Österreich › Ort

Anif › Salzburg › Österreich › 5081 Erfahrungen

Branchenbuch Anif

5081 Salzburg

Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 GASTROdat - Hotel Software Hotelsoftware

Der Allrounder für die digitale Verwaltung von Hotels! GASTROdat bietet eine umfangreiche Hotelsoftware in Österreich unabhängig von der Betriebsgröße an...
gastrodat.com/ Hotelsoftware Cookie Name Tools Hotels Datenschutzerklärung Nutzung Anbieter Zimmer Zweck Website Marketing Inhalte Laufzeit Software
2 Dr. Molnar Lungenfacharzt Anif Lungenfacharzt

Lungenarzt und Internist Dr. Clemens Molnar in Anif bei Salzburg bietet in seiner Praxis umfassende Behandlungen im Bereich der Pneumologie...
praxis-molnar.at/ Molnar Dr Anif Medizin Innere Facharzt Salzburg Pneumologie Praxis Clemens Kontakt Lungenfacharzt Pneumologe Pulmologe Team
3 island2go GmbH Marktplatz Für

DER kostenlose Anzeigenmarkt für ganz Mallorca: Die Verkaufsplattform island2go ist besonders für deutschsprachige Inselbewohner. Jetzt einfach online Kaufen und Verkaufen..
marktplatz-auktionen-kleinanzeigen-mallorca.com/ Mallorca Kleinanzeigen Marktplatz Auktionen Online Artikel Shops Informationen Neben Verkaufsplattform Verkäufers Top Shop Onlineshop Kontakt

Spezialisiert auf den Handel von CBD Öl und CBD Tropfen in unterschiedlicher Konzentration sind wir bestrebt die Lebensqualität unserer Kunden..
alpencbd.at Salzburg Bio Alpen Schnell Umgebung Event Stringfrom Arial Arrayflag
5 Harsch - Umzug Basel Umzug

Unsere ausgewiesene Erfahrung in den Bereichen Kunsttransport und internationale Umzüge bedeutet auch für Ihren lokalen Umzug einen echten Mehrwert. Gewiss..
harsch.ch/de/umzug-basel/ Umzüge Zug Umzug Firma Harsch Basel Schweiz Kunstwerke
6 Harsch - Umzug in Umzug

Es gibt tausenderlei Lösungen für einen Umzug in Zürich. Ohne Besichtigungstermin in Ihrem Zuhause ist es deshalb schwierig, eine genaue..
harsch.ch/de/umzug-zurich/ Umzug Zürich Harsch Umzüge Schweiz Umzugsunternehmen Kunstwerke Umz Vaud Firma Zug Basel Gland Zurich Gen
7 Stelzl Yachtcharter Yachtcharter

Mit Stelzl Yachtcharter in der Türkei, Griechenland, Kroatien sowie Mallorca, Italien und der Karibik segeln: Chartern und mieten Sie eine..
stelzl-yachtcharter.at/ Italien Stelzl Griechenland Türkei Kroatien Yachtcharter Karibik Mallorca Me Segeln Date Nexece Mieten Buchen Segelschiff
8 Müller Metall Metallbau

Seit über 15 Jahren haben wir uns auf die Metallverarbeitung spezialisiert. Dabei unterstützen wir Unternehmen u.a. aus dem Maschinen-, Anlagen-..
mueller-metall-form.de/ Metallverarbeitung Müller Metall Form Köln Spezialisten Ihr Blechverarbeitung Edelstahl Baugruppenfertigung Blech Inhaber Gehäuse Spezialist Angebot
9 Beller Hof Landwirtschaftliche Erzeugnisse

Beller Hof - der sympathische Gutshof am Rande von Köln. Frischer Spargel, Erdbeeren, Kirschen und Weihnachtsbäume direkt vom Erzeuger. Der..
beller-hof.de/ Spargel Hof Beller Erzeuger Erdbeeren Köln Gutshof Player Hofladen Saison Ende Radtour Eichholz Narzissenblüten Hofläden
10 Eintragung von Starglizz Kosmetik Hautpflege

Starglizz liefert das SPA direkt zu dir nach Hause. Mit der Schönheitsbox verwöhnst du deine Haut & lässt sie in..
starglizz.com Haut Editor Leben Zeit Balance Your Celebrate Beauty Matchen Mixen Schönheitsreinigung Streicheleinheit Peeling Du Power
11 Schorr Elektrokontrollen und Beratung Elektrokontrollen

Rheinsulz Laufenburg
Sie haben von Ihrem Netzbetreiber das Aufgebot zur Periodischen Elektrokontrolle erhalten? Wollen eine Liegenschaft verkaufen oder haben gegebenfalls eine gekauft?..
schorr-kontrollen.ch Elektrokontrollen Home Sicherheitsnachweis Kontrollen Periodischen Beratung Gewerbe Installationen Schorr Ihrem Periodische All Starkstromverordnung Gebäude Unslang
12 Loogo Umzüge Österreich Umzüge

Mit LOOGO sparen Sie Zeit und Nerven. Überlassen Sie Ihren Umzug den Profis von LOOGO! Profitieren Sie von unserer Organisation und..
loogo.at Umzug Möbel Kartons Möbelküche * + Umzugsunternehmen Privatumzug Angebot Firmenumzug Verpackungsmaterial * Umzüge Loogo Kartons * Lkw * Internationaler Neumöbel Abholung Karton Rechner Demokratischevolksrepublikkorearepublikkroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmauretanienmauritiusmazedonienmexikomikronesienmoldawienmonacomongoleimontenegromosambikmyanmarnamibianaurunepalneuseelandnicaraguaniederlandenigernigerianiuenorwegenösterreichomanosttimorpakistanpalästinensischeautonomiegebie
13 Gebäude- und Liegenschaftsbetreuung Lukaroski Hausbetreuung -

Gebäude- und Liegenschaftsbetreuung Lukaroski in Grödig. Unser Unternehmen bietet allgemeine und spezielle Reinigungen aller Art für Gebäude, Liegenschaften und Grünflächen..
14 Hausbetreuung Gebäude- und

