optional Stadt:
Österreich › Ort ›

› › Schweiz › 14199 Erfahrungen


Kostenlos: Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 Hypnose-Therapie Gesundheit Pschologie ch
Nutzen der Therapie: Sie lösen ihre Ängste, Phobien und Blockaden auf Sie steigern ihr Selbstvertrauen und maximieren ihren Selbstwert Sie werden Rauchfrei oder...
2 Motomi GmbH | Gebrauchtwagenbörse Gebrauchtwagenhandel at
Klagenfurt am Wörthersee
Gebrauchtwagenbörse für Händler und private Verkäufer. Bis zu 2 Fahrzeuge gratis inserieren. Autobörse für Gebrauchtwagen, Jahreswagen und Vorführwagen der Marken...
gebrauchtwagen-neuwagen.at Volkswagen Vw Golf Vii Variant Gebrauchtwagen Kärnten Auto Händler Leasing Kaufen Börse Passat Autos Ford Skiurlaub
3 Oliver Kania HKDO Heilpraktiker Tcm Traditionelle ch
An dieser Stelle geben wir Ihnen einen kleinen Einblick über uns. Der Heilpraktiker für Akupunktur in Bremen ist Oliver Kania....
akupunktur-heilpraktiker-bremen.de Erfahren Heilpraktiker Akupunktur Praxis Hkdo Bremen Oliver Bremende Kania Institut Fortbildung Zurück Japanische Hautprobleme Akupunkturklinik
4 schulsachen24 Schulsachen at

Größter Onlineshop für Schulsachen! Wir sind Österreichs größter Onlineshop für Schulsachen und bieten immer wieder tolle Aktionen an. Bei uns finden...
schulsachen24.at Warenkorb Bl St Jolly Format Ursus Heft Fx Connect Details Bleistift Blau Pelikan Liniert Formati Pp
5 Wirtner Elektrotechnik Alarmanlagen at
Mein Einzelunternehmen bietet folgende Leistungen an: Elektroinstallationen aller Art, Alarm&Videoanlagen, Erdung und Blitzschutz, Überprüfung von Elektroanlagen Sicherheitsprotokoll, Netzwerkverkabelung, SAT-Anlagen, Störungsbehebung, Photovoltaikanalgen...
elektro-wirtner.at Z Y
6 Dein Job in Australien Work And ch
St. Gallen
Wir bringen Dich nach Australien! Im Rahmen des Kookaburra Projekts organisieren wir Auslandaufenthalte für Handwerker und Bauarbeiter aus der Schweiz...
kookaburraaustralia.ch Australien Kookaburra Leben Australia Projekt Handwerker Dein Dich Abenteuer Deine Beratung Angebot Bauarbeiter Gratis Deutschland Deinem Unserem Grundkenntnisse Jobs Damit
7 Praxis für Physiotherapie Tanztherapie Gesundheit Physiotherapie at
Als Wahltherapeutin umfassen meine Kernbereiche in der Physiotherapie die Orthopädie, Traumatologie, Gynäkologie, Psychosomatik und Teilaspekte der Neurologie. Ich biete sowohl...
therapiebewegt.at Physiotherapie Praxis Pilates Tanztherapie Mich Kurse Therapie Kosten Power Freue Ich Therapieinhalt Housetanzspezifische Individuellen
8 praxisROSENBERG Dental Shop ch
Dentoshop.ch ist der Onlineshop für Mundhygieneprodukte. Fachgerechte Produkte zur Mundhygiene, Dentalbeauty oder für die medizinische Anwendung, aber auch herkömmliche Zahnbürsten...
dentoshop.ch Bleaching Zahnbürsten Zahnpasta Curaprox Kinder Vegan Mundhygiene Mundgeruch Whitening Cps Zungenreiniger Mundtrockenheit Kasse Mein Sonicare Smilepen Opalescence
9 Blumen Frisch | Meisterbetrieb Blumen Blumenladen ch
Urdorf Zürich
Blumen aus Meisterhand in Urdorf. Spezialisiert auf floristische Gestaltungen, Trauer-, Hochzeits- & Eventfloristik, Dekorationen von Büros, etc. Bei uns findet...
10 Blumen Frisch | Meisterbetrieb Blumen und ch
Blumen aus Meisterhand in Urdorf. Spezialisiert auf floristische Gestaltungen, Trauer-, Hochzeits- & Eventfloristik, Dekorationen von Büros, etc. Bei uns findet...
blumenfrisch.ch Z Y
11 Bengalito - Bengal Hobbyzucht Katzen ch

Bengalito - Bengal Hobbyzucht Charcoal, Goldbengal, Silberbengal...
bengalito.ch Bengalito Hobbyzucht Bengal Partner Katzen Charcoal Uns Silberbengalkitten Homegoldbengal Abgabeinfos
12 Bildwurf Kinowerbung Kinowerbung ch
Produktion und Schaltung von Kinowerbung in der Schweiz; mit Referenzen aus dem Gestalter_innen-Netzwerk, Preislisten, sowie Übersicht über potentielle Studio- und...
bildwurf.ch Z Y
13 Bildwurf Kinowerbung Kinowerbung ch
Produktion und Schaltung von Kinowerbung in der Schweiz; mit Referenzen aus dem Gestalter_innen-Netzwerk, Preislisten, sowie Übersicht über potentielle Studio- und...
