtcharter
Mit Stelzl Yachtcharter in der Türkei Griechenland Kroatien sowie Mallorca Italien und
stelzl-yachtcharter.at Yachtcharter Stelzl Segeln Segelyachten
77 Stranig Reaktiv Sporttherapie STRANIG
STRANIG reaktiv ist ein medizinisches Trainingszentrum für Leistungssportler Freizeitsportler Patienten mit Rücken oder
stranig-reaktiv.at STRANIG Reaktiv Stranig Reaktiv Anif
78 Tanzbar KaiserRanch KaiserRanch - J&R Absenger OG tanzbar
Tanzbar KaiserRanch in Saltzburg ... Bundesstraße A- Anif-Niederalm Salzburg Reservierungen Mi + Do - Fr
tanzbar-kaiserranch.at Tanzbar Kaiserranch Kaiser Ranch
79 Bauteam 4 Planung Planung
Bauteam 4 Planung Bauleitung Bautrauml;ger ... - officebauteam.at
bauteam4.at Planung Bauleitung Bautrauml;ger
80 Wozak Mediendesign Wozak Wozak Mediendesign KG Werbeagentur
Wozak Mediendesign die Werbeagentur in Salzburg für Print und Onlinewerbung. Die Werbespezialisten für digitale ... Adresse Dorfstrasse A- Anif +.. +.. studiowozak Navigation
wozak.at Werbeagentur Werbung Mediendesign Webdesign
81 Dr. Barbara Brunner
Niederalm b. Salzburg
... Dr. Barbara Brunner Öffentlichkeitsarbeit Kirchenstraße Niederalm b. Salzburg -(
82 Home dentallabor.knoll GmbH dentallabor zahna

dentallabor-knoll.at Dentallabor Zahnarzt Zahnersatz
83 Die Ausdauerschmiede

84 Forstinger + Stadlmann ZTGmbH
Forstinger + Stadlmann ZTGmbH Ingenieurkonsulenten für Erdwissenschaften ist Ihr Partner in Salzburg und Oberösterreich für ... Forstinger + Stadlmann ZT-GmbH A - in Anif - Achenpromenade Telefon. + Tele
85 Fotostudio Birgit Gesierich
Hochzeitsfotografin Fotostudio Birgit Gesierich in NiederalmAnif bei Salzburg Österreich Modern klassisch
86 UCM Verlag B2C Corporate Publishing GmbH verlag
Der UCMVerlag mit Sitz in Anif bei Salzburg steht für innovative Magazine. Unter dem Dach ... Publishing GmbH BB Media GmbH Co KG Salzweg A - Anif-Salzburg + - +
ucm-verlag.at Verlag Mode Lifestyle Fashion Fachmagazin Magazin Anif Salzburg
87 Home | Joachim Ortner

89 AtelierAnif Auer
Atelier Anif bietet künstlerische Wandgestaltung und schöne Dinge für Wand und Wohnen. Mit über 30
atelier-anif.at Auer Wandgestaltung Wandmalerei Fresko
90 Reschbergerhof: Appartments Zimmer

91 Schober Zelte Grillgeräte
... Schober Zelte Grillgeräte Tiergartenstr. A- Anif Telefon + Mobil +
92 PromoMasters Suchmaschinenoptimierung SEO PromoMasters Online Marketing Ges.m.b.H. suchmaschinenopti
Anif bei Salzburg
Die Suchmaschinenmarketing Spezialisten von PromoMasters führen Suchmaschinenoptimierung von Tourismus Industrie und Handel durch. In ... ¼rst - Waldbadstraße A- Anif Salzburg Österreich Telefon + - - +
kohlfuerst.at Suchmaschinenoptimierung Seo Suchmaschinenmarketing Suchmaschinen Optimierung
93 Facecam Live Fotocontent
Anif bei Salzburg

94 Drkrueger.at Dr.
Arzt für Allgemeinmedizin ... sind jederzeit möglich) Fremdsprache Englisch Dr. Martin Krüger Mischlgutweg Anif
dr-krueger.at Dr. Krüger Anif Arzt Allgemeinmedizin
95 Verlag Anton Pustet | Pustet
Salzburgs ältester Buchverlag Verlag Anton Pustet exklusive Bücher zu Architektur Geschichte Neue Ethik
pustet.at Pustet Anton Pustet Verlag Salzburg Buch Architektur Geschichte
96 Cafe Wenger: Home
... -Garten. + infocafe-wenger
97 Chirurgie Rettenbacher