Gebäude- und Liegenschaftsbetreuung Lukaroski in Grödig. Unser Unternehmen bietet allgemeine und spezielle Reinigungen aller Art für Gebäude, Liegenschaften und Grünflächen..
15 Inter Fahnen Beachflags & Fahnen

Grödig - Fürstenbrunn
Alle Beachfahnen, Beachflags und Werbefahnen sowie Stoffbanner von Inter Fahnen in Salzburg Österreich. Dekofahnen, Transparente im Großformatdruck und Tischwimpel zählen..
interfahnen.com/ Beachflag Display Zipper Tischwimpel Fahnen Rollup Transparente Inter Beachflags Kafka Werbefahnen Startnummern Trikotnummer Fahnenmasten Stoffbanner Bowwing Dali
16 BAUFuzzi dein online Baumarkt Baustoffhandel

BAUFuzzi - Ihr Baustoffhandel Shop wenn es um Qualitätsmaterial zu günstigen Preisen geht. Wir liefern Ihnen die Baustoffe, das Baumaterial..
17 BAUFuzzi dein online Baumarkt Baustoffhandel

BAUFuzzi - Ihr Baustoffhandel Shop wenn es um Qualitätsmaterial zu günstigen Preisen geht. Wir liefern Ihnen die Baustoffe, das Baumaterial..
18 Kalender für 2017 drucken Druckerei

DruckDiscount24.de bieten verschiedene Möglichkeiten an, individuelle Kalender für 2017 drucken zu lassen. Dafür stehen unterschiedliche Produkte, Formen und Varianten zur..
druckdiscount24.de/kalender-2017 Kalender Object Druckdiscountde Drucken Gratis Mail Leistungen Warenkorb Mein Dateivorgaben Here Tischplaner Wandkalender Wandplaner Schreibunterlagen Wire Bindung Visitenkarten Format Fehler Adresse* Vorname Pdfsherunter Datenschutzerklärung
19 Inter Fahnen Beachflags & Fahnen Textildruck

interfahnen.com/ Beachflag Tischwimpel Fahnen Transparente Inter Rollup Kafka Werbefahnen Beachflags Aufnäher Startnummern Stoffbanner Beachfahnen Fahnenmasten Trikotnummer Wappenform Bowcross Zweiteilige Startnummer
20 Inter Fahnen GmbH Druckerei

Inter Fahnen Stoffbanner, Beachfahnen und Beachflags sowie Werbefahnen und Fahnen – Produkte von Meisterhand. Inter Fahnen Salzburg, Österreich fertigt Dekofahnen..
interfahnen.com/ Fahnen Werbefahnen Rollup Inter Transparente Beachflags Beachfahnen Stoffbanner Dekofahnen Display Fahnenmasten Kafka Tischwimpel Salzburg Startnummern Cross Eco Xl
21 LAND-LEBEN Suppeneinlagen und Tiefkühlprodukte Nahrungsmittel

LAND-LEBEN Nahrungsmittel, Hersteller von Suppeneinlagen wie Backerbsen und Frittaten. Neben Suppeneinlagen produziert LAND-LEBEN auch weitere Convenience-Produkte wie Semmelknödel, Knödelbrot und..
land-leben.com/ Leben Land Croutons Backerbsen Suppeneinlagen Frittaten Semmelbrösel Rezepte Knödelbrot Salat Semmelknödel Pasteten Blog Snacks Sowie Buttermilch Suppe Kalte
22 Career Based Services Österreich Personalmarketing

Frischer Wind im Personalmanagement, Recruiting und Employer Branding: Employer Brand Manager Andrea Starzer zeigt mit Career Based Services, wie Online..
career-based-services.com/ Based Career Services Personalmarketing Employer Marketing Branding Andrea Karriere News Starzer Recruiting Jobshui Social Dienste Kalender
23 Aniferhof Hotelbetriebs GmbH Hotel

Der Aniferhof ist ein Hotel & Pension vor den Toren der Stadt Salzburg. Vom Hotel Aniferhof sind es nur wenige..
aniferhof.at/ Z Permanently The Server Pension Port Hotel Anif Officeaniferhofat Apache Advice Legal Friesacherâ´s Aniferhof
24 Skidata AG

Immer auf dem neusten Stand mit den Karriere News von SKIDATA: der Innovationsführer für Zutrittslösungen, Ticketsysteme und Parksysteme mit Sitz..
skidata.com/ueber-skidata/karriere.html Skidata Karriere Unser Stellen Offene Für Einblick Software Softwareentwicklung Jobs Stellenangebote Produktübersicht über Schüler Jobportal Lehrberufe Programmierer Ihrem Informiert
25 SKIDATA Careers Jobs

The software and hardware company SKIDATA, headquartered in Grödig, near Salzburg, Austria, has software development and hardware development jobs and..
skidata.com/en/about-skidata/career.html Skidata Career Open Areas Insight Contact Product Working Apprenticeship Job Portal Positions Attractions Meet Jobs Privacy Future Espaã±a Innovative
26 Inter Fahnen GmbH Druckdienstleistungen

Alle Beachfahnen, Beachflags und Werbefahnen sowie Stoffbanner von Inter Fahnen in Salzburg Österreich. Dekofahnen, Transparente im Großformatdruck und Tischwimpel zählen..
interfahnen.com/ Fahnen Inter Rollup Werbefahnen Transparente Beachflags Stoffbanner Beachfahnen Tischwimpel Aufnäher Fahnenmasten Display Beachflag Trikotnummer Kafka Change Produkte Dekofahnen
27 Friesacher Immobilien GmbH Anif Immobilien

Die Friesacher Immobilien GmbH hat Ihren Sitz in Anif bei Salzburg Österreich. Von hier aus werden österreichweit Immobilien wie Wohnung..
friesacher-immobilien.at/ Immobilien Salzburg Kauf Häuser Miete Anif Friesacher Villen Baugrund Wohnungen Wohnen Grundstücke Immobilienangebote Mietwohnungen Eigentumswohnungen Telefon Strae
28 PromoMasters Online Marketing Suchmaschinenoptimierung SEO

PromoMasters ist Spezialist für Suchmaschinenmarketing, Suchmaschinenoptimierung SEO, Suchmaschinenwerbung SEA und AdWords. Die Agentur mit Sitz in Salzburg und Wien verbessert..
promomasters.at/ Promomasters Marketing Suchmaschinen Suchmaschinenoptimierung Blog Internet Seminare Google Employer Social Firmen Schulung Meta Branding Adwords Keyword Advertising Zahnarzt Praxis Touristiker

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Anif

+ Kommentar oder Kleinanzeige für Anif eintragen!