14 Bildwurf Kinowerbung Kinowerbung ch
Produktion und Schaltung von Kinowerbung in der Schweiz; mit Referenzen aus dem Gestalter_innen-Netzwerk, Preislisten, sowie Übersicht über potentielle Studio- und...
15 Bildwurf Kinowerbung Kinowerbung ch
Produktion und Schaltung von Kinowerbung in der Schweiz; mit Referenzen aus dem Gestalter_innen-Netzwerk, Preislisten, sowie Übersicht über potentielle Studio- und...
16 Bildwurf Kinowerbung Kinowerbung ch
Produktion und Schaltung von Kinowerbung in der Schweiz; mit Referenzen aus dem Gestalter_innen-Netzwerk, Preislisten, sowie Übersicht über potentielle Studio- und...
17 Bildwurf Kinowerbung Kinowerbung ch
Produktion und Schaltung von Kinowerbung in der Schweiz; mit Referenzen aus dem Gestalter_innen-Netzwerk, Preislisten, sowie Übersicht über potentielle Studio- und...
18 Bildwurf Kinowerbung Kinowerbung ch
Produktion und Schaltung von Kinowerbung in der Schweiz; mit Referenzen aus dem Gestalter_innen-Netzwerk, Preislisten, sowie Übersicht über potentielle Studio- und...
19 Chinesische TCM Ernährungsberatung Chinesische TCM Ernährungsberatung Gesundheitsvorsorge at
TCM Ernährungsberatung ist nicht nur Ernährungsberatung, sondern beinhaltet eine Vielzahl an anderen Empfehlungen und ist daher die beste Gesundheitsvorsorge. Speziell von...
20 Herzenskinder Caterina Mayer Kinderbetreuung Kinderanimation at
Wir bieten Kinderbetreuung und Kinderanimation für Hochzeiten und Veranstaltungen aller Art. Auch einzeln buchbar für z.B. Messe, Kindergeburtstag, Events ist...
caterina-mayer.com/ Hochzeit Veranstaltungen Kinderbetreuung Private Besucht Firmenfeier Mayer Geburtstage Caterina Uns Kinderschminken Herzenskinder Abenteuer Spezialisiert Land Veranstaltung Taxenbach Unternehmen
21 W. Blaser AG Medizialmobiliar Sicht- ch
BlaserVisio und BlaserChair sind die einfachen und cleveren Systemlösungen der W. Blaser AG. Die W. Blaser AG ist ein vielseitiges...
wblaserag.ch Blaser + Ag Spiegelsysteme Chair Visio Uns Systems Vielseitig Kontaktformular Ihr Permanently The Holen Spiegel Port
22 SMBS University of Salzburg Ausbildung at
Die SMBS University of Salzburg Business School in Salzburg, Österreich, ist spezialisiert auf postgraduale Lehrgänge und bietet als international renommierte...
23 SMBS University of Salzburg Ausbildung at
Die SMBS University of Salzburg Business School in Salzburg, Österreich, ist spezialisiert auf postgraduale Lehrgänge und bietet als international renommierte...
24 Praxis für Physiotherapie Tanztherapie Physiotherapie Gesundheit at
Als Wahltherapeutin umfassen meine Kernbereiche in der Physiotherapie die Orthopädie, Traumatologie, Gynäkologie, Psychosomatik und Teilaspekte der Neurologie. Ich biete sowohl...
therapiebewegt.at Pilates Physiotherapie Praxis Mich Tanztherapie Kosten Therapie Kurse Freue Barbara_baumann Betreuen Behandeln Ihrem Anliegen Therapieinhalt
25 Kundenstopper-Discount.ch Werbung ch
Kunden wollen informiert werden. Mit unseren Tafeln haben Sie die Möglichkeit das Interesse potentieller Kunden an Ihren Produkten zu wecken...
kundenstopper-discount.ch Kundenstopper Kreidetafeln Tischschilder Discountch Now Aufsteller Shop Infoständer Massgeschneidert Holz Schaukästen Individuell Artikel Wandtafeln Wertsteuer Werbung
26 Oliver Kania TCM Nord Tcm Traditionelle ch
Wir heißen Sie willkommen. Vordergründig freuen wir uns, dass Sie den Weg zu uns gefunden haben. TCM Nord...
tcm-nord.de Erfahren Institut Tcm Medizin Traditionelle Bremerhaven Nord Bremen Akupunktur Chinesische Shou Toyohari Fortbildung Rare Nordde
27 Tetra Tech Veranstaltungstechnik AG Veranstaltungstechnik ch
Tetra Tech Veranstaltungstechnik AG ist ihr Spezialist in der Schweiz oder im Ausland für Beschallungs-, Beleuchtungs- und Präsentationstechnik. Wir bieten...