98 Architekt DI Christian Gneist Gneist
Architekt Architekturbüro Ziviltechniker ZT Architekt Gneist Christian Gneist Architektur ... Home Projekte Kontakt Atelier Alpenstraße im Silgmann Office A- Anif Anschrift
cg-architektur.at Gneist Architekt Architekt DI Christian Gneist
99 Legasthenie LRS

100 LaFIT Langmayr Fitness LaMED GmbH Training
Das LaFIT Trainingsprogramm kombiniert moderne Trainingslehre mit State of the ArtMedizin in Anif bei Salzburg. ... Langmayr mit Team LaFIT - Langmayr Fitness Hellbrunnerstraße Anif + Diese E
lafit.at Training Lafit Langmayr Trainingsprogramm
101 :: Pichler Media Trans Erika
Anif bei Salzburg
:: Pichler Media Trans :: Erika Pichler Dolmetschen und Übersetzen Anif bei Salzburg
pichler-media-trans.at Erika Pichler Dolmetschen Übersetzen Anif Salzburg Austria Dolmetscherin
102 Steuerberater Leitgeb Leitgeb Steuerberater

steuerberater-leitgeb.at Steuerberater Wirtschaftstreuhänder Steuer Buchhaltung
103 Bau deine Zukunft

105 Stonemotion bringt den Stein stonemotion e.U.
stonemotion bringt den Stein in Ihrem Unternehmen ins Rollen und entfaltet das gesamte Potenzial Ihrer
106 Arite design: projekt wg

107 Was die Politikwissenschafterin Kunst
Barbara WolfWicha PolitikWissenschaftKunst Politikwissenschafterin Herausgeberin Künstlerin Wort Schrift Bild Werdegang
barbara-wolf-wicha.at Kunst Kunstwerke Künstlerin Vielfalt Der
108 Cocktailtraum Startseite Partyservice
Cocktailtraum Ihr Party und Lieferservice in Anif gestaltet Ihre Partys professionell und kreativ
cocktailtraum.at Partyservice Lieferservice Feier Veranstaltung
109 Willkommen beim USK Anif
... Follow via Instagram Mail to USK Anif Schulweg Anif infousk-anif Anfahrt - Kontakt
110 Anif RiSKommunal Anif
Anif ... ) zum Seitenanfang Kontakt Gemeinde Anif Aniferstraße A- Anif T + F + DW
anif.gv.at Anif SalzburgSüd Schloss Anif Hellbrunn
111 Hotel Gastro Pool GmbH Hotel Gastro Pool GmbH HGP
Hotel Gastro Pool ist ein Unternehmen der hogastGruppe und auf die klein und mittelständische Hotellerie ... /So/Feiertag - + HGP Hotel Gastro Pool GmbH Sonystraße A- Anif/Niederalm T
hotelgastropool.at HGP Hotel Gastro Pool Gastro Pool
112 Hogast Einkaufsgenossenschaft für das hogast
hogast ist die führende Einkaufsorganisation der Hotellerie und Gastronomie. Sie ist genossenschaftlich organisiert und bietet ... für das Hotel- Gastgewerbe regGenmbH Sonystraße A- Anif/Niederalm T + F +
hogast.at Hogast Anif Einkaufen Einkauf
113 AnfahrPuffer zum Patent angemeldetes

114 Gerl Autoschaden Grödig Gerl GmbH Grödig
Firma Gerl Grödig Ihre Werkstatt zwischen Salzburg und Hallein nähe Berchtesgaden KFZ Lackiererei ... Sie gerne! Gerl GmbH Gartenauer a A- Grödig Diese -Adresse
unfallreparatur.at Grödig Salzburg Hallein Berchtesgaden
115 Willkommen im Schlaraffenland! SCHLARAFFENLAND GmbH
Willkommen im Schlaraffenland!
116 Home Körper
KoerperKult my body my Time
koerper-kult.at Körper Kult Miha Bodytec Powerplate
117 Hotels im Salzburger Land
Verbringen Sie Ihren Urlaub im Salzburger Land. Auf dieser Plattform werden zahlreiche Hotels im Salzburger
118 Peter kerschhofer | petigrafix.at

