optional Stadt:
Österreich › Ort ›

Hall › Steiermark › Schweiz › 8911 Erfahrungen

Branchenbuch Hall

8911 Steiermark

Kostenlos: Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:




1 Bücheler Werbegeschenke AG Werbeartikel ch
8912
Obfelden
Bücheler AG - Der Werbeartikel-Spezialist mit Werbeartikeln aller Art Streuartikel, edle Werbepräsente, Kundengeschenke, Give aways, Werbeartikel für Messen und Ausstellungen Ihre...
buecheler.ch Werbeartikel Bücheler Profi Werbegeschenke Etui Streuartikel Give Farben Kunststoff Sonnenbrille Flop Trinkflasche Tasse Wwwpromotrendsch Werbeartikelprofi Kundengeschenk Ipad Hülle Werbe
2 Loogo Umzüge Österreich Umzüge at
5400
Hallein
Mit LOOGO sparen Sie Zeit und Nerven. Überlassen Sie Ihren Umzug den Profis von LOOGO! Profitieren Sie von unserer Organisation und...
loogo.at Umzug Möbel Kartons Möbelküche * + Umzugsunternehmen Privatumzug Angebot Firmenumzug Verpackungsmaterial * Umzüge Loogo Kartons * Lkw * Internationaler Neumöbel Abholung Karton Rechner Demokratischevolksrepublikkorearepublikkroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmauretanienmauritiusmazedonienmexikomikronesienmoldawienmonacomongoleimontenegromosambikmyanmarnamibianaurunepalneuseelandnicaraguaniederlandenigernigerianiuenorwegenösterreichomanosttimorpakistanpalästinensischeautonomiegebie
3 Tourismusverband Region Hall-Wattens Tourismusverband at
6060
Hall in Tirol
Verbringen Sie Ihren Urlaub in Tirol in Österreich und genießen Sie zahlreiche Aktivitäten auf den Bergen, in der Natur und...
hall-wattens.at/ Hall Region Swarovski Haller Winter Urlaub Geschichte Tirol Wattens Sommer Unterkünfte Wandern Essen Nordic Sehenswürdigkeiten Incentive Angebote Kulinarik Sport Events Filmteams Klumperspaß Wellness
4 Piercingkurs.ch | Der Nr. Piercing Schule ch
8910
Affoltern a.A
Piercingkurs.ch | Unsere Wochenendseminare vermitteln Dir alle nötigen Kenntnisse, um erfolgreich den Einstieg in die Welt des Piercings zu schaffen....
piercingkurs.ch Piercing Piercingkursch Workshop Kurs – Einsteiger Nr Dir Piercens Daten äusserst Praktikumsplätze Vorkenntnisse Schweiz Begehrten Y

Kostenlos: Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:




5 professionelle Katzen&Hundepflege Steyr-Land Hundesalon at
4540
Bad Hall
Wir sind ein Familienunternehmen seit 1998 und bieten professionelle Katzen & Hundepflege an. Ob nach dem FCI Standard oder ganz nach...
profihundesalon.at Hundesalon Hall Ausbildung Hundesalonhuemer@gmxat Hundepflege Steyr Friends Kommt Huemer Leistungen Preise Hundefriseur Doch Shop Fotos Beiunseren Viel
6 Fachhochschule FH Salzburg Fachhochschule at
5412
Puch/Hallein
Die Fachhochschule Salzburg bietet ein fundiertes FH Bachelor und Master Studium in den Studiengängen Informationstechnik, Multimediatechnology, Bildverarbeitung, Gesundheits- und Krankenpflege...
fh-salzburg.ac.at/ Salzburg Fh Management Smart Multimediaart Design Bewerbung Innovation Betriebswirtschaft Hebammen Master Fachhochschule Multimediatechnology Slider Partner System Kmu Gf Social Profit Sektor
7 Adless Mediendesign e.U. Webdesign at
5400
Hallein
wir gestalten Medien - Web, Grafik & Druck...
adless.at Navigation Offsetdruck überspringen Webdesign Relaunch Augenhöhe Werbeagentur Grafik + Grafikdesign Angebot Web Uns Rufen Beratung
8 IfM – Institut für Ausbildungsinstitute at
5300
Hallwang
Berufsbegleitend studieren und lebenslang von Management-Kompetenzen profitieren: Das IfM – Institut für Management mit Sitz in Salzburg bietet als renommierte...
ifm.ac/ Management Ifm Programm Finanzierung Mba Veranstaltungsort Inhouse Bachelor Consulting Kosten Fakten Vorteile Salzburg Institut Bildung Kompetenzen Kurse Bildungsangebote Portfolio Berufsbegleitend
9 Tourismusverband Region Hall-Wattens Tourismus at
6060
Hall in Tirol
Verbringen Sie Ihren Urlaub in Tirol in Österreich und genießen Sie zahlreiche Aktivitäten auf den Bergen, in der Natur und...
hall-wattens.at/ Hall Region Tirol Swarovski Sommer Geschichte Urlaub Haller Wandern Unterkünfte Wattens Nordic Museum Wallfahrten Kristallwelten Sport Events Walking Incentive Angebote Veranstaltungsräume Laufen
10 Beziehungsberatung & Paarberatung Beziehungsberatung Paarberatung ch
8910
Affoltern a. A.
Beziehungsberatung & Paarberatung für Partnerschaft und Beziehung. Coaching für Frauen und Männer | Erwin Schmäh, Affoltern am Albis, Zürich...
erwinschmaeh.ch Beziehung Lebensaufstellungen Frauen Schmäh Mich | Partnerschaft Männer Seminar Erwin Beziehungsberatung Paarberatung Artikel Albis Erwachsen Eigenständig Thesen
11 Loogo Umzug Umzug Umzüge at
5400
Hallein
Jeder Umzug wird von uns mit höchster Priorität und Wichtigkeit behandelt und mit Freundlichkeit, Professionalität und vor allem kundenorientiert zum...
loogo.at Salzburg Umzug Umzugs Loogo Lagerung Mail Kontaktieren Eu Transport Kalkulator Firmenumzug Besichtigungstermin Kunden Kostenlosen Storage Self Entrümpelung
12 Hundesalon Huemer Hundesalon at
4540
Bad Hall
Ihr Vierbeiner kommt in erfahrene, geduldige Hände und wird individuell nach Ihren Vorstellungen oder nach dem FCI Standard geschnitten und...
profihundesalon.at Hundesalon Folgen Gepflegt Friends Hundepflege Hände Scheren Unterwolle Schneiden Beim Webnode Bringservice Neueröffnung Baden Preis Standard Schere Handtrimmen Border Gewinnspielenmitzumachen
13 Naturheilpraxis Heilpraktiker at
83435
Bad Reichenhall
Praxis für Naturheilkunde, Heilpraktiker, Chiropraktik, Akupunktur, Thymus-THX, Schmerztherapie, LWS, BWS, Migraine, Rückenschmerzen, Allergie, Stoffwechsel...
pantenburg.org Schule Leverkusende Wwwheilpraktikery
14 Gold Nagel Nails Nagelstudio ch
8916
Jonen
Neueröffnung! 12 Jahre Erfahrung! Fingernägel professionell und preiswert! Traumnägel voller Liebe und Eleganz. Ihre Hände sind Ihre Visitenkarte. Ich verhelfe Ihnen...
goldnagel.ch Foundguru Found Not Meditation Xiderror
15 E-Zigaretten und mehr Fachhandel ch
8912
Obfelden
Das Thema E-Zigarette bleibt weiterhin brisant und die Meinungen driften immer noch auseinander. Leider auch schon seit längerem gibt es...
happy-smoke.ch Lager Warenkorb Vapelounge Zubehör Liquids Reinigung Mods Five Drip Pawns Tips Ersatzteile Batterien Akkuträger Zigaretten Happy Smoke Liquid Suicide Pioneeryou
16 handyshop-badhall.at - Handyreparatur Bad Handyshop at
4540
Bad Hall
Mit der Firma handyshop-badhall.at kann man sein Smartphone wieder so gut wie neu hinbringen und muss nicht viel Geld dafür...
handyshop-badhall.at Hall Handyshop Handy Reparatur Ankauf Entsperren Badhall Kunden Handyreparatur Qualität Dienstleistungen Verkäufer Handybörse Unser |
17 bobber 125 ccm Motorrad at
5412
Puch bei Hallein
Der kleine Räuber mit 125 ccm, für alle, mit FS-A und für FS-B Besitzer, mit Code 111 , bei...
ms-bikes.at Bikes Wwwmotorradat Msy
18 EMCO Werkzeugmaschinen Drehmaschinen Fräsmaschinen Fräsen at
5400
Hallein
EMCO ist ein weltweit führender Werkzeugmaschinen Hersteller von Drehmaschinen und Fräsmaschinen. Der Erzeuger arbeitet nach modernsten und internationalen Standards und...
emco-world.com/ Emco Cnc [] Ausbildung News Fräsmaschinen Industrie Produkte Drehmaschinen Erzeuger Drehen Kundenservice Kundendienst Unternehmen Consulting Ersatzteile Schulungen Leistungsfähige Gebrauchtmaschinen
19 BOLLIPOO TOYPUDEL Züchter ch
8915
Hausen am Albis
Wir verfügen über viele Jahre Erfahrung in Zucht; Genetik und Ausstellungen und planen ganz bewusst eine Fremdrasseneinkreuzung; weil sich Welpen...
bollipoo-hybridzucht.ch Bollipoo Wwwbollipoo Hybridzuchtch Anzahlspiel Hunde Welpen Besucherinternetseite Spass Superplush
20 REYERlooks Designermoden Onlineshop Onlineshop Mode at
5400
Hallein
Designermode im Fashion Online shop REYERlooks! Die neuesten Trends den richtigen Style und die besten Designer. Designermode ohne Kompromisse! DER...
reyerlooks.com/ Trends Designer Reyerlooks Shop Fashion Mode Kleider Taschen Designermode Urban Mäntel Bags Schuhe Röcke Jacken Passend Winter Shoes Sicher Anrede*
21 Urlaub Hall Wattens Tirol Tourismus at
6060
Hall in Tirol
Verbringen Sie Ihren Urlaub in Tirol in Österreich und genießen Sie zahlreiche Aktivitäten auf den Bergen, in der Natur und...
hall-wattens.at/ Region Hall Haller Swarovski Geschichte Urlaub Wandern Sommer Tirol Wattens Hasegg Burg Events Winter Mils Incentive Angebote Themenführungen Fitness Hund Tradition
22 PC-Reparatur COMPUTER Service at
5400
Hallein
Herzlich Willkommen bei Ihrem CXPC-Service Team für Computer, Büro, Gaming, Multimedia PC´s und Ersatzteile. Wir haben unser Interesse für Computer...
cxpc-service.at Pc Computer Cxpc Finden Radeon System Amd Pc´s Budget Beratung Systeme Mini Technik Erfahrung Reparatur Kontaktformular Nutzen Edv Dienstleistung Ihrem
23 NägeleLogistics Expresstransport Botendienst at
5412
Puch bei Hallein
NägeleLogistics Expresstransport beschäftigt sich mit Termintransporte bzw. europaweiten Direktfahrten und Sonderfahrten. Zu den Kunden gehören Unternehmen aus verschiedensten Branchen. Seit 2014 betreibt...
naegele-logistics.eu Express Expresstransport Nägelelogistics Nägele Naegele Sonderfahrten Transporte Termintransporte Transportanfrage Abteilung Wwwmy Shoptoday Hotline Botendienst Freecall Transport Ihr Ngelekurier Presse Archiv
24 Selbstbewusstsein & Selbstvertrauen | Seminare Familienstellen ch
8910
Affoltern a. A.
Seminare zu Selbstbewusstsein und Selbstvertrauen sowie Angebote Familienaufstellungen und Lebensaufstellungen....
erwinschmaeh.ch Selbstbewusstsein Blockaden Schmäh Gefühl Erwin Leben Selbstvertrauen Angst Erkenne über Coaching Starke Vertraue Freiheit Vergangenheit Tipps Stark Tabus Texte
25 Helga M. Schnattinger Alternativmedizin at
5400
Hallein
Kinesiologie, Tuina, Familienaufstellung sowie Schamanismus und Rückführung bietet Helga Schnattinger in Hallein bei Salzburg - Gesundheitstrainerin und Diplomtherapeutin für traditionelle...
helga-schnattinger.at/ Kinesiologie Tuina Schamanismus Rückführung Helga Schnattinger Familienaufstellung Salzburg Hallein Seminare Sowie Kintao Reinkarnation Homöopathie Familienstellen über Meiner
26 Werbeartikel Werbeartikel ch
8912
Obfelden
Werbeartikel sind dreidimensionale Werbeträger, die Unternehmen zu Werbezwecken an Kunden und Interessenten verschenken. Klassische Werbeartikelreichen von preisgünstigen Streuartikeln und Gimmicks...
buecheler.ch Bücheler Werbeartikel Werbegeschenke Meta Alt+ Portemonnaie Taschenapotheke Feuerzeug Schreibmappe Navigation Hilfe Handy Etui Click Clack Dose Usb Stick Massband Fächer Zeckenkarte Prospekte
27 Portraitfotografie und Hochzeitsfotografie Fotografie ch
8910
Affoltern am Albis
Portraitfotografie Menschen zu fotografieren ist meine ganz grosse Leidenschaft. Emotionen bildlich festzuhalten und mit Menschen zu arbeiten erfüllt mich mit grösster...
fotoartcompany.ch Company Hochzeitsfotograf Fotoart | Portraitfotografie Hochzeitsfotografie Produktfotografie Portraitfotograf Zürich Brautpaar Preise Kontaktformular Email Fotokurse Fotokurs Agb Fineart
28 Schloß - Schlüssel - Schlosserei at
5412
Puch bei Hallein
Der Schlosserei- und Metallbaubetrieb Steinhofer Markus ist bekannt, für hochwertige sowie langlebige Produkte und Dienstleistungen; Die individuellen Wünsche und Bedürfnisse der...
metall-hand-werk.at Steinhofer Schlossermeister Betrieb Salzburg Puch Pongauat Menu Fax Fusszeile Usermetall Internetagentur Login Geschftszeiten Montag
29 Mertl-Kunststoff GmbH Kunststoff und at
5400
Hallein
MERTL Kunststoffe GmbH - Verschiedenste Produkte wie : Thermoplastische Werkstoffe Duroplastische Werkstoffe ICE FLOOR 365 Eislaufen ohne Eis Gleit- und Förderelemente Rammschutzleisten nach Wunsch kompetenter Partner...
mertl-kunststoff.com Kunststoffe Mertl Thermoplaste Icefloor Duroplaste Fertigteile Halbzeuge Plastix Förderelemente Erfahren Gleit Stellenanzeigen Zertifikat Kunststoff Zuschnitte Premium Werkstoffeund Hochleistungskunststoffe Sowie Pe Werkstoffe Unser
30 Sabay Sabay Thai Massage Massage ch
8910
Affoltern am Albis
Neueröffnung: Entspannung pur bei Sabay Sabay Thai Massage & Kosmetik Die traditionelle Thai Massage ist eine Kombination von sanften Akupressuren sowie...
sabay-thaimassage.ch Massage Sabay Thai Reflexzonen Kosmetik Fuss Informationen Schulter Nacken Rücken Kräuterstempel Gesundheit Thailand Kopfmassage Gutschein
31 Frauenarzt Dr. med. P. Frauenarzt ch
8910
Affoltern am Albis
Dr. med. Peter Dörffler ist Facharzt für Frauenheilkunde & Geburtshilfe in Affoltern am Albis. Er bietet sämtliche Gynäkologieleistungen und ist darüber...
frauenarzt-affoltern.ch/ Schwangerschaft Frauenarzt Albis Dörffler Gynäkologe Finden Person Praxis | Uns → Gynäkologische Med Web Formular Endokrinologie Hormonbehandlung Affoltern
32 Joya City Shop Schuhe at
5400
Hallein
weichster Schuh der Welt ideal bei Hallux und Fersensporn schon Rücken und stärkt Muskulatur Gelenkschonend...
joya-cityshop.at Joya Schuhe Shop Gesunde Komfortschuhe City Schöninger Erfolgsgeschichte Gehen Hallein Alois Kellner Schwelle Wegbereiter Cityshopat Wwwjoya Nater Shophallein
33 Medienquartier Werbeagentur at
5400
Hallein
Internetseite, Webseite, Grafiker, Webdesigner, Werbung, Visitenkarte, Plakat, Broschüre, Logo, Briefpapier, Kuverts, Postkarten, Rollups, Fahnen, Beachflag, Marketing, Social Media, Corporate Design...
medienquartier.at Project Salzburg Grafikdesign Webdesign Hallein Werbeagentur | Medienquartier Work Details Contact Print Cafe Genuss Wahre Maria Consulting
34 Lebens-Integrations-Prozess | Familienstellen | Familienstellen & ch
8910
Affoltern am Albis
Familienstellen und Lebens-Integrations-Prozess (LIP). Seminare in Zürich & Schweiz. Aufstellungsleiter Erwin Schmäh. [CH-8910 Affoltern am Albis]...
erwinschmaeh.ch Lebens Integrations Prozess Familienstellen Leben Empfehlungen Wollen Einzelberatung Seminare Schmäh Erwin Angebote Dein Umarme Pin Entwicklungsstufen Menü
35 Naturkosmetik Schönheit Wellness at
6060
Hall in Tirol
Wir führen Naturkosmetik Marken aus ganz Europa, deren Philosophie und Schwerpunkt uns überzeugen. Bevor wir uns für eine neue Marke...
naturkosmetik-tirol.at Line Naturkosmetik Natures Happy Haut Aging Seifen Beauty Tiroler Hauttyp Reine Sauna Gebhardt Accessoires Weihnachten Hände Schlafwohl Einzelöle Luke Active
36 BOLLIPOO-Hybridzucht und TOYPUDEL-Zucht BOLLIPOO-Hybridzucht und ch
8915
Hausen a/A.
Wir verfügen über viele Jahre Erfahrung in Zucht; Genetik und Ausstellungen und planen ganz bewusst eine Fremdrasseneinkreuzung; weil sich Welpen...
bollipoo-hybridzucht.ch Wwwbollipoo Hybridzuchtch Internetseite Hundespiel Anzahl Spass Besucher Bollypoo Welpen Superplush Ueberbollipoo
37 Artistic Institut - Echallens Epilation-Massage ch
1040
Echallens
Toutes les epilations pour dames et messieurs par estheticienne experimentee. Technique speciale et cire LYCON, extra douce, pour une...
artistic-institut.ch Epilation De Institut Artistic Dans Les Vous Hommes See Réussir Cadeau Et Cire Bienvenue Massage Diaporama Devraient Ils Anti Poils Année Mental Pas
38 Laserer Küchenstudio Salzburg at
5400
Hallein
Küchen sind nicht nur Orte, in denen man Essen zubereitet, sie sind in zahlreichen Fällen ebenfalls Begegnungsstätten. Das Abendessen, wird...
laserer.at/de/kuechen-wohnen/kuechen-kuechenplanung/kuechenstudio-salzburg/ Küchen Küchenstudio Wohnen Salzburg Gosau Hallein Laserer Tischlerei Marken Planung Anfahrt Küchenstudios Siematic Maß Traditionell Einbauküchen
39 moser - productagent Handel at
5400
Hallein
Handel mit Werbemittel, Weihnachtsgeschenke, Betriebsaktionen, Produktsuche, Produktvermittlung, Hallein, Salzburg, Österreich, Producthunter,...
productagent.eu Werbegeschenke Werbemittel Werbung Betriebsaktionen Weihnachten Hallein Salzburg Präsente Wien Business Tennengau Kärnten Linz Vorarlberg Flachgau Kundengeschenke Werbemitteloberösterreich
40 S.M.C.M. international Gmbh Inkasso at
8918
Unterlunkhofen
S.M.C.M. International GmbH mit Sitz in der Schweiz, bietet Ihnen vielfältige und umfassende Lösungen im Bereich des nationalen und internationalen...
smcm-international.com International Debt Services Marketing Court Enforcement Sales Management Credit Address Reporting Smcm Representation Tracing National Rappresentanza Accounts
41 Videodreh-Filmproduktion Videoproduktion at
6060
Hall in Tirol
Videoproduktionen und Pressearbeit...
videodreh.at Videodrehat Sportberichte Events Pressearbeit Tirol Imagefilme Hochzeit Musikvideos Videodreh Hochzeitsfilmer Filmproduktion Film Videoproduktionen Imagefilme Halten Partnernum Artworkat Produkt Filmproduction
42 video-hochzeit.at Videoproduktion at
6060
Hall in Tirol
Hochzeitsfilme, Taufen, Firmungen...
video-hochzeit.at Hochzeitsfilm Tirol Partner Videodreh Video Philosophie Leben Hochzeit Team Preise Taufen Verfügung Wunsch Moment Videos Leidenschaft Ich Macht Videodrehat Mail Vereinbaren

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Hall

+ Kommentar oder Kleinanzeige für Hall eintragen!

43 .:STARTSEITE:.Helmuth Matzner helmuthmatzner.at Helmuth
8911
Hall
ES GIBT 1000 KRANKHEITEN ABER NUR EINE GESUNDHEIT (ARTHUR SCHOPENHAUER)
helmuthmatzner.at Helmuth Matzner Gojibeere Wolfsbeere ätherische
44 Unser Heim :: Hauptmenu Betreuungsheim Rottensteiner GmbH
8911
Hall bei Admont
... ist!" und dieses Zuhause wollen wir Ihnen schenken. Unser Heim Wir sind ein Betreuungsheim in Hall
heim-rottensteiner.at
45 Wohnkeramik Taferner GmbH moderne
8911
Hall bei Admont
Peter Taferner ist Ihr Hafnerbetrieb wenn es um Kamine und Öfen aller Art geht ... Peter Taferner - Ihr Hafnermeister und Fliesenleger Hall Hall bei Admont +
taferner-wohnkeramik.at Moderne Kachelöfen Gestaltung Traditionelle Kachelöfen Hafnermeister Admont Hafn
46 Gnacht.ch | Bestellen Sie Karl-H Gmbh Satin
8915
Hausen am Albis
Satin Bettwäsche Fischbacher und Schlossberg Hirsekissen Daunen Duvet Milbenschutz Matratzen Schutzhüllen ... Weisbrod-Areal Hausen a. A. + » Topqualität » Schnell » Preiswert
g-nacht.at Satin Bettwäsche Fischbacher Und Schlossberg Hirsekissen
47 Home page | OnlineVinothek Willkommen
8911
Admont
Österreichs erlesene Weine sind in aller Welt bekannt! Die Vinothek Vineart in Admont bei Liezen
vinothek-vineart.at Willkommen Vinothek Vineart
48 Willkommen auf der Homepage Salz
8911
Admont
Hall ein idyllisch gelegenes Dorf am Fuß der Haller Mauern und zum Tor des Gesäuses ... GoogleNews Low Cost Levitra Gemeinde Hall ...ist einen Besuch wert Startseite Bildergalerie
gemeinde-hall.at Salz Hall Steiermark Admont
49 News
8911
Admont