28 Direkt Kommunikation Lebens-und Sozialberatung at
Ehrliche, humorvolle und authentische Kommunikation, Beratung, Mediation von und mit Anna Maria Michenthaler aus Villach...
lebensberatung-kaernten.com Anna Michenthaler Mariay
29 BSWW Unternehmensberatung Handwerker Berater Handwerker ch
Die Unternehmensberatung Handwerker in Deutschland bietet Ihnen eine detaillierte Beratung auf dem Sektor des Handwerks. Infolge unserer Sachkompetenz im Bereich...
unternehmensberatung-handwerker.de Beratung Handwerk Unternehmensberatung Handwerker Erfahren Unternehmen Krisenmanagement Verkauf Insolvenz Marketing Deutschland Kaufmännische Belange Markt Allen Gebiet Qualität *
30 Geht Ihr Partner fremd Detektiv Detektei ch
Ihr Lebenspartner kommt öfter spät von der Arbeit nach Hause, mit der Begründung, dass er viel zu tun habe und...
basiliskdetektei.ch/untreue_fremdgehen_verhaltnis_nachweisen.html Untreue Detektei Fremdgehen Privatdetektive Nachweisen Detektiv Basilisk Ehebetrug Zurück Ehebruch Tätigkeiten Firmen Anzeichen Seiteninhalt Verhältnis Gemeinden Zeitz Affäredurch Abklärung
31 bieten Darlehen zwischen bestimmten Darlehen at
Kreditangebot für Firmen, Unternehmen und jeder Person von gutem Charakter kann seine Verpflichtungen mit einem erschwinglichen Preis von 3% entsprechen....
rue francfort
32 Energie Technik nach Mass Energietechnik at
St. Peter am Ottersbach
Die Energie Technik nach Mass GmbH wurde im Jahr 2001 gegründet und beschäftigt sich seit diesem Zeitpunkt mit dem Vertrieb...
stromerzeuger-online.at/ Stromerzeuger Kva Wartung Zapfwellengeneratoren Stromaggregate Industrie Kaufen Mieten Lichtmasten Vertrieb Containeraggregate Reparatur Ersatzteile Sowie Mobile Steckystem
33 SKOPOS Corporate Architecture Architekt at
SKOPOS Corporate Architecture macht Architektur für Unternehmen. Der Schwerpunkt liegt auf authentischen und funktionalen Lösungen für KMU aus den Branchen: - Consulting -...
skopos.at Skopos Architecture Corporate Revitalisierung Refurbishment Erfahren Transformation | Potentiale Bauen Bestand Philosophie Raum Nutzung Corporatearchitecture Mittel Freie Bedeutet
34 Elektrofeuer Opti-Myst und Ethanol Kamine at
Besuch nur nach telefonischer Terminabsprache möglich (Tel.0891577794 oder 01715203770). Sehr kompetente und ausführliche Beratung in gemütlicher Atmosphäre. Es wurden die neuen Opti-Myst...
opti-myst24.de Kamine Versandkosten Inklusive Deutschland Opti Myst Ethanol Kamin Feuer Raku Alfra Bioalkohol Bio Elektrokamine Kaminofen Virtual
35 abc Sprachen Education ch
ABC-Sprachen steht für Individualität, Flexibilität und beste Lernerfolge. Die ausgebildeten und zertifizierten Fachkräfte unterrichten ausschliesslich in ihrer Muttersprache. Wählen oder...
abcsprachen.ch Halbprivatkurse Privat Sprachkafi Sprachtandem Konversationskurse Gruppenkurse Sprachen Diplomkurse Kurse Lehrkräfte English Abc Englisch Stolz Arbeitsplatz Fordern
36 CoolCab Taxi at
Flughafen Transfers zum Fixpreis, Flughafentaxi Wien, das billigste Taxi, Personenbeförderung im Inland und Ausland...
coolcab.at Flughafen Wien Taxi Flughafentaxi Giesshübl Maria Deutsch Simmering Rudolfsheim Fünfhaus Mistelbach Neulengbach Enzersdorfmaria Raasdorf Margarethensanktpetersattelbachsöldenscharndorfschladmingschlattenschwechatseefeld Treffpunkt Favoriten Individuelle Fahrten
37 Privatschule Firstclass GmbH Education ch
Die Privatschule Firstclass ist eine bilinguale Privatschule. Sie steht für ein hohes Niveau und Integrität, so dass eine familiäre Atmosphäre...
privatschule-firstclass.ch Z Y
38 Tierklinik Neusiedl Tierklinik Neusiedl Tierklinik Tierarzt at
Neusiedl am See
Therapiezentrum für Ganzheitsmedizin Das Hauptaufgabengebiet der Tierklinik NEUSIEDL ist es - gemeinsam mit unseren speziell ausgebildeten Tierärzten - für das Wohl...
tierklinik-neusiedl.at Neusiedl Notfall Tierklinik ärzte Tieres Ihres See Aktuell Gesundheit Leistungen + Team Fragen Vorsorgeuntersuchung Datenschutzerklärung Bildgebende
39 PayrollPlus AG Payroll For ch
Payrollplus ist Spezialist für die moderne Outsourcing Dienstleistung und bietet dem Unternehmen ein attraktives, preisgünstiges Model, zur externen Anstellung ihrer...