29 Www.weinkreation.at Weinkreation e.U. weinkreation
Einzigartige Wein für einzigartige Unternehmen
weinkreation.at Weinkreation Salzburg Anif Awinco
30 Startseite Ginzinger Landmaschinen GmbH

31 HandOver Beschaffungsdienstleistungs GmbH HandOver Beschaffungsdienstleistungs GmbH Einkauf
HandOver ist eine der führenden Beschaffungsorganisationen für Betreuungs Gesundheits und Bildungseinrichtungen in Österreich. ... Sonystraße A- Anif/Niederalm T + F + officehandover
handover.at Einkauf Einkaufen Beschaffung Beschaffen
32 Kulturdesign Unternehmenskultur ::: events
Ich konzipiere für Sie das Event den Presseauftritt das Werbemittel aus der Kultur
kulturdesign.at Events Pressearbeit Prarbeit Konzeption
33 Startseite PGV Austria Trunk GmbH Magento
Herzlich willkommen auf magazinshop.at! Hier findet jeder das richtige Abo: vom Kombiabo mit Vignette über
magazinshop.at Magento Varien Ecommerce
34 Startseite maxxup

35 Home Musikkapelle Anif
Musikkapelle Anif ... Pressefotos Mitgliederbereich Herzlich willkommen auf der Homepage der Musikkapelle Anif
36 Anifer Mühlenbrot GmbH in Anifer Mühlenbrot GmbH
Herzlich willkommen beim Anifer Mühlenbrot! Als Bäckerei mit langer Tradition finden Sie bei uns hochwertige ... Anifer Mühlenbrot GmbH Startseite Saisonales Kontakt Anfahrt Zurück Weiter Besuchen
37 Willkommen bei Yoga Trainerin
... Anif Kontakt
38 Stranig Reaktiv Sporttherapie STRANIG
STRANIG reaktiv ist ein medizinisches Trainingszentrum für Leistungssportler Freizeitsportler Patienten mit Rücken oder
stranig-reaktiv.at STRANIG Reaktiv Stranig Reaktiv Anif
39 Bauteam 4 Planung Planung
Bauteam 4 Planung Bauleitung Bautrauml;ger ... - officebauteam.at
bauteam4.at Planung Bauleitung Bautrauml;ger
40 Wozak Mediendesign Wozak Wozak Mediendesign KG Werbeagentur
Wozak Mediendesign die Werbeagentur in Salzburg für Print und Onlinewerbung. Die Werbespezialisten für digitale ... Adresse Dorfstrasse A- Anif +.. +.. studiowozak Navigation
wozak.at Werbeagentur Werbung Mediendesign Webdesign
41 Die Ausdauerschmiede

42 Forstinger + Stadlmann ZTGmbH
Forstinger + Stadlmann ZTGmbH Ingenieurkonsulenten für Erdwissenschaften ist Ihr Partner in Salzburg und Oberösterreich für ... Forstinger + Stadlmann ZT-GmbH A - in Anif - Achenpromenade Telefon. + Tele
43 Home | Joachim Ortner

45 AtelierAnif Auer
Atelier Anif bietet künstlerische Wandgestaltung und schöne Dinge für Wand und Wohnen. Mit über 30
atelier-anif.at Auer Wandgestaltung Wandmalerei Fresko
46 Reschbergerhof: Appartments Zimmer
... Ferienwohnung Anif Erdig und naturnah das ist der Reschbergerhof in Anif von außen. Style gepaart
47 Schober Zelte Grillgeräte
... Schober Zelte Grillgeräte Tiergartenstr. A- Anif Telefon + Mobil +
48 Drkrueger.at Dr.
Arzt für Allgemeinmedizin ... sind jederzeit möglich) Fremdsprache Englisch Dr. Martin Krüger Mischlgutweg Anif
dr-krueger.at Dr. Krüger Anif Arzt Allgemeinmedizin
49 Verlag Anton Pustet | Pustet
Salzburgs ältester Buchverlag Verlag Anton Pustet exklusive Bücher zu Architektur Geschichte Neue Ethik
pustet.at Pustet Anton Pustet Verlag Salzburg Buch Architektur Geschichte
50 Cafe Wenger: Home
... liebt ist hier richtig aufgehoben. Café Wenger - das absolute Muss in Anif. Cafe-/Bar-Kult Tage
51 Chirurgie Rettenbacher

52 Architekt DI Christian Gneist Gneist
Architekt Architekturbüro Ziviltechniker ZT Architekt Gneist Christian Gneist Architektur ... Home Projekte Kontakt Atelier Alpenstraße im Silgmann Office A- Anif Anschrift
cg-architektur.at Gneist Architekt Architekt DI Christian Gneist
53 Legasthenie LRS

54 LaFIT Langmayr Fitness LaMED GmbH Training
Das LaFIT Trainingsprogramm kombiniert moderne Trainingslehre mit State of the ArtMedizin in Anif bei Salzburg. ... Langmayr mit Team LaFIT - Langmayr Fitness Hellbrunnerstraße Anif + Diese E
lafit.at Training Lafit Langmayr Trainingsprogramm
55 Steuerberater Leitgeb Leitgeb Steuerberater

steuerberater-leitgeb.at Steuerberater Wirtschaftstreuhänder Steuer Buchhaltung
56 Bau deine Zukunft

58 Stonemotion bringt den Stein stonemotion e.U.
stonemotion bringt den Stein in Ihrem Unternehmen ins Rollen und entfaltet das gesamte Potenzial Ihrer
59 Arite design: projekt wg