gymnasium-admont.at
50 Willkommen
8911
Admont

hsadmont.at
51 Baumeister Huber Alexander Alexander
8911
Admont
Alexander Huber Baumeister Hall bei Admont
iplan4you.at Alexander Huber Baumeister Hall Bei Admont
53 Home | PörlSportShop responsive
8911
Admont
Responsive business template for Joomla 3.0 JA Zite. This responsive template is powered by
poerl-sport-shop.at Responsive Joomla Template Responsive Template Joomla
54 Willkommen im Gasthaus zur admont
8911
Admont
Gasthaus zur Ennsbruecke Admont ... und Christoph Pirafelner Hall A- Admont + DW gasthaus
pirafelner.at Admont Essen Gesäuse Xeis
55 |: Alpinschule ALPINSTIL :|: Bergführer
8911
Admont
Alpinschule Alpinstil "So draußen wie möglich" Profibergführer mit Qualitätsgarantie! Professionelle Tourenführung und Ausbildung ... >> Alpinschule Alpinstil Mag. Jürgen Reinmüller Steinfeldsiedlung Admont www.alpinstil + (
alpinstil.at Bergführer Alpinschule Bergsteigerschule Bergsport
56 Stiftskeller Admont
8911
Admont
Stiftskeller Admont im Benediktiner Stift Admont: Restaurant für jeden Anlass Busreisen Hochzeiten ... Informationen Admont Kirchplatz + officestiftskeller-admont Betriebsurlaub
stiftskeller-admont.at
57 |: Alpinschule ALPINSTIL :|: Bergführer
8911
Admont
Alpinschule Alpinstil "So draußen wie möglich" Profibergführer mit Qualitätsgarantie! Professionelle Tourenführung und Ausbildung ... >> Alpinschule Alpinstil Mag. Jürgen Reinmüller Steinfeldsiedlung Admont www.alpinstil + (
alpinklettern.at Bergführer Alpinschule Bergsteigerschule Bergsport
58 Home
8911
Admont

edart.at
59 Willkommen auf der Homepage: ENVESTA Energie- und Dienstleistungs GmbH
8911
Admont
Die ENVESTA Energie und Dienstleistungs GmbH als Tochterunternehmen des Benediktinerstiftes Admont versteht sich mit ihren ... Hauptstraße A- Admont T + - F + - www.envesta officeno
envesta.at
60 Freiwillige Feuerwehr und Rettungsabteilung Freiwillige
8911
Admont
Freiwillige Feuerwehr und Rettungsabteilung Admont
feuerwehr-admont.at Freiwillige Feuerwehr Feuerwehr FF Admont
61 AktivGsund Laktattest
8911
Admont
Durchführen von Laktattest Gehtest Leistungsdiagnostik Feldstufentest HRVMessung sowie Trainingsbegleitung
aktiv-gsund.at Laktattest Training Sport Leistungsdiagnostik
62 Gesäuse Perle Natur Limonade
8911
Admont

gesaeuse-perle.at
63 Glumpad
8911
Admont
glumpad ...nur so... ... wir uns am Radrennen durch Wien. zu den Fotos ? Back to Top Admont Austria+ gott.maurerglumpad
glumpad.at
64 JOHANN REINALTER KG Johann Reinalter KG johann
8911
Admont
Willkommen bei Johann Reinalter KG :: Heizung Sanitär Klima Spenglerei Elektro ... . Heizung Klima Sanitär Elektro und Spenglerei aus einer Hand! Johann Reinalter KG Bachgasse
reinalter.at Johann Reinalter Kg Johann Reinalter
65 Marktgemeinde Admont
8911
Admont
... Chronik Was ist los im Gesäuse Bewegungsarena Admont-Hall-Weng Amtsstunden Montag . bis . Dienstag
admont.at
66 Franz Tschitschko Lederhosenerzeuger Lederhose
8911
Admont
Franz Tschitschko Lederhosenerzeuger aus Admont
die-lederhose.at Lederhose Leder Hose Tracht
67 Klosterladen Weinshop Online Wein
8911
Admont
DveriPax Weinshop dem online Weinhandel des Benediktinerstifts Admont. Erlesene Weine zu AbHofPreisen bequem online
dveripax-austria.at Wein DveriPax Weinshop Online Versand
68 Www.f5d.teamaustria.at Startseite
8911
Admont
F5D Austria Team 2012
f5d-team-austria.at
69 Villa Elisabeth Willkommen Privatzimmer;Zimm
8911
Admont
Villa Elisabeth ist das Hotel in Admont in Österreich in dem Sie von einem ... Elisabeth Kontakt und Reservierung Villa Elisabeth Paradiesstraße Admont Österreich Rufen
villa-elisabeth.at Privatzimmer;Zimmer Admont;Urlaub Admont;Fremdenzimmer;Admont Zimmer Villa Elisa
70 Blumenstube Sabine Sabine
8911
Admont
Die Website von Blumenstube Sabine ist eine Präsentation des Blumen und Floristik Fachgeschäftes von Sabine ... Frühjahr Anfahrt Disclaimer Kontakt Sabine Zechner Willkommen auf meiner Homepage Hall
blumenstube-sabine.at Sabine Zechner Blumenstube Floristik Blumenhandel
71 Freiwillige Feuerwehr HALL Bezirk
8911
Admont - Austria
Freiwillige Feuerwehr Hall bei Admont! Bezirk Liezen Admont Hall Weng Ardning ... ; Admont Steiermark Österreich Copyright Freiwillige Feuerwehr HALL. Alle Rechte
ff-hall.at Bezirk Liezen Admont Hall Weng
72 HomepageTitel Startseite Kosmetik
8911
Admont
HomepageTitel in Admont bietet als Ihr modernes Kosmetikstudio alle Leistungen rund ums Wohlfühlen von ... Verwöhnstudio Alice Steiner Hier finden Sie mich Verwöhnstudio Alice Steiner Hauptstraße Admont Kontakt
kosmetik-admont.at Kosmetik Beauty
73 Supervision Hofer
8911
Admont

supervision-hofer.at
74 Admont Blumen Blumenladen
8911
Admont
Alles über Blumen und dem traditionellen Blumenladen des Stiftes Admont sowie dem Weinverkauf des
admont-blumen.at Blumenladen Stiftsgärtnerei Stift Admont Dveripax
75 Willkommen
8911
Admont
... fahren ab der Schule Richtung Hall Weng und Johnsbach um. Nach Ardning um ab der Schule
nmsadmont.at
76 Unser Kindergarten kindergartenadmont
8911
Admont

kindergarten-admont.at
77 Home Bergholz Admont GmbH Bergholz
8911
Admont
Die Firma Bergholz Admont GmbH ist ein traditionelles Sägewerk und Hobelwerk in Admont. ... Paradiesstraße Admont Austria Anfahrt Bürozeiten Montag - Donnerstag von - Uhr Freitag von
bergholz-admont.at Bergholz Admont Sägewerk Hobelwerk
78 Fellnasenstudio Home Angebot
8911
Admont
Fellnasenstudio Hall ... Sie hier . In unsererTierarztpraxis Dr. Hans Weißensteiner Hall A- Admont werden regelmässig "Erste-Hilfe-Kurse
fellnasenstudio.at Angebot Kompetenz Beratung
79 Home Ferienwonungen
8911
Admont
Startseite Ferienwohnungen Lep Admont Unterkunft Admont ... A- Admont / Diese -Adresse ist vor Spambots geschützt
ferienwohnungen-lep.at Ferienwonungen Lep Admont Zimmer Admont Privatzimmer Lep AdmontUnterkunft
80 Schutzhütte Gesäuse Home grabner
8913
Weng im Gesäuse
Grabneralmhaus 1395m Gesäuse ... zu den erreichbaren Gipfel Unterkunft im bis Bettzimmer und Lager möglich Home Zustiege Buchauer Sattel Hall
grabneralmhaus.at Grabner Alm Grabneralmhaus Gesäuse Schutzhütte
81 Start Nationalpark Gesäuse Nationalpark Gesäuse GmbH
8913
Weng im Gesäuse
... if sufficient participants of these languages. The workshops at the second day will take place
nationalpark-partner.at
82 Junior Ranger Nationalpark Gesäuse GmbH Junior
8913
Weng im Gesäuse
Junior Rangers ... für Jugendliche bewusst und spannend erlebbar zu machen. Nationalpark Gesäuse Junior Ranger Weng
junior-ranger.at Junior Rangers
83 List Rechtsanwalts GmbH Rechtsanwalt
8913
Weng im Gesäuse
Durch die Verkn?pfung zwischen l?sungsorientiertem Problembewusstsein und f?cher?bergreifendem KnowHow bietet die List Rechtsanwälte GmbH den
ralist.at Rechtsanwalt List Wien Öffentliches Recht
84 Start Nationalpark Gesäuse Nationalpark Gesäuse GmbH
8913
Weng im Gesäuse
... or English on demand if sufficient participants of these languages. The workshops at the second day
np-gesaeuse.at
85 Start Alpenregion Nationalpark Gesäuse
8913
Weng im Gesäuse
Urlaub und Ferien in der Alpenregion Nationalpark Gesäuse. Sommer und Winter Routenplaner zu Wandern ... Saisonale Highlights Gseispur TVB - Alpenregion Nationalpark Gesäuse Hauptstraße A - Admont
gesaeuse.at Gesäuse Energiequelle Europa Festival St.
86 Start Nationalpark Gesäuse Nationalpark Gesäuse GmbH
8913
Weng im Gesäuse
... workshops at the second day will take place in English language without translation. Registration The
nationalpark.co.at
87 Heinz Weiler
6060
Hall

heinzweiler.at
88 Verein VAGET
6060
Hall
... . Infoblatt memory download Verein VAGET - Schmiedtorgasse Hall Kontakt
tagestherapiezentrum.at
89 Kur und Stadtapotheke Hall apotheke
6060
Hall
Die Apotheke am oberen Stadtplatz in Hall ist um Ihre Gesundheit bemüht. ... zu fühlen- abnehmen wollen viele.... mehr... Hall in Tirol Oberer Stadtplatz -
stadtapotheke-hall.at Apotheke Hall Stadtapotheke Pollack Medikament Berggeist Knoblauchdragees Heilpf
90 News Fröschl AG & Co KG
6060
Hall
... Kontakt Aktuelle Seite Home Segnung FRÖSCHL HAUS Das neue Fröschl Haus am Haller Brockenweg wurde
froeschl.at
91 Red Lionettes: Hintergrund
6060
Hall
... Lionettes Cheerleading und Cheerdancing der Red Lions Hall Home Team Kampfmannschaft Juniors Verein
redlionettes.at
92 Red Lions: Home
6060
Hall
... Hall in Tirol
redlions.at
93 Rauchfutter | Anton Rauch
6060
Hall
... Adresse Rauchfutter Innsbrucker Hall Telefon + +
rauchfutter.at
94 Verein VAGET
6060
Hall
... . Infoblatt memory download Verein VAGET - Schmiedtorgasse Hall Kontakt
uebergangspflege-tirol.at
95 News Fröschl AG & Co KG
6060
Hall
... Kontakt Aktuelle Seite Home Segnung FRÖSCHL HAUS Das neue Fröschl Haus am Haller Brockenweg wurde
xn--frschl-xxa.at
96 Veranstaltungstechnik Lichttechnik Crossfade GmbH Veranstaltungstec
6060
Hall
Crossfade Veranstaltungstechnik Krippgasse 8 6060 Hall in Tirol
x-fade.at Veranstaltungstechnik Lichttechnik Bühnentechnik Tontechnik
97 Historica Historische Forschungen
6060
Hall