payrollplus.ch Payroll Plus Freelancer Ich Mitarbeiter Unternehmen Erfahren Personal Kunden Lohn Wann Offerte Downloads Selbständigkeit Swiss Plus$page Id Companyhire
40 Happy Day Movie Videography ch
Ein professioneller Hochzeitsfilm vom Profifilmer. Happy Day Movie steht für Tage wie diese: Hochzeit, Geburt, Taufe, Jubiläum, Familenfest. Halten Sie...
happy-day-movie.ch Hochzeitsvideo Hochzeitsfilm Happy Min Hochzeitsfilmer Präsenzzeit Dank Movie Film Kirche Petry Ton Paket Vielen Chf Adamus Day Hochzeits App Videoshooting Musikuntermalung Equipment Muss
41 Die Wellness Company Hersteller Von ch
Eine Kosmetikliege von Sabamed, die jedem Anspruch gewachsen ist, bekommen Sie nicht überall....
42 Prim. Dr. Harald Simader Internist Ärzte at
Erweiterte, risikoadaptierte Vorsorgeuntersuchungen mit Ultraschall, EKG, Lungenfunktion, Bestimmung des Knöchel-Arm-Index und der Pulswellengeschwindigkeit inklusive Labor in einer Stunde....
43 Prim. Dr. Harald Simader Internist Ärzte at
Erweiterte, risikoadaptierte Vorsorgeuntersuchungen mit Ultraschall, EKG, Lungenfunktion, Bestimmung des Knöchel-Arm-Index und der Pulswellengeschwindigkeit inklusive Labor in einer Stunde....
44 Professionelle Auswahl an Kartendruckern! Kartendrucker Hardware ch

Als Fachhändler von Elektronikartikeln bietet www.ausweisshop.com breite Auswahl an Kartendruckern wie Plastikkartendrucker oder Chipkartendrucker an. Wir sind Vertragshändler von renommierten...
ausweisshop.com/ausweisshop/index.php/kartendrucker.html Evolis Matica Karten Wunschzettel Warenkorb Artikelnummer Vergleichsliste Versandkosten Lieferbedingungen Serie Primacy Lanyards Expert Avansia Kartendrucker Pvc Vip Bänder Psd Card Tyvek Band
45 Dormis Ferienwohnungen Ferienhäuser at
Wir sind eine dynamische Firma, die das Zusammenwirken zwischen dem Gast und dem Gastgeber erleichtern will, um den gemeinsamen Nutzen...
dormis.com/ Nginx Services Booking Engine Affiliate Other Owners Book How Policy Additional Apartments Listing Companies Program Rentals Platform Cancellation Villas Filter
46 Dormis Ferienwohnungen Ferienhäuser at
Wir sind eine dynamische Firma, die das Zusammenwirken zwischen dem Gast und dem Gastgeber erleichtern will, um den gemeinsamen Nutzen...
dormis.com/ Nginx Services Booking Apartment Book Listing Other Apartments Policy Program Companies Additional Engine Owners Affiliate Filter Welcome
47 Hotel Schloss Leopoldskron Hotel at
Als Schlosshotel am See ist Hotel Schloss Leopoldskron sowohl traumhaftes Luxushotel für Urlaub in Salzburg, als auch außergewöhnliche Eventlocation für...
schloss-leopoldskron.com/ Schloss Salzburg Leopoldskron Hotel Seminare Suiten Veranstaltungen Eventlocation Park Zimmer Events Konferenzen Heiraten Music Feiern Garten Max Traum Partner
48 Wonderwerk Consulting GmbH Consulting at
Die Innovationsberatung Wonderwerk bietet ihren Kunden vielschichtige Beratungsleistungen in den Bereichen Strategie, Service Design, Digitalisierung und Innovation. Vor allem in...
wonderwerk.at ✓ Consulting Wonderwerk Unternehmensberatung Fxixexwxfxrxexkxeax Ok Training Strategieentwicklung Digitalisierung Events Innovation Partner Eugen|
49 GEF Medien AG Hotel And ch
Wellnesshotels auf einen Blick bei wellnesshotels-online.com. Entdecken Sie die schönsten Wellnesshotels in der Schweiz, Deutschland und Österreich. Eine adäquate Beschreibung...
wellnesshotels-online.com Wellnesshotels Wellness Hotels Buchen Wellnesshotel Hotel Onlinecom Wahre Sport Resort Bikehotels Bad Deutschland Erholung Individualisten
50 Sorein-Fabrik GmbH ch
Die Sorein-Fabrik ist spezialisiert auf beruflichen Hautschutz und entwickelt gut wirksame Handreinigungsprodukte, Hautschutzcremes und Hautpflegecremes. Die über 90-jährige Erfahrung...