60 Was die Politikwissenschafterin Kunst
Barbara WolfWicha PolitikWissenschaftKunst Politikwissenschafterin Herausgeberin Künstlerin Wort Schrift Bild Werdegang ... UND Wissenschafterin Herausgeberin Marie Jahoda sozialwissenschaftliche Studien Kunst als neues Medium Anif Kultur
barbara-wolf-wicha.at Kunst Kunstwerke Künstlerin Vielfalt Der
61 Cocktailtraum Startseite Partyservice
Cocktailtraum Ihr Party und Lieferservice in Anif gestaltet Ihre Partys professionell und kreativ
cocktailtraum.at Partyservice Lieferservice Feier Veranstaltung
62 Willkommen beim USK Anif
... Follow via Instagram Mail to USK Anif Schulweg Anif infousk-anif Anfahrt - Kontakt
63 Anif RiSKommunal Anif
Anif ... ) zum Seitenanfang Kontakt Gemeinde Anif Aniferstraße A- Anif T + F + DW
anif.gv.at Anif SalzburgSüd Schloss Anif Hellbrunn
64 Hotel Gastro Pool GmbH Hotel Gastro Pool GmbH HGP
Hotel Gastro Pool ist ein Unternehmen der hogastGruppe und auf die klein und mittelständische Hotellerie ... /So/Feiertag - + HGP Hotel Gastro Pool GmbH Sonystraße A- Anif/Niederalm T
hotelgastropool.at HGP Hotel Gastro Pool Gastro Pool
65 Hogast Einkaufsgenossenschaft für das hogast
hogast ist die führende Einkaufsorganisation der Hotellerie und Gastronomie. Sie ist genossenschaftlich organisiert und bietet ... für das Hotel- Gastgewerbe regGenmbH Sonystraße A- Anif/Niederalm T + F +
hogast.at Hogast Anif Einkaufen Einkauf
66 AnfahrPuffer zum Patent angemeldetes

67 H2 Atemtest Spirometrie H2
Anif Austria
H2 Atemtest bei Dr. Lahner GmbH Salzburg  Spirometrie Gastrolyzer GastroCh4eck Smoklerlyzer
lahner-medizintechnik.at H2 Atemtest Medizintechnik Austria Spirometrie Spirometrie Spirostik Complete
68 Treml Punsch Peter Treml Getränke Collection GmbH
Der köstliche Punsch aus dem Salzburger Land schenkt Lebensfreude und wärmt Leib und Seele. Für
69 PromoMasters Suchmaschinenoptimierung SEO PromoMasters Online Marketing Ges.m.b.H. suchmaschinenopti
Anif bei Salzburg
Die Suchmaschinenmarketing Spezialisten von PromoMasters führen Suchmaschinenoptimierung von Tourismus Industrie und Handel durch. In ... ¼rst - Waldbadstraße A- Anif Salzburg Österreich Telefon + - - +
kohlfuerst.at Suchmaschinenoptimierung Seo Suchmaschinenmarketing Suchmaschinen Optimierung
70 Facecam Live Fotocontent
Anif bei Salzburg

71 :: Pichler Media Trans Erika
Anif bei Salzburg
:: Pichler Media Trans :: Erika Pichler Dolmetschen und Übersetzen Anif bei Salzburg ... Anif bei Salzburg Skip to content Home pichler-media-trans
pichler-media-trans.at Erika Pichler Dolmetschen Übersetzen Anif Salzburg Austria Dolmetscherin
72 Artikelliste ZUMBAWEAR(R) Artikel ZUMBAWEAR
Artikelliste ZUMBAWEAR(R)
zumbawear-salzburg.at ZUMBAWEAR Salzburg Zumbaklamotten Zumbakleidung
73 RetteiMaskenWillkommen Andreas

rettei-masken.at Andreas Rettenbacher Salzburg Groedig
74 Anatomie Atlas Erlebnis anatomie
St. Leonhard
Online Version des populären Anatomie Atlas Erlebnis Mensch. Eine faszinierende Darstellung des menschlichen Körpers mit
erlebnis-mensch.at Anatomie Atlas Anatomie Körper Mensch
75 Willkommen bei Gerhard Bayer Gerhard
St. Leonhard
Willkommen bei Gerhard Bayer Training
gerhard-bayer.at Gerhard Bayer Burnout Firmengesundheit Personal
76 Sägewerk und Hobelwerk Klappacher Klappacher GmbH Sägewerk
St. Leonhard
Herstellung von Bauholz für Dachstuhl Terrassenboden Gartenzaun Schalung Balkon aus Lärche ... Dr. Friedrich Ödl-Weg Grödig-St. Leonhard/Salzburg Österreich Wir verarbeiten ausschließlich
saegewerk-klappacher.at Sägewerk Hobelwerk Holz Fichte
77 LEUBE Baustoffe ? Beton Zementwerk LEUBE GmbH
St. Leonhard
LEUBE: Das größte Zementwerk und Kalkwerk im Land Salzburg. Höchste Qualität bei Beton Zement
Gartenau bei Salzburg
Die Untersbergbahn entführt Sie zu wunderschönen Aussichten Wandern Klettern Paragleiten ... Analytics und Datenschutz Schneebericht Adresse UNTERSBERGBAHN TALSTATION Dr. Ödlweg Gartenau Tel
untersbergbahn.at Untersberg Sagenhaft Untersbergbahn Hausberg
79 Kingpack Home Angebot
Kingpack Grödig ... Home Über uns Angebot Galerie Kontakt Hier finden Sie uns Quellenstr. A- Gartenau
kingpack.at Angebot Kompetenz Beratung
80 Wer sind wir?
St. Leonhard
Wir bieten Ihnen eine umfangreiche Palette an Dienstleistungen von A wie Abfallmanagement über M wie
81 Salzburg Kreativ Salzburg
St. Leonhard
Tanzkleidung Babyarktikel Geschenke und vieles mehr personalisiert! ... drucken oder sticken. Babyartikel
82 SDaisy Web Shop SKIDATA AG kite
sDaisy Stellplätze für Räder
sdaisy.at Kite Kites Kiteboarding Kiteboards
83 Freie Immobilien in Salzburg
Ihr Immobilienmakler für freie Wohnungen Häuser Ferienwohnungen Büros und Gewerbe. Ob Miet ... Informationen... Kontakt Weiss Immobilien Marianne Weiss Staufenstraße Grossgmain +
85 Hundeonlineshop.at Hundezubehör
Grossgmain bei Salzburg
Hundezubehör Hundesportartikel Hundeshop Sporthund hundesport
hundeonlineshop.at Hundezubehör Furminator Strigel Hundeführerwesten Hundesportartikel
86 Malerei Nicco Krabath Maler
Malerei Nicco Krabath colour for your home and your life.
malerdesign.at Maler Malerei Malermeister Anstreicher