119 Hotel "DER HECHL" GASTROdat® Ges.m.b.H. Hotel
Das Hotel
hotel-hechl.at Hotel Hechl Tauplitz Skigebiet
120 GasthausFassl

121 Gerl Autoschaden Grödig Gerl GmbH Grödig
Firma Gerl Grödig Ihre Werkstatt zwischen Salzburg und Hallein nähe Berchtesgaden KFZ Lackiererei ... Sie gerne! Gerl GmbH Gartenauer a A- Grödig Diese -Adresse
pannendienst.at Grödig Salzburg Hallein Berchtesgaden
122 OSCG | Offshore Segelclub segel
Grödig - Salzburg
Willkommen beim OSCG dem Offshore Segelclub in Grödig bei Salzburg
oscg.at Segel Segeln Oscg Osc
123 Home: GuS Hausbetreuung

124 Invest ConceptManagement GmbH | its
Grödig - Salzburg
...its time to exchange...
roehrl.ic-m.at Its Time Exchange
125 Ideenpark

126 Kinder Spiel JUPIDU GmbH

127 Jujutsu Hebi /home.php

128 Journalist Translator Interpreter Elizabeth translation
Grödig bei Salzburg
Elizabeth Mortimer?austriabased translator and journalist offers professional language services english/german translations audioguides for
mortimer.at Translation Translations English German Journalism
129 Mybodycoach Mag. Sonja Fitness

mybodycoach.at Fitness Salzburg Personal Coaching Training
130 NEWS von MEV Neuigkeiten
NEUE Produkte von MEV ... ! Sonderpreis auf Anfrage!!!! Link To Detail Page ? Franz Hagenauer Oberfeldstraße A- Grödig Mail office
landmaschinenersatzteile.at Neuigkeiten MEV Neue Produkte
131 Gerl Autoschaden Grödig Gerl GmbH Grödig
Firma Gerl Grödig Ihre Werkstatt zwischen Salzburg und Hallein nähe Berchtesgaden KFZ Lackiererei ... Sie gerne! Gerl GmbH Gartenauer a A- Grödig Diese -Adresse
leihwagen.at Grödig Salzburg Hallein Berchtesgaden
132 Loxbox: Inside

133 Phönix Laboratorium GmbH Spagyra GmbH&Co KG phoenix
Phönix Laboratorium GmbH biologische Arzneimittel seit 1925. Spagyrische und homöopathische Produkte in Österreich
phoenix-lab.at Phoenix Laboratorium Arzneimittel Pharma
... im Gasthof - die Pflegerbrücke GASTHOF DIE PLEGERBRÜCKE IMPRESSUM Fam. Kohlstätter Pflegerstraße A-
135 Betreuung mit Herz Altenpflege
24 Stunden Betreuung für die eigenen vier Wände ... Text version Herzlich willkommen... ...bei www.Seniorenbetreuung.at -Stunden-Betreuung nach Maß
seniorenbetreuung24.at Altenpflege Seniorenbetreuung Häusliche Altenpflege 24
136 SMKKRAN SMK Vermietungs GMBH www.smkkran.at
SMK KRAN Vermietungs GMBH ... Copyright SMK-KRAN SMK Vermietungs GMBH Adresse A - Grödig Gewerbestrasse
smk-kran.at Www.smkkran.at Smk Kran Baumaschine
137 Huemer Onlineshop für PKW
... -Adresse Passwort Passwort vergessen? Kontakt HUEMER Ersatzteilshop Gewerbestrasse
138 Home bhb
bhb ... für Ihre Hilfe und Unterstützung! Unsere Bankdaten Raiffeisenbank Grödig Bauern helfen Bauern IBAN AT
bhb-sbg.at Bhb
139 Mybodycoach Mag. Sonja Fitness

aerobicinfo.at Fitness Salzburg Personal Coaching Training
140 Realtime.at Domain Services realtime.at Domain Services GmbH catch
We catch or snap your expired domain domain ... deleted .at domain names deleted domain names ... in the current auction list. Copyright
realtime.at Catch Doman Snap Domain Snap
141 Zauchensee Liftgesellschaft und Ski
Zauchensee Liftgesellschaft Veronika Scheffer Zauchensee in Verbund mit Ski Amade Altenmarkt Salzburger Land Alkohol am ... Peter Url geboren am .. Grödig Göllstraße vertreten durch Dr. Clemens Thiele
142 Die Psychotherapeutische Praxis Salzburg