51 HML Beleuchtung LED Beleuchtung at
St. Gilgen
Handel mit LED Beleuchtung, Umrüstung auf LED Beleuchtung, Stromsparen...
hml-beleuchtung.at Beleuchtung Hml Led Küche Bad Produkte Schlafzimmer Garten Vorraumräume Datenschutzerklärung Büro Pool Spa
52 HML Beleuchtung LED Beleuchtung at
St. Gilgen
Handel mit LED Beleuchtung, Umrüstung auf LED Beleuchtung, Stromsparen...
53 Praxis für Physiotherapie Tanztherapie Gesundheitswesen Therapie at
Herzlich Willkommen! Ich freue mich, Sie als Physiotherapeutin, Tanztherapeutin und Pilates Trainerin in Ihrem individuellen Anliegen zu betreuen und zu...
therapiebewegt.at Physiotherapie Pilates Tanztherapie Tanzspezifische Mich Allgemeines Individuellen Power Therapiegrund Therapiebewegt Kurse Ich Physiotherapeutin Praxistherapieinhalt
54 Praxis für Physiotherapie Tanztherapie Gesundheitswesen Therapie at
Herzlich Willkommen! Ich freue mich, Sie als Physiotherapeutin, Tanztherapeutin und Pilates Trainerin in Ihrem individuellen Anliegen zu betreuen und zu...
55 Edelstein Shop Eva Wimmer Edelsteine at
Bad Fischau
Edelsteine kaufen im Edelstein Shop Eva Wimmer Persönlicher Edelsteinschmuck mit deiner individuellen Edelsteinkombination für Körper und Seele...
56 Edelstein Shop Eva Wimmer Edelsteine at
Bad Fischau
Edelsteine kaufen im Edelstein Shop Eva Wimmer Persönlicher Edelsteinschmuck mit deiner individuellen Edelsteinkombination für Körper und Seele...
57 Hörgeräte Berlin Hörgeräte at
Hornig Hörgeräte Berlin - Besuchen Sie uns und lassen Sie sich professionell beraten....
58 Schmidt Bio logisch Reinigung & ch
ERFOLG DURCH BIOLOGISCHE MASSNAHMEN Mit unserer umweltfreundlichen Handlungsweise in den Bereichen Reinigung, Gartenunterhalt und Gartenbau möchten wir einen Beitrag zu einer...
59 Schmidt Bio logisch Reinigung & ch
ERFOLG DURCH BIOLOGISCHE MASSNAHMEN Mit unserer umweltfreundlichen Handlungsweise in den Bereichen Reinigung, Gartenunterhalt und Gartenbau möchten wir einen Beitrag zu einer...
60 Kavalierhaus Klessheim - Eventlocation Eventlocation at
Die Eventlocation Kavalierhaus Klessheim in Salzburg bietet Veranstaltungsräume und Seminarräume zum Mieten oder Buchen für Veranstaltungen wie Firmenfeiern, Firmenveranstaltungen oder...
61 HEIDEMANN DECORATION Innendekoration und ch
Wir freuen uns, Ihnen nachfolgende Dienstleistungen anbieten zu können: Polsterei Wandverspannung Sicht- und Sonnenschutz Insektenschutz Sicherheits- und Schutzpolster für diverse Anwendungen Reinigungsservice für Gardinen und...
heidemanndecoration.com Innendekorateur Design Polsterei Stoffe Upholsterer Plissee Allgemein Sonnenschutz Upholstery Stuhl Featured Sichtschutz Fabric Aktion = Alter White
62 Diätologie Wien - ernährungsmedizinische Ernährungsberatung at
Diätologie Wien ist eine ernährungsmedizinische Gemeinschaftspraxis, die von vier selbstständigen Diätologinnen als Kooperation gegründet wurde. Wir verfügen über jahrelange klinische...
diaetologie-wien.at/ Wien Ernährung Diät Essen Operationen Erkrankungen Reizdarm Gutachten Adipositas Beratung Mellitus Diabetes Leistungsangebot Preise Krebserkrankungen überblick Diätberatung Ernährungsumstellung
63 Shiatsu Brigitte Gruber Shiatsu-Massage at
Behandlung von Schmerzen im Bewegungsapparat - Gelenke und Wirbelsäule Narbenentstörung Verdauungsprobleme Schlafstörungen Burnout und Erschöpfung Entspannung persönliche Entwicklung...
shiatsu-gruber.at Shiatsu Mitte Zurück Dazu Gutscheine Meridiane Berührt Lebensenergie Energie Leben Praxis Wirkung Preise Geist Copyright Mut Ich Müdigkeit
64 Anwaltskanzlei Wittibschlager Anwälte Erbrecht ch
Anwaltskanzlei Wittibschlager erbringt für nationale und internationale Privatpersonen und Unternehmen die Beratung und Vertretung in allen Bereichen des Erbrechts. Möchten...
anwalt-zuerich.attorney Anwalt Zürich Arbeitsrecht Erbrecht Schweiz Scheidung Familienrecht Zrich Firmengründung Anwaltskanzlei Betreibung Wittibschlager Inkasso Scheidungsrecht Scheidungsanwalt Tel+ Scheidungsgründe Rechtsgebietendes Font
65 SMSup SMS Marketing ch
Contactez vos clients et prospects na jamais été aussi simple! SMSup.ch est un service Suisse 100 % en ligne qui vous...
smsup.ch/ Sms Vos De Marketing Publicitaire | Campagne En Temps % Communication Etreacuteel Contacts
66 SMSup SMS Marketing ch
Contactez vos clients et prospects na jamais été aussi simple! SMSup est un service Suisse 100 % en ligne qui vous...