88 Willkommen Barrierefrei |

89 Dvc Computing GmbH dvc Computing - Software Service GmbH dvc
Großgmain - Austria
... Verfügbarkeit. dvc Computing - Software Service GmbH Grenzweg - Großgmain - Austria +
dvc.at Dvc Computing
90 Ferienwohnungen Wegscheider Wegscheider

91 Betten Engel Betten Engel GmbH Matratzen
... Bayernweg A- Großgmain - servicebetten-engel REINIGUNG Preise
betten-engel.at Matratzen Matratzenreinigung Mobile Hausstaubmilben
92 Freie Immobilien in Salzburg
Ihr Immobilienmakler für freie Wohnungen Häuser Ferienwohnungen Büros und Gewerbe. Ob Miet ... Informationen... Kontakt Weiss Immobilien Marianne Weiss Staufenstraße Grossgmain +
93 Willkommen
... - Großgmain Österreich + - + - This e-mail
94 Resilienz im Unternehmen Resilinez
Mit Resilienz in Unternehmen kann man sich auf Krisen und Veränderungen vorbereiten.
varbene.at Resilinez Unternehmen Resilinez Organisationale Resilinez
95 Ferienwohnung Österreich Winzerhäusl
Ferienwohnung mit Sonnenterrasse in Großgmain Österreich Das Winzerhäusl
96 J.d'Art Homepage kunst
J.d'Art Schmuck ist nicht nur auf Dawanda! Die Künstlerin hat in der zwischen Zeit eine
jdart.at Kunst Jdart Jdart Schmuck Edelsteinschmuck Modeschmuck
97 Resilienz im Unternehmen Resilinez
Mit Resilienz in Unternehmen kann man sich auf Krisen und Veränderungen vorbereiten.
mein-aufschwung.at Resilinez Unternehmen Resilinez Organisationale Resilinez
98 Ausflugstipps mit Kindern in rawuza Ausflug & Medien KG Ausflugstipps
Hier findest du die besten Ausflugstipps für Familien mit Kindern in Österreich aufgegliedert in
rawuza.at Ausflugstipps Freizeittipps Familien Kinder
99 Freie Immobilien in Salzburg
Ihr Immobilienmakler für freie Wohnungen Häuser Ferienwohnungen Büros und Gewerbe. Ob Miet ... Informationen... Kontakt Weiss Immobilien Marianne Weiss Staufenstraße Grossgmain +
100 Aurasomashop.at AuraSoma® die AuraSoma
Onlineshop mit Schwerpunkt AuraSoma LichtWesen Ingrid Auer und Energetische Produkte ... - Poststrasse - A- Großgmain- + - e.Mail. infoaurasomashop
aurasomashop.at AuraSoma AuraSoma Equilibrium Pomander Quintessenz
101 Rechnungen schreiben Kassensysteme Rechnungen
Großgmain bei Salzburg
Rechnungen schreiben mit Sammelfaktura und Kassensysteme mit Kassensoftware fuer den ... kropro Am Mesnerbach Großgmain bei Salzburg Österreich + UID Nummer ATU
gastro-kasse.at Rechnungen Rechnungen Schreiben
102 IT Dienstleistungen Multimedia
IT Service more in Salzburg Ihr Fachmann für Reparatur Einrichten Installieren ... können. Kontakt Wir beraten Sie gerne! Media Handwerk IT-Service more Matthias Landauer Salzburgerstraße
103 Home Kulturkreis Grossgmain

104 Willkommen bei Austria Spedddating

105 Willkommen im Haus Knobloch ferienwohnung
... . Ferienwohnung Knobloch ? Ernst Knobloch ? Plainburgstr. ? Großgmain ? Salzburg Stadt Umgebung M +
ferienwohnung-grossgmain.at Ferienwohnung Whirlpoolwanne Ausgestattet Entspannen
... meine Praxisräume u. a. Praxis für Ergotherapie ELISABETH ZÖHRER Salzburgerstrasse Braunau zoereraon
107 Yachtcharter Stelzl Ihr yachtcharter
Mit Stelzl Yachtcharter in der Türkei Griechenland Kroatien sowie Mallorca Italien und ... in Niederalm ? Anif nahe Salzburg. Und damit Sie Ihren Bootsurlaub völlig sorgenfrei genießen empfehlen
stelzl-yachtcharter.at Yachtcharter Stelzl Segeln Segelyachten
108 Tanzbar KaiserRanch KaiserRanch - J&R Absenger OG tanzbar
Tanzbar KaiserRanch in Saltzburg ... Bundesstraße A- Anif-Niederalm Salzburg Reservierungen Mi + Do - Fr
tanzbar-kaiserranch.at Tanzbar Kaiserranch Kaiser Ranch
109 Dr. Barbara Brunner
Niederalm b. Salzburg
... Dr. Barbara Brunner Öffentlichkeitsarbeit Kirchenstraße Niederalm b. Salzburg -(
110 Home dentallabor.knoll GmbH dentallabor zahna