144 :: EHC SALZBURGSUED eishockey
Ehc SalzburgSüd
ehc-salzburgsued.at Eishockey Ehc Salzburgsüd Volksgarten Klausner
145 Freiwillige Feuerwehr Grödig Freiwillige
Informationsportal rund um das Feuerwehrwesen in Grödig. ... Kontakt Erreichbarkeit Adresse Freiwillige Feuerwehr Grödig Gartenauerstraße A- Grödig
feuerwehr-groedig.at Freiwillige Feuerwehr Grödig FF Grödig Brand
146 Löschzug FürstenbrunnGlanegg Freiwillige
Informationsportal rund um das Feuerwehrwesen in Fürstenbrunn/Glanegg. ... Kontakt Erreichbarkeit Adresse LZ Fürstenbrunn-Glanegg Fürstenbrunnerstraße A- Grödig
ff-fuerstenbrunn.at Freiwillige Feuerwehr Fürstenbrunn/Glanegg FF Fürstenbrunn Brand
147 Fotograf mathias mandl actionfotos
Fotos von Fotograf Mathias Mandl Actionfotos Landschaften Sportbilder Fotograf in Salzburg
148 Gerl Autoschaden Grödig Gerl GmbH karosserie
25 Jahre Erfahrung haben uns zu einem Musterbetrieb im Raum Salzburg Hallein Grödig und ... Gerl GmbH Gartenauer a A- Grödig infogerl Partnerbetriebe Gerl Autoschaden Grödig
gerl.at Karosserie Center Süden Salzburgs Jahre Erfahrung Musterbetrieb Raum
149 Herzlich Willkommen! | GmachlCoaching herzlich
Dipl. Lebensund Sozialberaterin EMMTECH Tutorin Anwenderin Trainerin Coach Organisationsberaterin Ich glaube an Dich
gmachl-coaching.at Herzlich Willkommen Dipl Lebens Sozialberaterin Emm Tech Tutorin
150 Ing. Müller Kabelfernsehen Kabelfernsehen
Ing. Müller Kabelfernsehen Internet Elektro in Grödig ... Uhr und nach tel. Vereinbarung Kontakt Firma Ing. Herwig Müller Eichetstraße a A- Grödig Tel+
redzac-mueller.at Kabelfernsehen Internet Elektro Grödig
151 Schwab Reisen Schwab Reisen GmbH
... Herrenslalom Schwab Reisen Jahresprogramm Schwab KEG . Gangsteig . A- Grödig . -
152 Wiebecke GmbH in Grödig abgehängten

wiebecke.at Abgehängten Zwischendecken Wiebecke Salzburg Grödig Decken Systemdecken Akustikd
153 Babsi Winzer wibagrafix
... wibagrafix Barbara Winzer Marktstraße Grödig officewibagrafix +
154 HAMOTEK Montagetechnik HAMOTEK Montagetechnik GmbH Hassler
hamotek montagetechnik ein neuer Name mit vertrauten Werten
hamotek.at Hassler Oliver Hassler Hamotek United
155 Untersberg Apotheke | Ihre UNTERSBERG-APOTHEKE Schiebel KG
... Apotheke. Untersberg-Apotheke Mag. Karin Schiebel Marktstraße Grödig +
156 Businesscenter Grödig bcG Businesscenter
Das Businesscenter Grödig vermietet hochwertige Büros. ... lifestyle seminarraeume ueber wasserschutzgebiet werden businesscenter grödig ? Friedensstrasse ? A-
buero-vermietung-salzburg.at Businesscenter Grödig Vermietung
157 Mission Statement | B.A.U.M. mission
Grödig - Salzburg
Sustainable Development B.A.U.M. das Austrian Network for Sustainable Leadership und seine Mitglieder und
baumaustria.at Mission Statement Sustainable Development Austrian Network Leadership Mitglieder
158 Willkommen bei GE Art Kunstfels
... verstärkten Kunststoffen! Kontakt TEL +.. infoge-design Anschrift Buchbichl Grödig
ge-design.at Kunstfels Kunstfelsen GFK Glasfaser
159 Löschzug FürstenbrunnGlanegg Freiwillige
Informationsportal rund um das Feuerwehrwesen in Fürstenbrunn/Glanegg. ... Kontakt Erreichbarkeit Adresse LZ Fürstenbrunn-Glanegg Fürstenbrunnerstraße A- Grödig
feuerwehr-fuerstenbrunn.at Freiwillige Feuerwehr Fürstenbrunn/Glanegg FF Fürstenbrunn Brand
160 Weratech Software GmbH weratech GmbH newsroom
Weratech entwickelt Software Lösungen im Bereich Tourismus und Social Media ... Büro Geschäftsstelle Friedensstraße A- Grödig TEL + FAX + -
wohnbau-news.at Newsroom Weratech Socialmedia Social
161 Gerl Autoschaden Grödig Gerl GmbH Grödig
Firma Gerl Grödig Ihre Werkstatt zwischen Salzburg und Hallein nähe Berchtesgaden KFZ Lackiererei ... Sie gerne! Gerl GmbH Gartenauer a A- Grödig Diese -Adresse
lackiererei.at Grödig Salzburg Hallein Berchtesgaden
162 Kirchgasser Furniere Grödig KIRCHGASSER Furniere GmbH
Furniere Dünn geschnittenes Edelholz in bester Qualität für Ihre Möbel oder Musikinstrumente. Exklusiv aus ... . Erleben Sie Kostbarkeiten zum Anfassen! Kontakt Kirchgasser Furniere GmbH Neue-Heimat-
163 Mybodycoach Mag. Sonja Fitness