67 SMSup SMSup SMS Marketing ch
Contactez vos clients et prospects na jamais été aussi simple! SMSup.ch est un service Suisse 100 % en ligne qui vous...
68 SMSup SMS Marketing ch
Contactez vos clients et prospects na jamais été aussi simple! SMSup.ch est un service Suisse 100 % en ligne qui vous...
69 Pilates Sport und ch
Wir haben für dich alle wichtigen Punkte rund um das Thema Pilates auf einer Seite zusammengefasst, damit du schneller deine...
pilates-schweiz.com Pilates Deine übungen Training Studios Reformer Körper Dich Deinen Muskeln Vorteile Dein Flexibilität Bewegungen Falls Schweizcom
70 Gebrauchtwagen Neuwagen Jahreswagen Kärnten Gebrauchtwagenhandel at
Gebrauchtwagen Händler in Kärnten der Steiermark und Österreich suchen. Hier finden Sie Autos, Neuwagen und Jahreswagen sämtlicher Marken und Modelle....
71 Gebrauchtwagen Neuwagen Jahreswagen Kärnten Gebrauchtwagenhandel at
Gebrauchtwagen Händler in Kärnten der Steiermark und Österreich suchen. Hier finden Sie Autos, Neuwagen und Jahreswagen sämtlicher Marken und Modelle....
72 Gebrauchtwagen Neuwagen Jahreswagen Kärnten Gebrauchtwagenhandel at
Gebrauchtwagen Händler in Kärnten der Steiermark und Österreich suchen. Hier finden Sie Autos, Neuwagen und Jahreswagen sämtlicher Marken und Modelle....
73 Gebrauchtwagen Neuwagen Jahreswagen Kärnten Gebrauchtwagenhandel at
Gebrauchtwagen Händler in Kärnten der Steiermark und Österreich suchen. Hier finden Sie Autos, Neuwagen und Jahreswagen sämtlicher Marken und Modelle....
74 Élu Cosmetics - Schönheit Kosmetikstudio In ch
In unserem Kosmetikstudio in Zürich bieten wir sorgfältig ausgewählte und individuelle Behandlungen für Körper, Gesicht, Hände und Füsse. Wir bieten Ihnen...
elu-cosmetics.ch Z Y
75 kita Blumenwiese uster GmbH Kinderkrippe ch
Herzlich willkommen in Kinderkrippe Blumenwiese Uster. Eine familiäre atmosphäre mit Spiele, Spass und Lernen. Liebe Eltern Im September 2017 eröffnet die Kinderkrippe...
kitablumenwiese-uster.ch Uster Blumenwiese Kinderkrippe Kita Kinder Spiele Spass Baby Name Lernen Vorname Plätze Eintrittsdatum Knabe Mädchen Ernährung Homepage Subventionierte
76 Kunstmalerin Kunstmalerin at
Malen auf Leinwand oder Steinen, gestalten von Figuren jeglicher Art, Keine moderne Kunst bei den Ölgemälden, nur Darstellende Kunst...
barbara-gruenberger.at Barbara Judy Hinweis Haustiere Balou Verkauft Grünberger Kuschelbären Steinmalerrei Mylittlehouseandthebiggarden Meiner Manchmalzugast Werdet Euch Besten Puppies
77 Ordination für Ernährungsberatung und Ernährungsberatung Personal at
Individuelle Ernährungsberatung & zielorientiertes Training Als Ernährungswissenschafterin und Personal Fitness Trainerin berate, betreue und unterstütze ich Sie professionell und erfolgreich auf...
ernaehrung-fitness.at/ Fitness Personal Ernährung Training Daten Bitte Funktionen Dritte Ernährungsberatung Innsbruck Richtige Ordination Social Media Schaltflächen
78 Dr. Malgosia Kaminski Augenarzt at
Frau Dr. Kaminski leitet die Augenarztpraxis im 3. Bezirk. Einfühlungsvermögen und Kompetenz werden hier groß geschrieben. Diese Eigenschaften sind in...
augeimdritten.at Wien Augenarzt Malgosia Kind Kaminski Ordination Kontaktlinsen Wartezeit Mail Mutter Pass Augenheilkunde Termin Kurze Schneller Privat Team Ziel Uuntersuchung
79 Psychologische Praxis MMag. Dr. Psychologie at
psychologin-fritzer.at Psychologische Klinische Wien Psychologin Behandlung Kinderwunsch Gutachten Endometriose Angebot Ausbildung Waffenpsychologische Gesundheits Drin Rauschfrei Supervision Anfrage Einsatz Office@psychologin Fritzerat Vorzeitiger Kassentarifsdurch Eierstockkrebs
80 Salon de Coiffure Coiffure ch
Bonjour, je mappelle Concetta, je suis une Coiffeuse Styliste italienne. Les années me ont permis dacquérir des connaissances dans lindustrie...