dentallabor-knoll.at Dentallabor Zahnarzt Zahnersatz
111 Fotostudio Birgit Gesierich
Hochzeitsfotografin Fotostudio Birgit Gesierich in NiederalmAnif bei Salzburg Österreich Modern klassisch
112 UCM Verlag B2C Corporate Publishing GmbH verlag
Der UCMVerlag mit Sitz in Anif bei Salzburg steht für innovative Magazine. Unter dem Dach ... Publishing GmbH BB Media GmbH Co KG Salzweg A - Anif-Salzburg + - +
ucm-verlag.at Verlag Mode Lifestyle Fashion Fachmagazin Magazin Anif Salzburg
113 Gerl Autoschaden Grödig Gerl GmbH Grödig
Firma Gerl Grödig Ihre Werkstatt zwischen Salzburg und Hallein nähe Berchtesgaden KFZ Lackiererei ... Sie gerne! Gerl GmbH Gartenauer a A- Grödig Diese -Adresse
unfallreparatur.at Grödig Salzburg Hallein Berchtesgaden
114 Willkommen im Schlaraffenland! SCHLARAFFENLAND GmbH
Willkommen im Schlaraffenland!
115 Home Körper
KoerperKult my body my Time
koerper-kult.at Körper Kult Miha Bodytec Powerplate
116 Hotels im Salzburger Land
Verbringen Sie Ihren Urlaub im Salzburger Land. Auf dieser Plattform werden zahlreiche Hotels im Salzburger
117 Peter kerschhofer | petigrafix.at

118 Hotel "DER HECHL" GASTROdat® Ges.m.b.H. Hotel
Das Hotel
hotel-hechl.at Hotel Hechl Tauplitz Skigebiet
119 GasthausFassl

120 Gerl Autoschaden Grödig Gerl GmbH Grödig
Firma Gerl Grödig Ihre Werkstatt zwischen Salzburg und Hallein nähe Berchtesgaden KFZ Lackiererei ... Sie gerne! Gerl GmbH Gartenauer a A- Grödig Diese -Adresse
pannendienst.at Grödig Salzburg Hallein Berchtesgaden
121 OSCG | Offshore Segelclub segel
Grödig - Salzburg
Willkommen beim OSCG dem Offshore Segelclub in Grödig bei Salzburg
oscg.at Segel Segeln Oscg Osc
122 Home: GuS Hausbetreuung

123 Invest ConceptManagement GmbH | its
Grödig - Salzburg
...its time to exchange...
roehrl.ic-m.at Its Time Exchange
124 Ideenpark

125 Kinder Spiel JUPIDU GmbH

126 Jujutsu Hebi /home.php

127 Journalist Translator Interpreter Elizabeth translation
Grödig bei Salzburg
Elizabeth Mortimer?austriabased translator and journalist offers professional language services english/german translations audioguides for
mortimer.at Translation Translations English German Journalism
128 Mybodycoach Mag. Sonja Fitness

mybodycoach.at Fitness Salzburg Personal Coaching Training
129 NEWS von MEV Neuigkeiten
NEUE Produkte von MEV ... ! Sonderpreis auf Anfrage!!!! Link To Detail Page ? Franz Hagenauer Oberfeldstraße A- Grödig Mail office
landmaschinenersatzteile.at Neuigkeiten MEV Neue Produkte
130 Gerl Autoschaden Grödig Gerl GmbH Grödig
Firma Gerl Grödig Ihre Werkstatt zwischen Salzburg und Hallein nähe Berchtesgaden KFZ Lackiererei ... Sie gerne! Gerl GmbH Gartenauer a A- Grödig Diese -Adresse
leihwagen.at Grödig Salzburg Hallein Berchtesgaden
131 Loxbox: Inside

132 Phönix Laboratorium GmbH Spagyra GmbH&Co KG phoenix
Phönix Laboratorium GmbH biologische Arzneimittel seit 1925. Spagyrische und homöopathische Produkte in Österreich
phoenix-lab.at Phoenix Laboratorium Arzneimittel Pharma
... im Gasthof - die Pflegerbrücke GASTHOF DIE PLEGERBRÜCKE IMPRESSUM Fam. Kohlstätter Pflegerstraße A-
134 Betreuung mit Herz Altenpflege
24 Stunden Betreuung für die eigenen vier Wände ... Text version Herzlich willkommen... ...bei www.Seniorenbetreuung.at -Stunden-Betreuung nach Maß
seniorenbetreuung24.at Altenpflege Seniorenbetreuung Häusliche Altenpflege 24
135 SMKKRAN SMK Vermietungs GMBH www.smkkran.at
SMK KRAN Vermietungs GMBH ... Copyright SMK-KRAN SMK Vermietungs GMBH Adresse A - Grödig Gewerbestrasse
smk-kran.at Www.smkkran.at Smk Kran Baumaschine
136 Huemer Onlineshop für PKW
... -Adresse Passwort Passwort vergessen? Kontakt HUEMER Ersatzteilshop Gewerbestrasse
137 Home bhb
bhb ... für Ihre Hilfe und Unterstützung! Unsere Bankdaten Raiffeisenbank Grödig Bauern helfen Bauern IBAN AT
bhb-sbg.at Bhb
138 Mybodycoach Mag. Sonja Fitness

aerobicinfo.at Fitness Salzburg Personal Coaching Training
139 Realtime.at Domain Services realtime.at Domain Services GmbH catch
We catch or snap your expired domain domain ... deleted .at domain names deleted domain names ... in the current auction list. Copyright
realtime.at Catch Doman Snap Domain Snap
140 Zauchensee Liftgesellschaft und Ski
Zauchensee Liftgesellschaft Veronika Scheffer Zauchensee in Verbund mit Ski Amade Altenmarkt Salzburger Land Alkohol am ... Peter Url geboren am .. Grödig Göllstraße vertreten durch Dr. Clemens Thiele
141 Die Psychotherapeutische Praxis Salzburg