historica.co.at
98 Willkommen | Hörtnagl Andrä Hörtnagl Produktion und Handel GmbH
6060
Hall
Hörtnagl ist der Tiroler Marktführer in der Erzeugung und Veredelung von hochwertigen Wurst und Fleischwaren. ... zweimal jährlich abgebildet. Weiterlesen Genussstation in Hall Der Hörtnagl-Standort in Hall in Tirol darf
hoertnagl.at
99 Kunterbunter Laden Kinder
6060
Hall
im ... Kunterbunter Laden - Kinder Second Hand Schmiedgasse Hall in Tirol Öffnungszeiten DO
kunterbunter-laden.at
100 News Fröschl AG & Co KG
6060
Hall
... der Gemeinde Tulfes Träger des Ehrenzeichens des Landes Tirol und der Stadt Hall sowie zahlreicher weiterer
liquid-rock.at
101 Bäckerei Zöhrmühle aus Bad Zöhrmühle GmbH
4540
Bad Hall
Die Bäckerei Zöhrmühle aus Bad Hall bäckt ausschließlich nach eigenen Rezepten Ihr Steinofenbrot ... Bäckerei Zöhrmühle Startseite Filialen Backwaren Rückblicke Info Point Filiale Bad Hall Hauptplatz
zoehrmuehle.at
102 IPC Verpackungen und Logistik IPC
4540
Bad Hall
IPC Verpackungen und Logistik GmbH bietet Flugfrachtverpackung Sonderverpackung Gefahrengutverpackung LKW Verpackung
karopack.at IPC Verpackungen Verpackung Logistik
103 Startseite Ökergo Unternehmensberatung Service-Team GesmbH Unternehmensberat
4540
Bad Hall
Wir sind eine Unternehmensberatungsfirma bei der die ProzessOptimierung durch ein ExpertenTeam im Vordergrund steht. Ökergo UnternehmensberatungsServiceTeamGesmbH
netzwerk-zeitwirtschaft.at Unternehmensberatung Arbeitsvorbereitung Arbeitssicherheit Lohnsysteme
105 IPC Verpackungen und Logistik IPC
4540
Bad Hall
IPC Verpackungen und Logistik GmbH bietet Flugfrachtverpackung Sonderverpackung Gefahrengutverpackung LKW Verpackung
ipc-verpackungen.at IPC Verpackungen Verpackung Logistik
106 CellaApotheke Die Quelle Cella
4540
Bad Hall
Die CellaApotheke in Bad Zell bietet Ihnen ein großes Leistungsspektrum von Bachblütenberatung bis hin zu
cella-apotheke.at Cella Apotheke Zell Bad Zell
107 Willkommen! Kinderwerkstatt Grillenbichl e.V.
6060
Hall i.T.
... . Badgasse A- Hall i.T. kinderwerkstatt grillenbichl
grillenbichl.at
108 Autohaus Gegenleitner und Lang Gegenleitner & Lang GmbH Autohaus
4540
Bad Hall
Autohaus Gegenleitner und Lang Ihr Spezialist für seat gebwseat Autohaus Auto Carconfigurator ... Unsere Anschrift Gegenleitner Lang GmbH Bad Hall Steyrer Telefon Tele
gegenleitner-lang.at Autohaus Gegenleitner Und Lang Seat Gebwseat Autohaus
109 Die Gesundheitsdienstleister :: Baden Gesundheit
4540
Bad Hall
Die Gesundheitsdienstleister in Baden sind spezialisiert auf Kurmedizin Sportmedizin Homöopathie Akupunktur
gesundheitsdienstleister.at Gesundheit Medizin Ganzheitsmedizin Kur
110 Startseite Ökergo Unternehmensberatung Service-Team GesmbH Unternehmensberat
4540
Bad Hall
Wir sind eine Unternehmensberatungsfirma bei der die ProzessOptimierung durch ein ExpertenTeam im Vordergrund steht. Ökergo UnternehmensberatungsServiceTeamGesmbH
oekergo.at Unternehmensberatung Arbeitsvorbereitung Arbeitssicherheit Lohnsysteme
111 ParkpensionBillroth.at Parkpension
4540
Bad Hall
... sagt liegt dieses gepflegte Haus direkt am Kurpark von Bad Hall einer der schönsten Parks von ganz
parkpension-billroth.at Parkpension Billroth Gegenhuber Pension
112 Hochbeete | Terrassen | Hochbeete
4540
Bad Hall
Ortner Holz in Oberösterreich bietet Hochbeete Fassaden und viele weitere Produkte aus Holz.
ortner-holz.at Hochbeete Hochbeet Ortner Holz Sägewerk
113 Jausenstation Eisenhuber | Bad Jausenstation
4540
Bad Hall
Jausenstation Eisenhuber | Bad Hall | Furtberg ... herunterladen Jausenstation Eisenhuber Furtberg Bad Hall; +
jausenstation-eisenhuber.at Jausenstation Eisenhuber Bad Hall Furtberg Schmankerl Most Schweine
114 Startseite Klinikum Bad
4540
Bad Hall
Das Klinikum Bad Hall ist ein modernes Kompetenzzentrum für HerzKreislauf und neurologische Rehabilitation. ... Schriftgröße A A A Klinikum Bad Hall Parkstraße Bad Hall Telefon + -
klinikum-badhall.at
115 Vereinigung österreichischer Kurorchester orchester
4540
Bad Hall
... Bad Hall Bad Hofgastein Bad Ischl und Bad Schallerbach zusammengeschlossen zur ?Vereinigung
kurorchester.at Orchester Kurorchester österreichische Kurorcheser Musikinstrumente Kurchorchest
116 Monika Neudecker ::
4540
Bad Hall

monika-neudecker.at
117 Home | ModellFOX OnlineShop
4540
Bad Hall
Alles muss raus! Rasch zuschlagen nur begrenzte Stückzahlen.Teilen ... % Spw mm Anzahl AT- Texan Produktdetails... Artikel Nummer AN ? ? Sie sparen
modellfox.at OnlineShop Modellbau Modellflug Regler BEC
118 METABOLICTYPING.AT Willkommen!
4540
Bad Hall
... . Wilhelm Tischler Feldgasse Bad Hall + + Design
metabolic-typing.at
119 Dr. Blaha Wirtschaftstreuhänder wirtschaftstreuhä
4540
Bad Hall
Wirtschaftstreuhänder Steuerberater Blaha in Bad Hall Linz Oberösterreich Ratgeber in allen steuerlichen Angelegenheiten ... . Wirtschaftstreuhänder - Steuerberater Dr. Blaha in Bad Hall A- Bad Hall Hauptplatz Telefon +
stb-blaha.at Wirtschaftstreuhänder Steuerberater Blaha Bad Hall
120 über Uns dynamic-extrusion.com GmbH Handwerk
4540
Bad Hall
Steinkorbsystem bad hall ... -extrusion GmbH Mühlgruberstrasse Bad Hall + + ? officesteinkorbsystem
steinkorbsystem.at Handwerk Gold Silber Gold
121 S.S.T. Security sst
4540
Bad Hall
S.S.T. Security ... bei Unser Unternehmen mit Sitz in Bad Hall bietet Ihnen professionelle Dienstleistungen im Discotheken
sst-security.at Sst SST S.s.t. S.S.T. Security Security Sicherheitsdienst Bewachung
122 Home www.stodo.at
6060
Hall i.T.
Marketing und Kommunikation Webdesign Graphikdesign Geschäftsausstattung Kongressmanagement Events ... Fotogallerie Über mich Anfrage Doris Stolz ? Thurnfeldgasse a ? A Hall in Tirol
stodo.at
123 TGNMaschinenvertrieb TGN
4540
Bad Hall
Ihr Partner in Sachen Blechbearbeitung und Rohrbearbeitung Spenglerei Lufttechnik und Klimatechnik ... Kanallängen TGN Maschinenvertrieb Steyrer Str a Bad Hall + - + - E
tgn.at TGN Goldschald Steyr Bad Hall
124 Startseite Tomic TEC Tomic TEC Austria GmbH Industrieller
4540
Bad Hall
Konzeption Planung und Realisierung von Industrieanlagen bis hin zur schlüsselfertigen Übergabe einzelner Systeme. ... Stellenangebote KONTAKT Standorte Anfrage Kontakt Tomic TEC Austria GmbH Tischlerstr. A- Bad Hall
tomic.at Industrieller Anlagenbau TGA Schleifkabinen Versorgungstechnik
125 Austrowaren Alphapack Nagel und Nagel
4540
Bad Hall
Austrowaren Alphapack bietet seinen Kunden Produkte aus den Bereichen der Befestigungstechnik Schmelzklebetechnik
austrowaren.at Nagel Und Klammersysteme Kartonheftprogramme Baubeschläge
126 Willkommen | Home |
4540
Bad Hall
... ! Dreifaltigkeitsapotheke Bad Hall Hauptplatz Bad Hall + + Mail office
apotheke-badhall.at
127 Home
4540
Bad Hall
... wir! Beate Wetzlmayer - Cosmetic Institute Steyrer Bad Hall Austria + (
beate-wetzlmayer.at
128 Lebensmitteltechnologie Lebensmittelhygiene EuroConcept
4540
Bad Hall
Lebensmitteltechnologie Lebensmittelhygiene | EuroConcept unterstützt Lebensmittelbetriebe und verarbeiter bei neuen Innovationen.
euro-concept.at EuroConcept Lebensmitteltechnologie Lebensmittelhygiene Lebensmittel
129 Gruber Elektrotechnik Bad Hall Franz Gruber GesmbH & Co KG Elektroinstallati
4540
Bad Hall
Platz für Ihren Slogan
elektro-gruber.at Elektroinstallation Elektrotechnik Elektrogeräte Alarmanlagen
130 FF Bad Hall
4540
Bad Hall
... Freiwillige Feuerwehr Bad Hall retten - schützen - bergen - löschen - seit geben wir unsere
ff-badhall.at
131 FUSE Elektrotechnik GmbH in Fuse
4540
Bad Hall
FUSE Elektrotechnik GmbH in St. Marien bietet Beleuchtungsanlagen Energieverwaltungssysteme Sicherheitsbeleuchtungsanlagen Notrufanlagen und
fuse.at Fuse Elektrotechnik St. Marien ElektroFachbetrieb
132 Golfclub Herzog Tassilo golf;bad
4540
Bad Hall
... uns auf Sie! Der Vorstand des GC Herzog Tassilo Druckbare Version GC Herzog Tassilo Blankenberger Bad Hall
gcherzogtassilo.at Golf;bad Hall;herzog Tassilo;gc;golfclub;club;golfplatz;oberösterreich;
133 Tischlerei Küchenstudio Franz
4540
Bad Hall
... Adlwangerstraße Bad Hall Route berechnen Telefon Mobil office
tischlerei-gegenleitner.at
134 Alfred Scheich MAS Alfred
4540
Bad Hall
Alfred Scheich MAS. International Consulting. Mayrbäurlweg 14 4540 Bad Hall Oberösterreich ... Mayrbäurlweg A- Bad Hall officeasfs Internet www.international-consulting . Benutzername
international-consulting.at Alfred Scheich MAS International
135 RS Tore Industrietore RSTORE
4550
Bad Hall
... Hall Hehenberg - officerstore
rstore.at RSTORE Rührlinger Planung Bauplanung Industrietore
136 Der Schnürerhof die Pension
4540
Bad Hall
Herzlich Willkommen beim Schnürerhof die Frühstückspension und Jausenstation im Herzen Oberösterreichs. Ausspannen Ruhe ... im Herzen Oberösterreichs! Feyreggerstraße - A- Pfarrkirchen b. Bad Hall DIENSTAG u
schnuererhof.at Pension Urlaub Unterkunft Bad Hall
137 DER ALARM PROFI Ihr AirControlSystem
4540
Bad Hall
Ihr Berater für Sicherheitstechnische Fragen rund um das Thema Alarmsicherung.
deralarmprofi.at AirControlSystem Alarmanlage AlarmierungsSystem Außenbewegungsmelder
138 Praxis PD Dr. Heinrich Lenders
74523
Schwäbisch Hall
Praxis PD Dr. Heinrich Lenders
lenders.at Lenders Heinrich Lenders Praxis Praxis
139 Langerweg28.at Home H & H Immobilien und Projektentwicklung GmbH Langerweg
6060
Hall i.T.
Langerweg Innsbruck Büro und Geschäftsflächen Mietflächen HH Immobilien und Projektentwicklung
langerweg28.at Langerweg Innsbruck Büro Und Geschäftsflächen
140 Lebensmitteltechnologie Lebensmittelhygiene EuroConcept
4540
Bad Hall
Lebensmitteltechnologie Lebensmittelhygiene | EuroConcept unterstützt Lebensmittelbetriebe und verarbeiter bei neuen Innovationen.
hygienix.at EuroConcept Lebensmitteltechnologie Lebensmittelhygiene Lebensmittel
141 Leben kann mehr sein workshops
4540
Bad Hall
Home Angebot Philosophie Über uns Die 3 Termine Aktuelles Kontakt einzelbalancen ? gruppenarbeit ? workshops
lkms.at Workshops Gruppenarbeit Seminare Ausbildungen
142 Pepi Personaleinsatzplaner
4540
Bad Hall
Optimieren Sie Ihre Personaleinsatzplanung!
personaleinsatz.at
143 HOME Postfuchs Postfuchs
6060
Hall i.T.
Die FCG Post Tirol übernimmt Verantwortung für zahlreiche Christgewerkschafterinnen und Christgewerkschafter die das Wertefundament ... HOME TEAM NEWS POSTFUCHS SERVICE FORMULARE FCG POST POST SOZIAL KONTAKT FCG - Tirol
postfuchs.at Postfuchs Postfuchs Fcg Fraktion
144 Willkommen bei SerVers! Ihr SerVers GmbH
4540
Bad Hall