81 Salon de Coiffure Coiffure ch
Bonjour, je mappelle Concetta, je suis une Coiffeuse Styliste italienne. Les années me ont permis dacquérir des connaissances dans lindustrie...
82 Madame Beauty Institut Kosmetikstudio Kosmetikinstitut ch
Madame Beauty Institut Hauptsache Hautsache Das wunderschön gelegene Kosmetikstudio in Bern an der Aare. Kommen Sie vorbei und geniessen Sie eine individuelle...
83 Tuina-Brugg TCM-Praxis TCM ch
TCM Traditionelle chinesische Medizin manuelle & innere Medizin...
tuina-brugg.ch Tuina Brugg Masseur Simon Feiertags Voranmeldung Pedro Therapeut Gesundheits Tipps Nacken Jul Center Wellness Wildpflanzen Loeliger Aarauerstrasse Praxis Fussmassage Akupunktur Xxeb
84 Shamisen lernen & spielen Japanische Musik ch
Wir sind eine Gruppe die das japanische Instrument Shamisen zusammen lernt und spielt. Wir treffen uns einmal wöchentlich in Winterthur...
openryu.ch Shamisen Openryū | オープン流三味線 Vergangene Lernen Events English Uns Hause Projekt Baummann Wordpresscom Douangmuckda Proudly Page
85 infrarotheizung Handel at
Wir bieten Qualitäts-Infrarotheizungen in verschiedenen Ausführungen und Wattstärken, wenn Sie wollen mit LED Beleuchtung oder mit Ihrem persönlichen Motiv...
infrarotheizung-sommer.at Infrarotheizung Infrarot Finder Smart Led Klima Sommer Rasen Heizung Roboter Motiv Zurück Technik Heimtest Glas Strahler
86 infrarotheizung Handel at
Wir bieten Qualitäts-Infrarotheizungen in verschiedenen Ausführungen und Wattstärken, wenn Sie wollen mit LED Beleuchtung oder mit Ihrem persönlichen Motiv...
87 Uniresidence Alloggi Studenti ch
Residenza con appartamenti arredati e climatizzati a Lugano vicino all Università . Appartamenti per studenti USI e SUPSI , lavoratori...
uniresidence.ch Appartamenti Uniresidence Lugano Studenti Contatto Usi Per Residenza Climatizzaticoppie Procedura Ammobiliati Assigned Punti
88 Kosmetiksalon spezialisiert auf Augenbrauen Kosmetik ch
Bern Schweiz
Das innovativste Kosmetikstudio in Bern. Wir haben uns auf Augenbrauen Behandlungen, wie Augenbrauen zupfen, Augenbrauen färben, Wimpern färben und Haarentfernung...
lovelybrows.ch Augenbrauen Manuel Kundinnen Brow Bern Gesicht Brows Models Entdecken Härchen Happy Gestartet Day Wimpern Gesucht Färben Jobs Copyright Endlich Look
89 Dojo Massagen at
Praxis Marie-Therese Waldl für Narbenentstörung, Massagen und Craniosacral Balancing....
dojo.co.at Craniosacral Narbenentstörung Sha Otho Akupunktmassage Balancing Schröpfen Bionomy Mich Massagen Fortbildungen Gua Sva Penzel Gesundheitshunderter Waldl Meine
90 Urlaub Kaprun Hotel at
Urlaub im Gasthof Eschbacher in Piesendorf an der Sonnenseite von Kaprun und Zell am See...
urlaub-kaprun.at Kaprun Anreise Hotel Piesendorf + Eschbacherat Webcam Zimmergemütlich Hotel@gasthof Lage Köstlichkeiten Ausflugsziele Sommerpauschalen Restauranttraditionelle Urlaubsanfrage Skifahren Impressionen Preise Doppelzimmer Dreibettzimmer
91 vita club Mondsee Fintessstudio at
Der vita club, Salzburgs größtes Fitnesscenter und Fitnessclub mit Standorten in Salzburg und Mondsee bietet Beratung und Coaching für Ihre...
vitaclub.at/ Club Vita Rsaquo Mondsee Salzburg Fitnessclub Training Fitnessstudio Fitnesscenter Fitness Gtgt Spinning Ausdauertraining Yoga Trainer Geräte Permanently The Kurse
92 vita club Salzburg West Fintessstudio at
Der vita club, Salzburgs größtes Fitnesscenter und Fitnessclub mit Standorten in Salzburg und Mondsee bietet Beratung und Coaching für Ihre...
vitaclub.at/ Club Vita Rsaquo Mondsee Salzburg Gtgt Fitnessstudio Training Fitnesscenter Fitnessclub Fitness Ebenso Trainingsplan Beratung Plate Spinning
93 vita club Salzburg Nord Fintessstudio at
Der vita club, Salzburgs größtes Fitnesscenter und Fitnessclub mit Standorten in Salzburg und Mondsee bietet Beratung und Coaching für Ihre...