kinesis.at Fitness Salzburg Personal Coaching Training
164 Wir sind Ihr Ifor

165 Megabusiness
166 Michael Sieberer Mein Zinsen
Die Geschäftspraktiken einer Salzburger Bank ließen den Lebenstraum der Familie des Fleischhauers Michael Sieberer aus
mein-verlorenes-vertrauen.at Zinsen Liegenschaft Ruin Buch
167 Energethikerin Rositta Dolliner
Rositta Dolliner ist eine Energethikerin mit Herz. Rositta Dolliner arbeitet neben mit Engelenergie PranaVita ... da sie die Energiearbeit dankbar annehmen. Rositta Dolliner · Glanegger · Grödig +
168 Paxnatura Naturbestattung in paxnatura Naturbestattungs GmbH
paxnatura bietet eine würdevolle Alternative zum Friedhof. paxnatura informiert über Naturbestattungen in Österreich: Alle Infos ... A- Grödig Presse Kontakt Sitemap Facebook
169 ShowArts Lausenhammer Rene e.U. ShowArts Lausenhammer Rene e.U. Eventgestaltung
ShowArts Lausenhammer Rene e.U. Grödig ... .? Hier finden Sie uns ShowArts Lausenhammer Rene e.U. Oberfeldstraße Grödig Kontakt Rufen Sie einfach
showarts.at Eventgestaltung Event Veranstalter Party
170 MOR Photodesign photography
Architektur und Landschaft Privat und Businessportraits Fotografin und Photodesign Salzburg
orsinirosenberg.at Photography Marie OrsiniRosenberg Fotografin Photodesign
171 Home Original-Gletscherschliff e.U.