servers.co.at
145 Branchenbuch Firmen branchenbuch
74523
Schwäbisch Hall

aligo.at Branchenbuch Branchen Branchen Verzeichnis Firmenverzeichnis Firmen Verzeichnis
146 HonigManufaktur Binder Startseite Honig
74523
Schwäbisch Hall
Bio Honig ... die am Anfang stehen ... Weiterlesen... Einführungskurs Schwäbisch Hall Einführungskurs ?Arbeiten im Angepassten
angepasster-brutraum.at Honig Manufaktur
147 Mcexpert Apple Beratung Apple
4540
Bad Hall
Apple Autorisierter Händler Mac OSX Beratung Support Service Reparatur Verkauf Linz Wels Steyr Ihr ... Home Shop Support Service Autorisierter Händler In Bad Hall und Online. Shop Bad Hall Online
mcexpert.at Apple Autorisierter Händler Mac OSX Beratung Support
148 Mehler Elektrotechnik Mehler
4540
Bad Hall
Mehler Mehler Elektrotechnik
mehler-mehler.at
149 Die Keynote zum Erfolg! Lichtkoppler Unternehmensberatung GmbH
4540
Bad Hall
Sie suchen einen begeisternden KeynoteSpeaker für Ihre Veranstaltung? Hier sind Sie richtig! ... Lichtkoppler Lichtkoppler Unternehmensberatung GmbH Habichtstraße Bad Hall info
keynote-speaker.at
150 Ägypten Infos
4540
Bad Hall
Hier finden Sie Ägypten Infos.
aegypten-infos.at
151 Bluebird tattoo Startseite Tättowierer
4540
Bad Hall
Manuel Aumüller BLUEBIRD Tattoo Piercing aus Bad Hall findet mit Ihnen das ideale ... Freehand Tattoos Willkommen bei BLUEBIRD Tattoo Piercing in Bad Hall Termine für sind alle vergeben
bluebird-tattoo.at Tättowierer Tätowierungen Tattoo Piercing
152 English Day | Bad
4540
Bad Hall
Herzlich willkommen bei English Day dem Sprachinstitut von Susan Geiblinger ihres Zeichens Native ... Sie Englisch mit Susan Geiblinger von English Day aus Bad Hall! Kontaktieren Sie mich gleich hier! Kompetente
englishday.at
153 Teambuilding Teamworkshops Lichtkoppler Unternehmensberatung GmbH
4540
Bad Hall
Workshops mit dem Ziel Ihr Team erfolgreicher zu machen! ... Unternehmensberatung GmbH infolichtkoppler Dr.-Karl-Renner- c Bad Hall + Laufend aktuelle
teamworkshop.at
154 Hubert Metzler Steuerberater Steuerberater
6060
Hall in Tirol
Hubert Metzler Stadtgraben 25 A6060 Hall in Tirol T: 0 52 23 ... Stadtgraben Hall in Tirol www.wtmetzler fon + - - + - -
wtmetzler.at Steuerberater Hall In Tirol Steuerberatung Hall In
155 Startseite Haller Lend Apotheke Mag. pharm. Vinzenz Krug e.U. Haller
6060
Hall in Tirol
Haller Lend Apotheke
haller-lend-apotheke.at Haller Lend Apotheke Apotheke Hall Apotheke
156 BIO Anbieter in Österreich
6060
Hall in Tirol
... - woran erkennt man BIO? Kropsch und Krajnc GnbR · Eugenstraße · Hall · - · Mobil
lustaufbio.at
157 Otto's Fliesen
6060
Hall in Tirol
... Gerbergasse A- Hall in Tirol . hribarottos-fliesen Öffnungszeiten
ottos-fliesen.at
158 Private Banking Hall in Vermögensmanegeme
6060
Hall in Tirol
Private Banking der Raiffeisen Regionalbank Hall: persönliche Vermögensberatung Vermögensmanagement Anlagestrategien und Investmentansatz. ... Sie sich jetzt für den kostenlosen Newsletter des Private Banking Teams der Raiffeisen Regionalbank Hall in Tirol an und profitieren
privatebanking-hall.at Vermögensmanegement Vermögensberatung Vermögensverwaltung Vermögensplanung
159 Startseite Plappermaul OG
4540
Pfarrkirchen bei Bad Hall
... bei Bad Hall + Diese -Adresse ist vor Spambots geschützt! Zur Anzeige
plappermaul.at
160 Salvatori Home
6060
Hall in Tirol

salvatori.at
161 Balsam Naturkosmetik #IndexMetaKeyword
6060
Hall in Tirol
#IndexMetaDescriptionStandard#
naturkosmetik-tirol.at #IndexMetaKeywordsStandard#
162 Elektro Anlagen Bau Elektro Pickl GmbH
6060
Hall in Tirol
... Home Geschichte Referenzen Leistungen Anfahrt Kontakt Elektro Anlagen Pickl Hall in Tirol
elektro-pickl.at
163 Nudeln und Teigwaren von
6060
Hall in Tirol
... finden Sie im ARCHIV . Recheis Teigwaren GmbH Fassergasse - A- Hall in Tirol kostenlose
direktindiepfanne.at
164 Bestattung Ebenbichler
6060
Hall i. Tirol

bestattung-ebenbichler.at
165 Bergerlebniswelt "Kugelwald am Glungezer"
6060
Hall in Tirol
... + officehall-wattens Galerie Region Hall Wattens Social Media
kugelwald.at
166 Urlaub Österreich Tirol Region Urlaub
6060
Hall in Tirol
Urlaub in den Tiroler Alpen: Hotels und Ausflugsziele in der Region HallWattens in Tirol / ... Kristallwelten RiesenKinderSpiel Geschichte der Fa. Swarovski Haller Münze Burg Hasegg Museum Münze Hall Burg
hall-wattens.at Urlaub Tiroler Alpen Hotels
167 Home | Projekt Tirol Harley Davidson
6060
Hall in Tirol
Harley Davidson Innsbruck jetzt neu und endlich wieder in Tirol!
harley-tirol.at
168 Hall in Tirol
6060
Hall in Tirol
... Hall in Tirol - Haller Stadtrundgänge Seit gibt es die beliebten Haller Stadtrundgänge
hall-fuehrungen.at
169 Einkaufen in Hall in
6060
Hall in Tirol
... KAUFLEUTE ? HALL IN TIROL ? INFOHALLER-KAUFLEUTE.AT ? Login webdesign
haller-kaufleute.at
170 Hotel GARNI GRANAT der PRESSETEXTER Text- und Kommunikationsagentur GmbH Ötztal
6060
Hall in Tirol
Willkommen auf der Startseite des Hotels Granat in Soelden im Ötztal!
hotel-granat.at Ötztal Soelden Tirol Hotel
171 HOME Immobilien Huber Immobilien Huber GmbH Hausverwaltung
6080
Mils bei Hall i.T.
Wir beschäftigen uns mit dem Hausverwaltungsgewerbe und verwalten als Immobilientreuhänder und Gebäudedienstleister Wohnanlagen und ... GmbH A Mils bei Hall i.T. Gewerbepark officeimmobilienhuber
immobilienhuber.at Hausverwaltung Immobilienverwaltung Immobilien Wohnanlagen
172 Pension Griebler: Willkommen Pfarrkirchen
4540
Pfarrkirchen bei Bad Hall
Gaestehaus Griebler Urlaub zum Wohlfühlen! ... des Kurbezirks Bad Hall. Eine große Anzahl von immer wieder kommenden Stammgästen zeigt uns die Zufriedenheit
griebler.at Pfarrkirchen Bad Hall Kremsmünster Kremsmuenster Urlaub Erholung Kur
173 Grossholzner HOME Über
4540
Pfarrkirchen bei Bad Hall
Ich bin Christian Grossholzner aus Pfarrkirchen bei Bad Hall und erzähle euch auf dieser Webseite ... Pfarrkirchen bei Bad Hall + + ch.grossholzneraon FOHLENAUFZUCHT GASTSTUTEN
grossholzner.at Über Mich Hobby Fotos
174 Gaber Backwaren
6060
Hall in Tirol

gaber-backwaren.at
175 Home Park In
6060
Hall in Tirol

parkin.at
176 Panorama Bauobjekt GmbH der Panorama Bauobjekt GmbH panoramabau
6060
Hall in Tirol
panorama Bauobjekt und Panorama Projektentwicklung Karl Heinz Schlechter Bauträger Immobilientreuhänder und Projektentwicklung. ... Rudolfstraße a A- Hall in Tirol ? ? ? objektpanoramabau
panoramabau.at Panoramabau Bauträger Immobilientreuhänder ökologisches Bauen
177 Webdesign EDV Technik web
6060
Hall in Tirol
Professionelles kostengünstiges Webdesign sowie Consulting bezüglich Internetanbindung Multimedia Internet Technik
hoema.at Web Design Webpräsentationen Webdesigner Webspaxe
178 Halbmarathon Hall in Tirol
6060
Hall in Tirol
... Lauftreff Hall Sommacampagna Sportveranstaltungen Gästebuch Haftungsausschluss italiano webdesign
halbmarathon-hall-wattens.at
179 KFZ Servicewerkstätte Hausbichler
6060
Hall in Tirol
... KFZ Meisterbetrieb. Unsere Anschrift KFZ Meisterbetrieb S. Hausbichler Lorettostr. a Hall
hausbichler.at
180 Home JENEWEIN EXCLUSIVE Home
6060
Hall in Tirol
Home
jenewein-exclusive.at Home
181 Isuzu ISUZU Hollaus
6060
Hall in Tirol
... Vertragspartner der neue D-Max Alles rund um ISUZU finden Sie bei der Firma Auto Hollaus - Hall Verkauf (ISUZU D
isuzu-hollaus.at
182 Kreativtischler Spötl Küchen Innsbruck
6060
Hall in Tirol
Ob neue Küche Renovierung oder Ausbau: Wir achten auf gute Qualität spitzen Service ... Unsere Marken Unsere Leistungen Kontakt -/- Anfahrt Kreativtischlerei Spötl in Hall
kuechen-hall-innsbruck.at Innsbruck Hall Thaur Absam
183 KulturmacherInnen ? das österreichische Verlag Ablinger & Garber GmbH kulturmacherInnen
6060
Hall in Tirol
das kulturhandbuch für österreich und südtirol : Kulturinitiativen / KulturveranstalterInnen Kultur und Kunstfestivals ... Hall in Tirol fon +--- +--- send mail top kulturmacherinnenablinger
kulturmacherinnen.at KulturmacherInnen österreich Austria Kulturinitiativen Festivals Theatergruppen
184 Willkommen
6060
Hall in Tirol
... Skip to the navigation . Skip to the content . KLARAHEIM ? Hall in Tirol Wohn- und Pflegeheim
klaraheim.at
185 Lebensberatung Hall
6060
Hall in Tirol
... ? Lebensberatung Hall für Einzelpersonen Paare Beziehungen Design by Mauenbert Co. Template design by
lebensberatunghall.at
186 Home
6060
Hall in Tirol
... Home Im Aufbau Links Vereinschronik Modellbaugemeinschaft Hall i. Tirol Nur fliegen
mbg-hall.at
187 Welcome to the Frontpage joomla
6060
Hall in Tirol
Joomla! dynamische PortalEngine und ContentManagementSystem ... Unterer Stadtplatz A- Hall in Tirol + Home Anmeldung Chronik
musikschule-hall.at Joomla Joomla
188 Metallbau Hofmann Home Metallbau
6060
Hall in Tirol
Metallbau Hofmann Home
m.metallbauhofmann.at Metallbau Hofmann Home
189 Mykon Technisches Büro MYKON OG
6060
Hall in Tirol