143 :: EHC SALZBURGSUED eishockey
Ehc SalzburgSüd
ehc-salzburgsued.at Eishockey Ehc Salzburgsüd Volksgarten Klausner
144 Freiwillige Feuerwehr Grödig Freiwillige
Informationsportal rund um das Feuerwehrwesen in Grödig. ... Kontakt Erreichbarkeit Adresse Freiwillige Feuerwehr Grödig Gartenauerstraße A- Grödig
feuerwehr-groedig.at Freiwillige Feuerwehr Grödig FF Grödig Brand
145 Löschzug FürstenbrunnGlanegg Freiwillige
Informationsportal rund um das Feuerwehrwesen in Fürstenbrunn/Glanegg. ... Kontakt Erreichbarkeit Adresse LZ Fürstenbrunn-Glanegg Fürstenbrunnerstraße A- Grödig
ff-fuerstenbrunn.at Freiwillige Feuerwehr Fürstenbrunn/Glanegg FF Fürstenbrunn Brand
146 Fotograf mathias mandl actionfotos
Fotos von Fotograf Mathias Mandl Actionfotos Landschaften Sportbilder Fotograf in Salzburg
147 Gerl Autoschaden Grödig Gerl GmbH karosserie
25 Jahre Erfahrung haben uns zu einem Musterbetrieb im Raum Salzburg Hallein Grödig und ... Gerl GmbH Gartenauer a A- Grödig infogerl Partnerbetriebe Gerl Autoschaden Grödig
gerl.at Karosserie Center Süden Salzburgs Jahre Erfahrung Musterbetrieb Raum
148 Herzlich Willkommen! | GmachlCoaching herzlich
Dipl. Lebensund Sozialberaterin EMMTECH Tutorin Anwenderin Trainerin Coach Organisationsberaterin Ich glaube an Dich
gmachl-coaching.at Herzlich Willkommen Dipl Lebens Sozialberaterin Emm Tech Tutorin
149 Ing. Müller Kabelfernsehen Kabelfernsehen
Ing. Müller Kabelfernsehen Internet Elektro in Grödig ... Uhr und nach tel. Vereinbarung Kontakt Firma Ing. Herwig Müller Eichetstraße a A- Grödig Tel+
redzac-mueller.at Kabelfernsehen Internet Elektro Grödig
150 Schwab Reisen Schwab Reisen GmbH
... Herrenslalom Schwab Reisen Jahresprogramm Schwab KEG . Gangsteig . A- Grödig . -
151 Wiebecke GmbH in Grödig abgehängten

wiebecke.at Abgehängten Zwischendecken Wiebecke Salzburg Grödig Decken Systemdecken Akustikd
152 Babsi Winzer wibagrafix
... wibagrafix Barbara Winzer Marktstraße Grödig officewibagrafix +
153 HAMOTEK Montagetechnik HAMOTEK Montagetechnik GmbH Hassler
hamotek montagetechnik ein neuer Name mit vertrauten Werten
hamotek.at Hassler Oliver Hassler Hamotek United
154 Untersberg Apotheke | Ihre UNTERSBERG-APOTHEKE Schiebel KG
... Apotheke. Untersberg-Apotheke Mag. Karin Schiebel Marktstraße Grödig +
155 Businesscenter Grödig bcG Businesscenter
Das Businesscenter Grödig vermietet hochwertige Büros. ... lifestyle seminarraeume ueber wasserschutzgebiet werden businesscenter grödig ? Friedensstrasse ? A-
buero-vermietung-salzburg.at Businesscenter Grödig Vermietung
156 Mission Statement | B.A.U.M. mission
Grödig - Salzburg
Sustainable Development B.A.U.M. das Austrian Network for Sustainable Leadership und seine Mitglieder und
baumaustria.at Mission Statement Sustainable Development Austrian Network Leadership Mitglieder
157 Willkommen bei GE Art Kunstfels
... verstärkten Kunststoffen! Kontakt TEL +.. infoge-design Anschrift Buchbichl Grödig
ge-design.at Kunstfels Kunstfelsen GFK Glasfaser
158 Löschzug FürstenbrunnGlanegg Freiwillige
Informationsportal rund um das Feuerwehrwesen in Fürstenbrunn/Glanegg. ... Kontakt Erreichbarkeit Adresse LZ Fürstenbrunn-Glanegg Fürstenbrunnerstraße A- Grödig
feuerwehr-fuerstenbrunn.at Freiwillige Feuerwehr Fürstenbrunn/Glanegg FF Fürstenbrunn Brand
159 Weratech Software GmbH weratech GmbH newsroom
Weratech entwickelt Software Lösungen im Bereich Tourismus und Social Media ... Büro Geschäftsstelle Friedensstraße A- Grödig TEL + FAX + -
wohnbau-news.at Newsroom Weratech Socialmedia Social
160 Gerl Autoschaden Grödig Gerl GmbH Grödig
Firma Gerl Grödig Ihre Werkstatt zwischen Salzburg und Hallein nähe Berchtesgaden KFZ Lackiererei ... Sie gerne! Gerl GmbH Gartenauer a A- Grödig Diese -Adresse
lackiererei.at Grödig Salzburg Hallein Berchtesgaden
161 Kirchgasser Furniere Grödig KIRCHGASSER Furniere GmbH
Furniere Dünn geschnittenes Edelholz in bester Qualität für Ihre Möbel oder Musikinstrumente. Exklusiv aus ... . Erleben Sie Kostbarkeiten zum Anfassen! Kontakt Kirchgasser Furniere GmbH Neue-Heimat-
162 Mybodycoach Mag. Sonja Fitness

kinesis.at Fitness Salzburg Personal Coaching Training
163 Wir sind Ihr Ifor

164 Megabusiness
165 Michael Sieberer Mein Zinsen
Die Geschäftspraktiken einer Salzburger Bank ließen den Lebenstraum der Familie des Fleischhauers Michael Sieberer aus
mein-verlorenes-vertrauen.at Zinsen Liegenschaft Ruin Buch
166 Energethikerin Rositta Dolliner
Rositta Dolliner ist eine Energethikerin mit Herz. Rositta Dolliner arbeitet neben mit Engelenergie PranaVita ... da sie die Energiearbeit dankbar annehmen. Rositta Dolliner · Glanegger · Grödig +
167 Paxnatura Naturbestattung in paxnatura Naturbestattungs GmbH
paxnatura bietet eine würdevolle Alternative zum Friedhof. paxnatura informiert über Naturbestattungen in Österreich: Alle Infos ... A- Grödig Presse Kontakt Sitemap Facebook
168 ShowArts Lausenhammer Rene e.U. ShowArts Lausenhammer Rene e.U. Eventgestaltung
ShowArts Lausenhammer Rene e.U. Grödig ... .? Hier finden Sie uns ShowArts Lausenhammer Rene e.U. Oberfeldstraße Grödig Kontakt Rufen Sie einfach
showarts.at Eventgestaltung Event Veranstalter Party
169 MOR Photodesign photography
Architektur und Landschaft Privat und Businessportraits Fotografin und Photodesign Salzburg
orsinirosenberg.at Photography Marie OrsiniRosenberg Fotografin Photodesign
170 Home Original-Gletscherschliff e.U.