172 Mybodycoach Mag. Sonja Fitness

personaltrainingstudio.at Fitness Salzburg Personal Coaching Training
173 Weratech Software GmbH weratech GmbH newsroom
Weratech entwickelt Software Lösungen im Bereich Tourismus und Social Media ... Büro Geschäftsstelle Friedensstraße A- Grödig TEL + FAX + -
headline.co.at Newsroom Weratech Socialmedia Social
174 Hotel Der Königsleitner GASTROdat® Ges.m.b.H. königsleiten
Neues 4 Sterne Hotel Der Königsleitner und Ferienwohnungen Astn Hütten in Königsleiten. Die perfekte Unterkunft
koenigsleiten.at Königsleiten Nebelfrei Pollenfrei Kitzbüheler Alpen
175 NEWS von MEV Neuigkeiten
NEUE Produkte von MEV ... ! Sonderpreis auf Anfrage!!!! Link To Detail Page ? Franz Hagenauer Oberfeldstraße A- Grödig Mail office
mev.co.at Neuigkeiten MEV Neue Produkte
176 SpotOn Marketing GmbH SpotOn Marketing GmbH spoton
Grödig bei Salzburg
Makes you move! ... . Herausgeber SpotOn Marketing GmbH Friedensstraße Grödig bei Salzburg Österreich GESCHÄFTSFÜHRER
spoton-management.at Spoton Motorsport Dtm Susie Wolff
177 Kirchgasser Furniere Grödig KIRCHGASSER Furniere GmbH
Furniere Dünn geschnittenes Edelholz in bester Qualität für Ihre Möbel oder Musikinstrumente. Exklusiv aus ... . Erleben Sie Kostbarkeiten zum Anfassen! Kontakt Kirchgasser Furniere GmbH Neue-Heimat-
178 Weratech Software GmbH weratech GmbH newsroom
Weratech entwickelt Software Lösungen im Bereich Tourismus und Social Media ... Büro Geschäftsstelle Friedensstraße A- Grödig TEL + FAX + -
headline.or.at Newsroom Weratech Socialmedia Social
179 Werbegrafik Mühlbacher
... . Für ein unverbindliches Gespräch stehen wir Ihnen gerne zur Verfügung. Top Gewerbestraße Grödig
180 Trennungsagentur.at Powerd by trennungsagentur
Warum auch immer Sie sich trennen möchten wir helfen Ihnen dabei! Wir machen aus
trennungs-agentur.at Trennungsagentur Glückliche Unglücklichen Singles
181 Wittronik GmbH Home Wittronik GmbH Wittronik
Startseite ... ) Dokumente Broschüre Wittronik GmbH Hauptstrasse Grödig Austria + - +
wittronik.at Wittronik GmbH Startseite Home
182 OutdoorDesign Pflaster | outdoordesign.at
outdoordesign.at Pflaster | Naturstein | Garten | Grödig bei Salzburg ... - Pflaster Naturstein Garten Franz Peyerl Grödig Inhaber Reinhold Hinterberger
outdoor-design.at Outdoordesign.at Pflaster | Naturstein | Garten
183 Nuun
... Prötschhofstraße b Grödig Salzburg Telefon + infonuun www.nuun
184 Manufaktur2 für Werbung
Grödig bei Salzburg
Die Werbeagentur Salzburg Manufaktur2 eine Fullservice Agentur mit Standort in Grödig Salzburg ... Manufaktur² für Werbung und Design Neue Heimat . Grödig + officemanufaktur.at
185 Hobbyfotograf Markus Jäckel Hobbyfotograf
Grödig bei Salzburg
Portfolio von Salzburgs Hobbyfotografen Markus Jäckel. Feinste Fotografie in den Bereichen Akt Teilakt
mj-photography.at Hobbyfotograf Fotograf Markus Jäckel
186 Jagdwissen.at Jagdwissen

jagdwissen.at Jagdwissen Jagd ELearning Prüfung
187 Sat+kabel müller satanlagen
Ihr Spezialist für SATAnlagen KabelTV und Internet in Grödig und Umgebung ? Salzburg ... im Kabelnetz Previous Next Telefon + . kontaktsat-kabel-mueller Eichetstraße a Grödig
sat-kabel-mueller.at Satanlagen Satelliten Anlagen Kabeltv Kabelfernsehen
188 SUB Unternehmensberatung Sulzbacher Unternehmensberatung GmbH
... Unternehmen Leistungen Kunden Partner Sulzbacher Unternehmensberatung GmbH Göllstrasse C
189 Ferienhaus ?Haus Salzburg? Ferienwohnung
Glanegg bei Salzburg
Das Ferienhaus "Haus Salzburg" ist der perfekte Platz für Ihren Urlaub mit der ganzen ... ! Hier finden Sie uns Ferienhaus "Haus Salzburg" Jagerbauernweg Glanegg bei Salzburg Kontakt Rufen
ferienhaus-haussalzburg.at Ferienwohnung Salzburg Ferien Österreich Glanegg Urlaub
190 NEWS von MEV Neuigkeiten
NEUE Produkte von MEV ... Aktuelle Angebote ? Franz Hagenauer Oberfeldstraße A- Grödig Mail officemev.co
landmaschinen.co.at Neuigkeiten MEV Neue Produkte
191 VollSOLAR Ingenieurbüro vollSOLAR GmbH


Ergebnisse der Bewertungen für die Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Taxach:
129 Bewertungen ergeben 3 StadtBranche Punkte

Salzburg ▪ 5083

Grödig5082, 5083
Sankt Leonhard5083
Taxach Stadtplan Salzburg