mykon.at
190 Maschinenverleih LeihMair Geräteverleih Leihmaschinen
6060
Hall in Tirol
... Geräteverleih in Hall in Tirol! Nur km östlich von Innsbruck sind wir sehr zentral gelegen. Wir möchten
leih-mair.at
191 PHYSIO CENTRAL Peter
6060
Hall in Tirol
Physio Central Praxis für Physiotherapie und Osteopathie im Herzen von Hall. Ihre erste Adresse ... Osteopathie Global Diagnostics in Hall ? HiTech im ganzheitlichen Gesundheitsbereich Massage Atemtherapie
physio-central.at Peter Geisler Physiotherapie Physiotherapie Hall
192 Pharmador.at ? Startpage
6060
Hall in Tirol
... · A- Hall in Tirol
pharmador.at
193 Tiroler Rohre  TRM Tiroler Rohre GmbH Willkommen
6060
Hall in Tirol
Tiroler Rohre entwickelt produziert und vermarktet Systeme aus duktilem Guss für den Wassertransport und ... einsetzbare Pfahlsysteme für den Spezialtiefbau gefertigt. An unserem Produktionsstandort in Hall in Tirol
pfahl-trm.at Willkommen Beim Spezialisten Für Duktilen Guss!
194 Spenglerei Glaserei Posch Klaus Spenglerei
6060
Hall i. T.
Spenglerei Glaserei Posch Innsbruck Tirol Absam Hall Blechbearbeitung Blechd�cher Dachrinnen Handwerker Blechdachanstrich Verglasung Korrosionsschutz Fensterbleche
posch-klaus.at Spenglerei Glaserei Posch Innsbruck Tirol Absam Hall Blechbearbeitung
195 Home  PER TUTTI Cafe Pizzeria per
6060
Hall in Tirol
PER TUTTI Cafe Pizzeria Ristorante Wir bieten Ihnen erstklassige italienische Küche in der schönen ... uns Sie in unserem wunderschönen Lokal in Hall in Tirol begrüßen zu dürfen. Erstklassige original italienische Küche
per-tutti.at Per Tutti Altstadt Hall In Tirol
196 Über mich
6060
Hall in Tirol

professional-image.at
197 POJAT
6060
Hall in Tirol
... Home über uns OJA in Tirol Kontakt Saline A Hall in Tirol officepojat www.pojat
pojat.at
198 Home Startseite Kaffeevertrieb Praxmarer GmbH
6060
Hall in Tirol
Die Startseite des Kaffeevertriebs Praxmarer GmbH. ... Adresse lautet Löfflerweg Hall in Tirol Kontakt Praxmarer Kaffeevertreb GesmbH
praxmarer.at
199 Versicherungsmakler PF Hall in
6060
Hall in Tirol
... Fleischmann OEG Weinfeldstrasse a A- Hall in Tirol T - F --
pflanzner-fleischmann-oeg.at
200 Mihalits Piroche Cosmetiques
6060
Hall in Tirol

piroche.at
201 Willkommen auf der Startseite Psychologie
6060
Hall in Tirol
Ing.Dr.Ulrike Hanko Systemische Praxis Coaching Supervision und Therapie
psychologie-tirol.at Psychologie Klinische Psychologie Gesundheitspsychologie Antiaggressionstrain
202 Shoes n feet ?
6060
Hall in Tirol
Besuchen Sie shoes n feet in 6060 Hall in Tirol. In unserem Schuhgeschäft finden Sie ... Innsbruckerstr. Hall in Tirol
shoesnfeet.at
203 G.Moser Söhne
6060
Hall in Tirol
... Schreibwaren G. Moser Söhne Oberer Stadtplatz A- Hall in Tirol Mo-Fr
skribo-moser.at
204 Dinkhauser Kartonagen verpacken Dinkhauser Kartonagen GmbH Dinkhauser
6060
Hall in Tirol
Dinkhauser ... packaging .. Weltkunstschau Datenschutzerklärung AGB Dinkhauser Kartonagen GMBH Hall
showpac.at Dinkhauser Verpackungen Verpackung Displays
205 Die Sprachdienstleister : Übersetzung
6060
Hall in Tirol

sprachdienstleister.at
206 TBE Hager Home Joomla
6060
Hall in Tirol
Joomla the dynamic portal engine and content management system ... gutachtentbe-hagerat TBE Hager Joomla! is Free Software released under the GNU/GPL License.
tbe-hager.at Joomla Joomla
207 Terschl CNC Rohrbearbeitung
4540
Bad Hall - Adlwang
... Gesellschaft m.b.H. Co KG - CNC Blech- Rohrbearbeitung - Terschlplatz - A- Bad Hall - Adlwang - Tel
terschl.at
208 Home
6060
Hall in Tirol
... wurde am . September am Kurhausplatz in Hall durchgeführt. Kostenlos konnten dabei Jugendliche ihr Rad
jugendarbeit-mobil.at
209 Straub Schützen Hall
6060
Hall in Tirol
... Hall INFOS .. Straubball mehr .. Schützenheim-INFO mehr
straubschuetzen.at
210 TKIES Schotterwerk Absam T-Kies GmbH & Co KG TKIES
6060
Hall in Tirol
Wir betreiben an 2 Standorten (Absam und Ebbs) in Tirol einen Abbau von mineralischen Rohstoffen
t-kies.at TKIES Kies Steinbruch Absam
211 Die Sprachdienstleister : Übersetzung
6060
Hall in Tirol

transalps.at
212 Aktuelle Theater Neuigkeiten
6060
Hall in Tirol
... Kontakt Aktuelles vom Haller Theaterhaufen Casting Der Haller Theaterhaufen veranstaltet
theaterhaufen.at
213 STARTSEITE: Speckbacher Schützenkompanie Hall Josef
6060
Hall in Tirol
Speckbacher Schützenkompanie Hall in Tirol ... Haller StaTTfest In Gedenken an Fred Hafner Leider müssen wir euch die traurige Nachricht
speckbacher-schuetzen.at Josef Speckbacher Schützen Schützenkompanie Hall
214 Theaterpädagogisches Zentrum Hall
6060
Hall in Tirol

tpz.at
215 Alena Obleitner Künstlerin
6060
Hall in Tirol
Sie finden auf dieser Seite Informationen rund um die akademische Malerin Alena Obleitner. ... der Haller Künstlerin. Diese Seite kann nur mit aktiviertem JavaScript korrekt angezeigt werden. kontakt Ã
alenaobleitner.at
216 Home TCC Studentenheim GmbH
6060
Hall in Tirol
... Herzlich Willkommen im Studentenheim am Universitätscampus in Hall in Tirol! Wohnen und Studieren
campushotel.at
217 Canal Co. Aktuell CANAL & Co. KG
6060
Hall in Tirol
Canal Co. Alles für den Bau. Der Tiroler BauwarenProfi mit Baufachmärkten in Hall ... gerecht werden. Unsere Baumärkte in Hall in Tirol und Pfaffenhofen runden das Angebot für unsere Kunden
canal.at
218 Pizza Hall in Tirol
6060
Hall in Tirol
... PIZZA UND KEBAP in Hall in Tirol Bitte installieren Sie den Flash Player und aktivieren
chili-kebap-hall.at
219 Startseite Tickets London
6060
Hall in Tirol
... Warteliste! FC Bayern München Alle Spiele erhältlich! Tickets Tours ? Thaurer ? A- Hall
bundesligakarten.at London 2012 Tickets Olympia
220 Home Cashcom Abrechnungssysteme GmbH
6068
Mils bei Hall i.T.

cashcom.at
221 Hall AG Camping Stadt Hall in Tirol Immobilien GmbH Schwimmbad
6060
Hall in Tirol
... Sie in unmittelbarer Nähe der historischen Altstadt Hall in Tirol Stellplätze im Grünen auf insgesamt . m
camping-hall.at Schwimmbad Camping Hall In Tirol Camping Hall
222 Mike Brötz mike
6060
Hall in Tirol

broetz.at Mike Brötz Architekt Design Möbel
223 ATUM Ensemble
6060
Hall in Tirol

atum.at
224 Auto Hollaus Auto
6060
Hall in Tirol
... Auto Hollaus - Hall - Tirol Navigation überspringen Auto Hollaus Über uns Fahrzeughandel
auto-hollaus.at
225 Hotel Garni Bergheim in der PRESSETEXTER Text- und Kommunikationsagentur GmbH Hotel
6060
Hall in Tirol
Urlaub im Hotel Garni Bergheim in Sölden Ötztal. Buchen Sie Ihren Skiurlaub in Sölden
bergheim-soelden.at Hotel Garni Bergheim Sölden Ötztal Tirol Oesterreich Österreich
226 Bezirkskrankenhaus Hall Anästhesie Bezirkskrankenhau
6060
Hall in Tirol
Anaesthesie Bezirkskrankenhaus Krankenhaus BKH Hall Intensivmedizin öffentlich allgemein Medizin Klinik Genesung Schmerztherapie Tirol
anaesthesie-hall.at Bezirkskrankenhaus Hall Tirol
227 Country Home Style Schloss Mühlgrub Betriebs GesmbH
4540
Pfarrkirchen bei Bad Hall
Im Schloss Mühlgrub in Pfarrkirchen bei Bad Hall/Oberösterreich finden Sie COUNTRY HOME STYLE. In diesem außergewöhnlichen ... Trendset München . ? . Jänner Halle B Stand B Creativ Salzburg . Februar ? . März
country-homestyle.at
228 ORDINATION Dr. Christoph Harpf
6060
Hall in Tirol
Dr. Harpf Venen Ästhetik Chirurgie aus Hall in Tirol meine Schwerpunkte Plastische ... für Plastische Chirurgie Facharzt für Gefäß-Chirurgie Gerbergasse Hall in Tirol T +
dr-harpf.at Harpf Hall Tirol Chirurg
229 Cultuhr wir drehen für
6060
Hall in Tirol
... nicht für bereits ermäßigte Tarife. Münze Hall Münzerturm - Museum Goldenes Dachl Innsbruck - Silberbergwerk
cultuhr.at
230 ISUZU
6060
Hall in Tirol
... Auto Hollaus Burgfrieden Hall in Tirol Willkommen ISUZU D-Max SingleCab
d-max.at
231 Der Hundeladen
6060
Hall in Tirol
... DAS ANGEBOT KONTAKT Schlossergasse A - Hall in Tirol Öffnungszeiten MO Ruhetag DI-FR
derhundeladen-hall.at
232 ÉLÈVES POUR ÉLÈVES
6060
Hall in Tirol