171 Mybodycoach Mag. Sonja Fitness

personaltrainingstudio.at Fitness Salzburg Personal Coaching Training
172 Weratech Software GmbH weratech GmbH newsroom
Weratech entwickelt Software Lösungen im Bereich Tourismus und Social Media ... Büro Geschäftsstelle Friedensstraße A- Grödig TEL + FAX + -
headline.co.at Newsroom Weratech Socialmedia Social
173 Hotel Der Königsleitner GASTROdat® Ges.m.b.H. königsleiten
Neues 4 Sterne Hotel Der Königsleitner und Ferienwohnungen Astn Hütten in Königsleiten. Die perfekte Unterkunft
koenigsleiten.at Königsleiten Nebelfrei Pollenfrei Kitzbüheler Alpen
174 NEWS von MEV Neuigkeiten
NEUE Produkte von MEV ... ! Sonderpreis auf Anfrage!!!! Link To Detail Page ? Franz Hagenauer Oberfeldstraße A- Grödig Mail office
mev.co.at Neuigkeiten MEV Neue Produkte
175 SpotOn Marketing GmbH SpotOn Marketing GmbH spoton
Grödig bei Salzburg
Makes you move! ... . Herausgeber SpotOn Marketing GmbH Friedensstraße Grödig bei Salzburg Österreich GESCHÄFTSFÜHRER
spoton-management.at Spoton Motorsport Dtm Susie Wolff
176 Kirchgasser Furniere Grödig KIRCHGASSER Furniere GmbH
Furniere Dünn geschnittenes Edelholz in bester Qualität für Ihre Möbel oder Musikinstrumente. Exklusiv aus ... . Erleben Sie Kostbarkeiten zum Anfassen! Kontakt Kirchgasser Furniere GmbH Neue-Heimat-
177 Weratech Software GmbH weratech GmbH newsroom
Weratech entwickelt Software Lösungen im Bereich Tourismus und Social Media ... Büro Geschäftsstelle Friedensstraße A- Grödig TEL + FAX + -
headline.or.at Newsroom Weratech Socialmedia Social
178 Werbegrafik Mühlbacher
... . Für ein unverbindliches Gespräch stehen wir Ihnen gerne zur Verfügung. Top Gewerbestraße Grödig
179 Trennungsagentur.at Powerd by trennungsagentur
Warum auch immer Sie sich trennen möchten wir helfen Ihnen dabei! Wir machen aus
trennungs-agentur.at Trennungsagentur Glückliche Unglücklichen Singles
180 Wittronik GmbH Home Wittronik GmbH Wittronik
Startseite ... ) Dokumente Broschüre Wittronik GmbH Hauptstrasse Grödig Austria + - +
wittronik.at Wittronik GmbH Startseite Home
181 OutdoorDesign Pflaster | outdoordesign.at
outdoordesign.at Pflaster | Naturstein | Garten | Grödig bei Salzburg ... - Pflaster Naturstein Garten Franz Peyerl Grödig Inhaber Reinhold Hinterberger
outdoor-design.at Outdoordesign.at Pflaster | Naturstein | Garten
182 Nuun
... Prötschhofstraße b Grödig Salzburg Telefon + infonuun www.nuun
183 Manufaktur2 für Werbung
Grödig bei Salzburg
Die Werbeagentur Salzburg Manufaktur2 eine Fullservice Agentur mit Standort in Grödig Salzburg ... Manufaktur² für Werbung und Design Neue Heimat . Grödig + officemanufaktur.at
184 Hobbyfotograf Markus Jäckel Hobbyfotograf
Grödig bei Salzburg
Portfolio von Salzburgs Hobbyfotografen Markus Jäckel. Feinste Fotografie in den Bereichen Akt Teilakt
mj-photography.at Hobbyfotograf Fotograf Markus Jäckel
185 Jagdwissen.at Jagdwissen

jagdwissen.at Jagdwissen Jagd ELearning Prüfung
186 Sat+kabel müller satanlagen
Ihr Spezialist für SATAnlagen KabelTV und Internet in Grödig und Umgebung ? Salzburg ... im Kabelnetz Previous Next Telefon + . kontaktsat-kabel-mueller Eichetstraße a Grödig
sat-kabel-mueller.at Satanlagen Satelliten Anlagen Kabeltv Kabelfernsehen
187 SUB Unternehmensberatung Sulzbacher Unternehmensberatung GmbH
... Unternehmen Leistungen Kunden Partner Sulzbacher Unternehmensberatung GmbH Göllstrasse C
188 Ferienhaus ?Haus Salzburg? Ferienwohnung
Glanegg bei Salzburg
Das Ferienhaus "Haus Salzburg" ist der perfekte Platz für Ihren Urlaub mit der ganzen ... ! Hier finden Sie uns Ferienhaus "Haus Salzburg" Jagerbauernweg Glanegg bei Salzburg Kontakt Rufen
ferienhaus-haussalzburg.at Ferienwohnung Salzburg Ferien Österreich Glanegg Urlaub
189 NEWS von MEV Neuigkeiten
NEUE Produkte von MEV ... Aktuelle Angebote ? Franz Hagenauer Oberfeldstraße A- Grödig Mail officemev.co
landmaschinen.co.at Neuigkeiten MEV Neue Produkte
190 VollSOLAR Ingenieurbüro vollSOLAR GmbH


Ergebnisse der Bewertungen für die Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Anif:
129 Bewertungen ergeben 3 StadtBranche Punkte

Salzburg ▪ 5081

Anif ist eine österreichische Gemeinde im Bundesland Salzburg mit 4085 Einwohnern . Ortsteile der Gemeinde sind Anif, Neu-Anif und Niederalm.

Grödig5082, 5083
Sankt Leonhard5083
Taxach5083, 5400
Anif Stadtplan Salzburg