optional Stadt:
Österreich ›

Ihr Ausrüster Für Segelboote › Versandkosten Bad Ischl

Ihr Ausrüster für Segelboote Motorboote Schlauchboote und Yachten.

Ihr Ausrüster für Ihr Ausrüster für Öffnungszeiten Versandkosten

Ihr Ausrüster für Segelboote Motorboote Schlauchboote und Yachten.

Ihr Ausrüster für Segelboote  Motorboote  Schlauchboote und Yachten.  Öffnungszeit
Versandkosten Eur Inkl
Online Shop für Bootszubehör wie Bekleidung Navigation und Sicherheit an Bord. Bei uns können Sie Bootsteile im Internet Shop bestellen und persönlich im Lager abholen. Unser bootsshop in Bad Ischl hat viele Wassersportartikel auf Lager.

Kostenlos: Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:


Öffnungszeiten

Öffnungszeiten für Ihr Ausrüster für:
keine Angabe
Stand

Erfahrungen

StadtBranche.at Ihr marine-business.at Wertung vom 2018-01-15:
4 StadtBranche.at Punkte
(Anzahl Besucher)
http://stadtbranche.at/erfahrung-marine-business.at.png http://stadtbranche.at/erfahrung/http_www.marine-business.at.jpg

Ihr Eur Inkl

Webseite
Name
Ihr Ausrüster für Segelboote Motorboote Schlauchboote und Yachten.
Postleitzahl4820  
OrtBad Ischl  
UmkreisBad Ischl  
BrancheVersandkosten in Bad Ischl
RegionOberösterreich  
Telefon  

Kostenlos: Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:



Ihr Ausrüster für Segelboote Erfahrungen Mwst

› Beitrag oder Bewertung schreiben
Versandkosten Eur Inkl Mwst Liros Bord E Mail Warenkorb Bootszubehör Onlineshop Ihr Viadana Unter Passwort Gummischnur Suche Facebook Kundengruppe Sicherheit Adresse Navigation Startseite Lager Shop Shopsoftware Ecommerce Template Online License Public General Gnu Nirokrampen Modified Nautic Expertsat Magic D Bekleidung Kunststoff Pro Gleitlagerrolle Bootsteile Internet Bestseller Anmeldung Newsletter Vergessen

Beste Einträge zu Versandkosten sowie Eur und Inkl

1 Paketdienste Österreich Paketversand: Pakete Quehenberger Logistics GmbH Paketdienste
5204
Strasswalchen
Paketdienste Österreich Paketversand: Pakete Versand senden versenden verschicken schicken. Transportkosten Versandkosten Tarifrechner Paketservice ... Pakete Versand Transportkosten Versandkosten Tarifrechner Paketservice Kleintransporte Transportservice
logandeasy.at Paketdienste Paketversand Österreich Pakete
2 Bioethanol für EthanolKamine direkt Bioethanol

Hochwertiges Bio Ethanol für Feuerstellen und Ethanol Kamine zu unschlagbaren Preisen direkt vom Hersteller. Einfach ... . Entscheidungshilfe Liter Bioethanol .% % Kanister EUR ( inkl. % MwSt. inkl. Versandkosten
mybioethanol.at Bioethanol Bio Ethanol Bioethanol Versand
3 MassAnzugOnline.at: Der perfekt passende Massanzug Herrenbekleidung
8021
Zürich
MassAnzugOnline.at: Der perfekt passende Massanzug ganz bequem per Internet ab EUR 194. oder wir kommen ... oder Wollgemisch Karos dominierten schon die letzten Saisons... Neu! Wintermantel nach Mass
massanzug-online.at Herrenbekleidung Hosenanzüge Massanzug Massanzüge
4 Pfeffer Salz und

Safran von Azafran Geld sparen durch Großpackungen ? Top Qualität ? Unverfälscht ? Viele ... Mineralen Ab EUR Gramm Mehr Infos Safran-Fäden Premium Safranfäden Qualität I Ab
azafran.at
5 Naturbabyshop Wenn Sie manduca
2230
Gänserndorf
Von der Manduca Babytrage bis zum Schnuller ausgewählte Produkte für Sie und Ihr Baby ... Steuern Unsere Empfehlungen Gute Nacht Bio Kräuterkissen EUR BecoPotty Topferl EUR Fellhof
naturbabyshop.at Manduca Babytrage Baby Babyshop
6 Servietten + Bastelbedarf Großhandel Servietten
37441
Bad Sachsa
Servietten Wimmel Servietten + Bastelbedarf Großhandel Willkommen in unserem Shop für Händler ... werden Ihnen auch die Versandkosten für das ausgewählte Lieferland angezeigt. Ab EUR Bestellwert liefern wir in Deutschland sogar
servietten-grosshandel.at Servietten Wimmel Shop Servietten Bestellen Stöbern Warenanlieferungen Händler
7 Willkommen in unserem Shop Servietten
37441
Bad Sachsa
Servietten Wimmel Willkommen in unserem Shop für Servietten + Bastelbedarf Bei uns finden ... dort hinein. Im Einkaufskorb werden Ihnen auch die Versandkosten für das ausgewählte Lieferland angezeigt
servietten-wimmel.at Servietten Wimmel Servietten Wenn Bastelbedarf Basteln Tischdekoration Shop
8 PreisvergleichModellbau.de Modelle