elevespoureleves.at
233 Über mich
6060
Hall in Tirol

elfi-knofler.at
234 Feuerwerk und Raketen
6060
Hall i. Tirol
... über für sie auf Lager. Unser Feuerwerk-Verkaufsstand in Hall in Tirol ist ab . Dezember wieder für Sie geöffnet
eppifire.at
235 Flörl :: Metallbau und FLÖRL Ges.m.b.H.
6060
Hall in Tirol
Metallbau und Kunstschlosserei. ... Ges.m.b.H. Metallbau + Kunstschlosserei Kugelanger A- Hall in Tirol t. + f. + (
floerl-metallbau.at
236 Tiefkühlservice Freund Eskimo
6060
Hall in Tirol
... ? A- Hall in Tirol ? - - ? . - - ? verkauffreund
freund-tks.at
237 Feuerwehr Pfarrkirchen Feuerwehr
4540
Pfarrkirchen bei Bad Hall
Feuerwehr Pfarrkirchen Worauf du dich verlassen kannst. ... unserer Wehr absolvierten die Atemschutz-Leistungsprüfung der höchsten Stufe in Gold in Bad Hall
ff-pfarrkirchen.at Feuerwehr Pfarrkirchen FF Pfarrkirchen Freiwillige Feuerwehr
238 HOME Aristos Druckzentrum GmbH
6060
Hall in Tirol

aristos.at
239 Alpenhelis Projektpage
6060
Hall in Tirol

alpenheli.at
240 Home keywords1
6060
Hall in Tirol
description of the website ... geologen Saline Hall in Tirol + + - officegeo-zt
geo-zt.at Keywords1 Keywords2 Keywords3 Keywords4 Keywords5
241 Mode von Feucht  Mode von Mode von Feucht GmbH
6060
Hall in Tirol
... Mode von Feucht GmbH Zentrale Schergentorgasse · A- Hall in Tirol Telefon +
feucht.at
242 Fotograf markus mair :: fotografie
6060
Hall in Tirol
fotografie markus mair innsbruck spezialfotografie ... aus der Baustellenpraxis >>> www.fotograf-mair Hall Bei der Säule infofotograf-mair + (
fotograf-mair.at Fotografie Spezialfotografie Hochbildfotografie Aug Am Stiel Hochstsativ Hall
243 Tierarzt Anker Hall
6060
Hall in Tirol
... - Röntgen Labor Chirurgie Komplementärmedizin Zähne; Bruckergasse - A- Hall i.T. - +
tierarzt-anker.at
244 Salzraum hall Stadt Hall in Tirol Beteiligungs AG
6060
Hall in Tirol
... start salzlager kurhaus burg hasegg münze hall anreise links kontakt impressum deutsch ? englisch
salzlager-hall.at
245 Scheinwerfer Licht + Scheinwerfer
6060
Hall in Tirol
... Kontakt Ing. Michael Cazzonelli Eugenstraße A- Hall in Tirol T + Mob + (
scheinwerfer-c.at Scheinwerfer Licht + Beratung Ing. Michael
246 SCHLOSS MÜHLGRUB Schönes Schloss Mühlgrub Betriebs GesmbH
4540
Pfarrkirchen bei Bad Hall
Im Schloss Mühlgrub in Pfarrkirchen bei Bad Hall/Oberösterreich finden Sie COUNTRY HOME STYLE. In diesem außergewöhnlichen
schloss-muehlgrub.at
247 Univ. Prof. Dr. Dr.
6060
Hall in Tirol
bei Univ. Prof. Dr. Dr. Siegfried Jank Facharzt fü Mund Kiefer und Gesichtschirurgie. ... Jank Facharzt für Mund- Kiefer und Gesichtschirurgie Behaimstr. A- Hall in Tirol
kieferchirurgie-hall.at
248 Grußkarten Trauerbillets Grußkarten
6060
Hall in Tirol
... weiter zum Shop Firmenkunden Passwort Passwort anfordern Watzek Photografie Salvatorgasse Hall
kikicard.at Grußkarten Grußbilletts GrußKarten GrußBilletts
249 Round Table 25
6060
Hall in Tirol
... überspringen Round Table Charity Ball am Samstag den .. im Kurhaus Hall Seit mehr als Jahren feiert
rt25.at
250 Restaurant Restaurant Schwarzer Adler
6060
Hall in Tirol
... Speisekarte Öffnungszeiten Kontakt Restaurant Schwarzer Adler - Hall in Tirol Bereits ab
schwarzer-adler-hall.at
251 Videodreh Filmproductions Ihr
6060
Hall in Tirol
Home ... ist eine Videoproduktionsfirma mit Sitz in Hall in Tirol. Unser Produktionsteam besteht aus mehreren erfahrenen Kameramännern
videodreh.at Ihr Ansprechpartner Für Fimproduktionen
252 WESTCAM Datentechnik Technologien WESTCAM Datentechnik GmbH
6068
Mils bei Hall
Die WESTCAM Datentechnik unterstützt seit fast 25 Jahren Unternehmen die innovative Produkte entwickeln oder
westcam-datentechnik.at
253 Home
4540
Bad Hall - Adlwang
Willkommen bei Wolf Historc Racing
whr.at
254 Installateur TUSCH Hall TUSCH Installations Ges.m.b.H.
6060
Hall in Tirol
Installateur TUSCH Ihr Meisterbetrieb seit über 120 Jahren im Herzen von Hall in Tirol ... HALL in TIROL ? ZOLLSTRASSE TEL. ? FAX - officetusch-hall Sie befinden
tusch-hall.at
255 Homepage Glungezer Gastronomie KG
6060
Hall in Tirol
... sich Hannes nach einer "Dependance" in Hall in Tirol um Hier ergriff der Zufall das Zepter
vino1337.at
256 Kühltransporte Martin Wegscheider in Martin Wegscheider e.U.
6060
Hall in Tirol
... in Hall i. T. können wir sämtliche Transporte innerhalb von bis Stunden garantieren
wegitrans.at
257 Union Innsbruck / upc
6060
Hall in Tirol

upc-nachwuchscup.at
258 Klasseneinteilung Turmlauf Hall in
6060
Hall in Tirol
... und Video Kontakt Gästebuch Newsletter Haftungsausschluss webdesign . Raiffeisen Turmlauf Hall
turmlauf.at
259 Blumen Neuner joomla
6060
Hall in Tirol
Joomla! dynamische PortalEngine und ContentManagementSystem ... Über uns Kontakt Home / Blumen Neuner Krippg Hall in Tirol Copyright . All Rights Reserved. powerd
blumenneuner.at Joomla Joomla
260 Dinkhauser Kartonagen verpacken Dinkhauser Kartonagen GmbH Dinkhauser
6060
Hall in Tirol
Dinkhauser ... packaging .. Weltkunstschau Datenschutzerklärung AGB Dinkhauser Kartonagen GMBH Hall
boxanova.at Dinkhauser Verpackungen Verpackung Displays
261 Univ. Prof. Dr. Dr.
6060
Hall in Tirol
bei Univ. Prof. Dr. Dr. Siegfried Jank Facharzt fü Mund Kiefer und Gesichtschirurgie. ... Jank Facharzt für Mund- Kiefer und Gesichtschirurgie Behaimstr. A- Hall in Tirol
cosmeo.at
262 Wohnskulptur Wolfgang Wallner Möbel
6060
Hall in Tirol
Wohnskulpturen
wolfgang-wallner.at Möbel Lichtobjekt Vintage Skulptur
263 Home Zimmerei Thurner Thurner Zimmereiunternehmen GesmbH
6060
Hall in Tirol
... Schlöglstraße Hall in Tirol + officezimmerei-thurner
zimmerei-thurner.at
264 Kolpingsfamilie Hall in Tirol
6060
Hall in Tirol
... Kolpingsfamilie Hall in Tirol verantwortlich leben ? solidarisch handeln Home Wer
kolpinghall.at
265 Univ. Prof. Dr. Dr.
6060
Hall in Tirol
bei Univ. Prof. Dr. Dr. Siegfried Jank Facharzt fü Mund Kiefer und Gesichtschirurgie. ... Jank Facharzt für Mund- Kiefer und Gesichtschirurgie Behaimstr. A- Hall in Tirol
kieferchirurgie-innsbruck.at
266 Aktuelles hak
6060
Hall in Tirol
Die Handelsakademie Hall ist eine Wirtschaftsschule welche nach 5 jähriger Vorbereitung aufs Wirtschaftsleben mit ... Erstellt . November Weiterlesen... Absolventin der HAK Hall unter den Preisträgern ..r BTV Dr
hak-hall.at Hak Has Hall Ausbildung
267 Ideenweberei OG Ideenweberei OG Ideenweberei
6060
- Hall in Tirol
ideenweberei OG eine full service Werbeagentur mit dem Schwerpunkt "Web" und dem Fokus auf open ... in einem kurzen Video zusammen. Read More... Ideenweberei OG Saline Hall i. Tirol +
ideenweberei.at Ideenweberei Ideenweberei Ideenweberei OG Ideen
268 Metallbau Hofmann Home Metallbau
6060
Hall in Tirol
Metallbau Hofmann Home
m.metallbau-hofmann.at Metallbau Hofmann Home
269 Mammagyn ? Univ. Prof. Mamma
6060
Hall in Tirol
Homepage von Univ. Prof. Dr. Susanne Taucher Fachärztin für Gynäkologie und Geburtshilfe Fachärztin für Chirurgie
mammagyn.at Mamma Taucher Susanne Gynäkologie Geburtshilfe Gynäkologie Gyn Chirurgie
270 Mihalits Piroche Cosmetiques Anna Mihalits OG
6060
Hall in Tirol

noesis.at
271 Www.sachverständigerunfallchirurgie.at Sachverständiger
6060
Hall in Tirol
Sachverständiger Unfallchirurgie Dr. med. R. Hrubesch
sachverstaendiger-unfallchirurgie.at Sachverständiger Unfallchirurgie Gutachten Hrubesch
272 Über mich Hall
6060
Hall in Tirol
Über den Haller Künstler Siegfried Obleitner
siegfriedobleitner.at Hall In Tirol Malerei Plastik
273 Salzraum hall Stadt Hall in Tirol Beteiligungs AG
6060
Hall in Tirol
... start salzlager kurhaus burg hasegg münze hall anreise links kontakt impressum deutsch ? englisch
salzraum-hall.at
274 Dr. Christian und Ursula Knie
6060
Hall in Tirol
Dr. Christian Zangl Facharzt für Orthopädie und orthopädische Chirurgie Schwerpunkt: Arthroskopie minimalinvasive
orthoclinic.at Knie Hüfte Knieprothese Hüftprothese
275 Rathauscafe Hall Hall Kili Gastro GmbH
6060
Hall in Tirol
... HOME HOCHZEITEN FOTOS KONTAKT HOME Willkommen im Rathaus Cafe Hall in Tirol Wir freuen
rathauscafe-hall.at
276 ELkinet Mauertrockenlegung Mauerentfeuchtung Mauertrockenlegun
6060
Hall in Tirol
Firma zur professionellen Mauerentfeuchtung und Mauertrockenlegung mit Elektroosmose. HOTLINE: +43 (0)5223 90 344. ELkinet Mauertrockenlegung ... )das erfolgreiche Traditionsunternehmen mit Sitz in Hall in Tirol. Zufriedene ELkinet-Kunden anmehr als .
elkinet-mauertrockenlegung.at Mauertrockenlegung Elektroosmoose Mauerentfeuchtung ELkinet Mauertrockenlegung
277 Home joomla
6060
Hall in Tirol
Joomla! dynamische PortalEngine und ContentManagementSystem ... ein Unternehmen der SCHMIDT´S Gruppe Schlöglstraße A- Hall in Tirol ++ ++(
hb-technik.co.at Joomla Joomla
278 Fertighaus in Massivbauweise | Massivhaus GmbH
6060
Hall in Tirol
Das Bauunternehmen in Innsbruck bietet schlüsselfertige Häuser in Massivbauweise. Kompetent schnell fixtermin ... MASSIVHAUS GmbH Obere Lend Hall in Tirol + + info
massiv-haus.at
279 Hall in Tirol
6060
Hall in Tirol
... Hall in Tirol - Haller Stadtrundgänge Seit gibt es die beliebten Haller Stadtrundgänge
xn--hall-fhrungen-1ob.at
280 Tirolinside.at Home ideenweberei OG
6060
Hall i. T.
... ? SOUNDKILLAZ X-MAS SPECIAL Kulturlabor Stromboli Hall in Tirol Österreich Kulturlabor Stromboli Last
tirolinside.at
281 WALCH music Home Eventgestaltung
6060
Hall in Tirol
WALCH music Aldrans ... Home Salinenmusik Hall Ensembles Videos Bildergalerien Termine Downloads Gästebuch Kontakt
walch-music.at Eventgestaltung Event Veranstalter Party
282 Dr. Christian und Ursula Knie
6060
Hall in Tirol
Dr. Christian Zangl Facharzt für Orthopädie und orthopädische Chirurgie Schwerpunkt: Arthroskopie minimalinvasive
sportho.at Knie Hüfte Knieprothese Hüftprothese
283 . : S T
6060
Hall in Tirol

steiner-unternehmensentwicklung.at
284 UnternehmensberatungHall Startseite
6060
Hall in Tirol
... Willkommen bei der Unternehmensberatung-Hall Unternehmensberatung-Hall steht für qualifizierte
unternehmensberatung-hall.at
285 Event Catering Partyservice Menüservice Mohr KG Menüservice
6060
Hall in Tirol
Express Event Catering Partyservice in Innsbruck in Tirol. Wir bieten Catering für Events ... Partyservice Essen Online Bestellen Kontakt Menüservice Mohr KG Schopperweg A- Hall in Tirol +
msmohr.at Menüservice Mohr
286 Mag. Monika Planer
6060
Hall in Tirol
... Mag. MONIKAÂ PLANERÂ Lendgasse a Hall in Tirol officemonikaplaner + (
monikaplaner.at
287 Home mtb
6060
Hall in Tirol
mtb
mountainbike-innsbruck.at Mtb
288 ISUZU
6060
Hall in Tirol
... Auto Hollaus Burgfrieden Hall in Tirol Willkommen ISUZU D-Max SingleCab
n-serie.at
289 AAB Hall in Tirol
6060
Hall in Tirol
... Suchbegriff Startseite Inhalt Kontakt Datenschutz Druckansicht AAB-Info AAB-Info (Hall
aab-hall.at
290 Home MultipleVoices Hall
6060
Hall in Tirol
... Vorstand Unser Repertoire Unsere Förderer Kontakt Kalender Anfrage Home Chor Multiple Voices Hall in Tirol
mv-hall.at
291 Home MTP - Medizin Technik Planungs GmbH MTP
6060
Hall in Tirol
MTP Medizintechnik Planungs GmbH Planung und Beratung für Einrichtungen des Gesundheitswesens
mtpgmbh.at MTP MTPGmbH Mtpgmbh Mtp Medizintechnikplanung Medizin Medizintechnik Planung
292 Münze Home Hall.AG
6060
Hall in Tirol
Hall.AG ... A A A Webcam Falken Toursimusverband Hall-Wattens facebook Media Presse Münze Hall AG
muenze-hall.at Hall.AG
293 Huber Schaltanlagen Startseite Huber Schaltanlagen Ges.m.b.H. & Co KG
6060
Hall in Tirol
... von Schaltanlagen. Huber Schaltanlagen Ges.m.b.H Co. KG Kugelanger Hall in Tirol Österreich Telefon +
huber-schaltanlagen.at
294 Startseite Pfarrkirche St.
6060
Hall in Tirol
Sanierung Pfarrkirche St. Nikolaus Hall in Tirol. ... Navigation überspringen Homestartseite Kulturgutherzstück-geschichte-hall in tirol
kulturgut-hall.at
295 Kultur ist unsere Natur
6060
Hall in Tirol
... im Riesen? in den Swarovski Kristallwelten. >> mehr Sprachsalz Hall Bei den Internationalen
kulturtirol.at
296 Herzlich willkommen ? Immoblienpickerl
6060
Hall in Tirol

immobilien-inspektor.at
297 Arbeits und Organisationspsychologie
6060
Hall in Tirol
Arbeitspsychologie BurnoutPrävention Stressbewältigung Kommunikation Kurse Trainings und Coachings für Firmen ... .-Prof. Bernhard Güntert Leiter Institut für Management und Ökonomie im Gesundheitswesen der UMIT Hall
juliagheri.at
298 KISStroyer Österreichs heißeste
6060
Hall in Tirol
KISStroyer! Die Adresse wenn es um die beste Kiss Coverband aus Tirol in Österreich
kisstroyer.at
299 PizzaKebapBurger Restaurant il
6060
Hall in Tirol
... Kunden Aktuelles Kontakt Online-Bestellung Restaurant il Mondo Hall in Tirol Besuchen Sie uns in unserem
restaurant-ilmondo.at
300 EDV Stognief EDV
6060
Hall in Tirol
Stefan Stognief Hall in Tirol ... -Dienstleistungen Galgenfeldstraße Hall in Tirol Austria Kontakt Rufen Sie einfach an unter +
stognief.at EDV IT Service Computer
301 Barrierefreie Kommunikation und barrierearme Text- und Kommunikationsagentur GmbH
6060
Hall in Tirol
b'kom steht für barrierefreie Kommunikation und hilft Ihnen bei der barrierefreien und barrierearmen Aufbereitung Ihrer
barrierefreie-kommunikation.at
302 Beside me Zuchtstätte Beside
6060
- Hall in Tirol
Hundezucht Labrador Züchter Retriever
beside-me.at Beside Me Hall In Tirol Zuchtstätte
303 Psychologin Coaching
6060
Hall in Tirol
Wohlbefinden Glück Zufriedenheit Erfolg Selbstvertrauen und emotionale Balance sind Ziel meiner ... in Hall in Tirol MAG. JULIA GHERI Klinische und Gesundheitspsychologin Arbeitspsychologin Mentalcoach info
entspannterleben.at
304 Die Sprachdienstleister : Übersetzung
6060
Hall in Tirol

die-sprachdienstleister.at
305 Bellness Oase
6060
Hall in Tirol
Home/ Sie suchen einen Hundesalon Katzensalon bzw. Hundefriseur in Tirol? Innsbruck Schwaz ... und sich nicht auf einer einmaligen Ausbildung ausruht? Dann sind Sie in Hall in Tirol richtig! Informieren Sie sich auf folgenden
bellness-oase.at
306 B.R. Logistik | Transport B.R. Logistik International GmbH Hall
6060
Hall in Tirol
Wenn Sie ein zuverlässiges Logistikunternehmen suchen wenden Sie sich an B.R. Logistik. Das Team ... auch Sie auf B.R. Logistik mit Sitz in Hall in Tirol. Aufgrund unserer langjährigen Erfahrung in Bereichen
brlogistik.at Hall In Tirol 6060
307 Willkommen bei Dialogo Logopädie
6060
Hall in Tirol
Praxis für Logopädie und Lektorat in Hall in Tirol. Das Therapieangebot umfasst alle Störungsbilder. ... Schinderegg Hall in Tirol Telefon + infodialogo Dialogo
dialogo.at Logopädie Innsbruck Hall Wattens
308 Home Permanent
6060
Hall in Tirol
Permanent Make up Microblading Visagistik Ich habe mich als Permanent Stylistin/Visagistin weitergebildet
elras.at Permanent Make Up Microbladin Visagist
309 Die Sprachdienstleister : Übersetzung
6060
Hall in Tirol

diesprachdienstleister.at
310 Home Duftatelier
6060
Hall in Tirol
... View the embedded image gallery online at http//www.duft-atelier/#sigProIdccee
duft-atelier.at
311 Fischschmied'n fischschmiedn
4540
Pfarrkirchen bei Bad Hall
Neben dem Verkauf von vielen Fischarten bieten wir Ihnen genauso Hilfe und Informationen Rund um
fischschmiedn.at Fischschmiedn Besatzfische Fische
312 Willkommen
6060
Hall in Tirol
... . Aktuelles Ihre Kinderzahnärztin in Hall in Tirol Dr. med. dent. Brigitte Brückner Zahnärztin für Kinder
zahnkind.at
313 VocHall Kolpingchor homepage
6060
Hall in Tirol
homepage dokument webpage page web netz ... aus Hall in Tirol ! Der Kolpingchor Hall entstand im Jahre die Chorleitung und die Zusammensetzung
vochall.at Homepage Vochall Chor Chor Aus Hall
314 TAXI Hall in Tirol
6060
Hall in Tirol
... Fuhrpark Region Hall-Wattens Partner Kontakt Taxi Hall in Tirol - Robert Rohregger Ihr Taxi
taxi-hall.at
315 Citynet Home Stadtwerke Hall in Tirol GmbH Internet
6060
Hall in Tirol
Internet Tirol Citynet Telefonie virtuelle Server Homepage Domain Tyrol Fernsehen Regional lokal schnell flexibel ... A A A Privat Business Kundenportal Webmail Media Presse Downloads Citynet Hall AG
citynet.at Internet Tirol Citynet Telefonie Virtuelle Server Homepage Domain
316 Canal Co. Aktuell CANAL & Co. KG
6060
Hall in Tirol
Canal Co. Alles für den Bau. Der Tiroler BauwarenProfi mit Baufachmärkten in Hall ... Baugewerbe gerecht werden. Unsere Baumärkte in Hall in Tirol und Pfaffenhofen runden das Angebot für unsere
canal.co.at
317 Mode von Feucht  Mode von Mode von Feucht GmbH
6060
Hall in Tirol
... Zentrale Schergentorgasse · A- Hall in Tirol Telefon + +
feucht.co.at
318 Immobilien Tirol Wohnanlage Immo-Bau Vermietungs und Verpachtungs GmbH
6068
Mils bei Hall in Tirol
... - Wir machen Menschen glücklich! Willkommen beim Immobilien-Spezialisten Immobau GmbH in Mils bei Hall in Tirol nähe
immobau-mils.at
319 Dr.med.univ. Klemens Trojer ::: klemens
6060
Hall i. Tirol - Austria
Praxis fuer Psychiatrie
psychiater-trojer.at Klemens Trojer Praxis Psychiatrie Gesundheit
320 AS Electronicdesign Ing. AS Electronicdesign ? Ing. Andreas Schinner e.U.
6060
Hall in Tirol - Austria

electronicdesign.at
321 Plus Kassenservice GmbH Plus Kassenservice GmbH
6068
Mils bei Hall in Tirol

kassenservice.at
StadtBranche.at Orts-Portrait von Hall in Steiermark Österreich. Die Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Hall erhält 3 StadtBranche.at Punkte - Bewertet wird die Anzahl der Besucher dieser Themenseite. - Stand: + Kontakt

Hall
Steiermark ▪ 8911

Hall steht für:

OrtPLZ
Admont8911
Aigen8911
Gstatterboden8913
Johnsbach8912
Krumau8911
Weng bei Admont8911