PreisvergleichModellbau.de Preis ab EUR Stand vom mit Beschreibung Produktbild ... inkl. der jeweils geltenden gesetzlichen Mehrwertsteuer ggfs. zzgl. Versandkosten. Alle Angaben
preisvergleich-modellbau.at Modelle Modelleisenbahnen Modellbausätze Ferngesteuerte Modelle
9 Darkkingdom.at dein shop Shop

bekleidung steampunks und sonstige ... Kunden Login Neukunde? Kontakt AGB Versandkosten Willkommen Los Es wurden keine Produkte
dark-kingdom.at Shop Bekleidung Steampunk; Gothic Victorian
10 Schulzeug günstig kaufen im und www.myschulzeug.at ist eine Unternehmung der myrucksack UG (haftungsbeschränkt) myschulzeug
09114
Chemnitz
Bei uns kaufst du dein Schulzeug für nur 13 95 ? Versandkosten nach Österreich. Dein ... Anmelden Dein Warenkorb enthält Artikel EUR ganz aktuell im Shop Preis-Suche ? bis ? Preis suchen
myschulzeug.at Myschulzeug Schulzeug Mypen Zirkel Etui Handy Portemonai Geld
11 Mode Schmuck Shop ist mode

Bei uns im Mode Schmuck Shop finden sie günstigen Schmuck wie Edelstahl Goldschmuck Silberschmuck Perlenschmuck ... Kategorien Geschenke Schmuck Schmuckpflege Uhren Mehr über... Liefer- und Versandkosten Privatsphäre
mode-schmuck-shop.at Mode Schmuck Shop Modeschmuckshop Uhren Modeschmuckshop.at
12 KressShop.at Commerce

... Bohrmaschinen Bohrschrauber Preisoptionen Sonstiges Informationen Liefer- und Versandkosten Privatsphäre
kress-shop.at Commerce VEYTON Warenkorb Artikel Datenschutz Enterprise Impressum Informationen
13 Homepage Demmers Teehaus Tee

Online über 300 Qualitätstees für jeden Anspruch einfach und sicher ohne Versandkosten bestellen! Demmers ... Deutsch Deutsch English Über Teesorten Versandkostenfrei ab EUR Demmer's Teehaus Newsletter
tee.at Tee Demmer Teehaus

Häufige Versandkosten Suchbegriffe Eur

Unser Bad Ischl Zurück! Willkommen Leer Verfügung Web Kunststoffschäkel Stopperkugel Businessmarine Marine Britestudersunwaretbstecnosealteleflextessilmarethetfordtorqeedotremturboswingultraflexviadanawaecowatersnakewebastowildschekwinddexwindesignyachticonyeahykkzenith Marinestar Sikaflexsilvasioenskywatchsostechnicspeedwatchstamoid Powersikasika Gläserrobshiprulesailguardsattlerscrubbisseajetseasailseastarsecumarseiwashipshadeside Guardprotectorprympsppyropolrauscherrecytexriedel Marinephilippiphocosprop Timeoptipartsorigooverboardperkopfeiffer Nxoceanledoptimum Nxnexus Funnelnautichargernavisafenavishellnavylinenawanewportnexus Powermehlermoonlightmr Pacifiiroxisottajabscokonuslalizasliroslofransloxxmagmamarcomarine Xtcmodified Hermsprengehydroslideinstatrimironwood Allenhondahonwavehövelinghs Lloydhighfieldholt MarinebravobungycansbclamcleatcoelancondorcremessodandatacoleasyechomaxelvstrÖmengelfariaformafortressfujinonfusiongarmingelertgisatexgolightgotopguardianhavecohella Domain Gloveboss Wavebody Wählenacapellaairmenbeansanchorwincharcorocarmascherlbarigobaystarbedflexblue Bitte Hersteller Webdesign Color Webhost Federklemme Marinehenri Öffnungszeiten Ihnen Bojen Elektrik Beleuchtung Exquisit Living Falträderfunsportbootezubehör Fender Profile Sail Kochen Heizen Kühlen Essen Lacke Harze Pflegemittel Hardware Deck Pumpen Airmenbeans Mein Konto Neukunde Kasse Anmelden Kategorien Ankern

Ihr Ausrüster Öffnungszeit Inkl Mwst

Ihr Ausrüster für Segelboote Die Ihr Ausrüster für Segelboote Motorboote Schlauchboote und Yachten. Öffnungszeiten Bad Ischl können zu Feiertagen wie Karneval, Valentinstag, Ostern (Karfreitag Ostersonntag Ostermontag), Tag der Arbeit und Himmelfahrt abweichen. Wir empfehlen, sich vorher zu informieren, ob es sich um ein lokales Versandkosten Bad Ischl Geschäft handelt. Bei Änderungswünschen zu Erfahrungen und Eur Test Bewertung und Erfahrungsbericht von Ihr Ausrüster für Segelboote Motorboote Schlauchboote und Yachten. Bad Ischl senden Sie uns eine E-Mail. b

Marine-business.at Schlagworte Liros Bord

Pads Belegen Beschläge Schrauben Bootsmotoren Zubehör Cremesso Kapselmaschine Lüfter Sanitär Fragen Anker Snackschalen Set Internetshop Art Ob Schwimmweste Leine Neue Abholen Besuchen Wwwbootsshopat Von Mo So Uhr Artikel » Maritime über Geschenksideen Bootselektronik Planenstoffeverkleidungtapes Segelkleidung Accessoires Tauwerk Drahtseile News Erweiterte Agb Bezahlung Versand Datenschutz Widerrufsrecht Impressum Kontakt Wassersportartikel