vitaclub.at/ Club Vita Rsaquo Mondsee Fitness Salzburg Fitnessclub Fitnessstudio Training Fitnesscenter Gtgt Spinning Power Sauna Ebenso Trainingsplan Gesundheitlichen
94 vita club Salzburg Süd Fintessstudio at
Der vita club, Salzburgs größtes Fitnesscenter und Fitnessclub mit Standorten in Salzburg und Mondsee bietet Beratung und Coaching für Ihre...
vitaclub.at/ Club Vita Rsaquo Mondsee Training Fitnessstudio Gtgt Fitness Salzburg Fitnesscenter Fitnessclub Coaching Spinning Yoga Geräte Gesundheitlichen Trainieren Ausdauertraining
95 Dr. Schwabenski - Zahnarzt Zahnarzt ch
Mit einer Erfahrung aus 20 Jahren versorgt Dr. Schwabenski seine Patienten mit medizinisch fundierten Behandlungen. Besonderes Augenmerk gilt bei ihm...
zahnarzt-winterthur.ch Winterthur Zahnmedizin Zahnarzt Schwabenski Praxis Patientinnen Patienten Med Dent Wurzelbehandlung Philosophie Nachher Bleaching Parodontitis Weisheitszähne Terminvergabe Ziel Mittelpunkt
96 Elektro Jonny GmbH Onlineshop ch
Birmensdorf ZH
Ihr Schweizer Onlineshop für: Elektro • Haushalt • Unterhaltung Hochwertige Produkte zu besten Preisen, schnell und unkompliziert, versandkostenfrei bestellen! Wir über uns Elektro Jonny...
elektro-jonny.com Zubehör Produkt Elektro Versandkostenfrei Games Mobile Haushalt Audio Leuchten Kabel Computer Anmelden Design Foto Stecker Blu Ray Febreze Linex Simba Hobbyzonehomematic Canon Sandfree
97 Cystinol Pharmazie ch
Frauen leiden häufig an Blasenentzündungen. Gynäkologen verschreiben in solchen Fällen gerne Antibiotika. Antibiotika wirkt sehr gut gegen Blasenentzündungen aber es...
cystinol.ch Therapiecystinol Produkt Blasenentzündung Cystinol® Blasen Frentzündung De Rsaquo Fachhandel
98 Mobile Zeiterfassung Software Produkte ch
Die mobile Zeiterfassung nach Schweizer Standards Der Papierkram raubt Ihnen als Unternehmer kostbare Zeit für wichtigere Aufgaben? Die App Timeentries nimmt...
99 Exclusive Real Estate Immobilien ch
Exclusive Real Estate, Ihr Immobilienmakler für luxuriöse Villen, Häuser, Eigentumswohnungen und Geschäfts-Immobilien. Unsere Kernkompetenz ist der Verkauf von Wohn- und...
100 Exclusive Real Estate Immobilien ch
Exclusive Real Estate, Ihr Immobilienmakler für Luxuriöse Villen, Häuser, Eigentumswohnungen und Geschäfts Immobilien. Unsere Kernkompetenz ist der Verkauf von Wohn-...
101 Exclusive Real Estate Immobilien ch
Exclusive Real Estate, Ihr Immobilienmakler für Luxuriöse Villen, Häuser, Eigentumswohnungen und Geschäfts Immobilien. Unsere Kernkompetenz ist der Verkauf von Wohn-...
102 Exclusive Real Estate Immobilien ch
Exclusive Real Estate, Ihr Immobilienmakler für Luxuriöse Villen, Häuser, Eigentumswohnungen und Geschäfts Immobilien. Unsere Kernkompetenz ist der Verkauf von Wohn-...
103 Exclusive Real Estate Immobilien ch
Exclusive Real Estate, Ihr Immobilienmakler für Luxuriöse Villen, Häuser, Eigentumswohnungen und Geschäfts Immobilien. Unsere Kernkompetenz ist der Verkauf von Wohn-...
104 Exclusive Real Estate Immobilien ch
Exclusive Real Estate, Ihr Immobilienmakler für Luxuriöse Villen, Häuser, Eigentumswohnungen und Geschäfts Immobilien. Unsere Kernkompetenz ist der Verkauf von Wohn-...
105 Kartenlegen-Engelstrahl Kartenlegen-Engelstrahl Energetiker Astrologie at
Wr. Neustadt
Mediale Wegbegleitung mit Hilfe der Engel Kartengestütztes Hellsehen Workshops/Einzelcoaching in Kartenlegen, Runen, Räuchern Energieschmuck Schmuck-Kartenpartys...
106 Zusatzunterricht im Raum Zwettl Bildung und at
Mathematik, Physik, Softwareentwicklung, Netzwerktechnik, Systemtechnik Für Dich: Langfristig/Kurzfristig, Auffrischung/Notfallmanagement, Zusatzunterricht/Hausübungsbetreuung, Altlastbereinigung/Vorbereitung....
107 World Wide Wheels AG Reise ch
Die World Wide Wheels AG ist ein auf die Vermietung von Wohnmobilen spezialisiertes Reiseunternehmen. Wenn Sie ein Reisemobil im In-...
world-wide-wheels.com Wohnmobil Caravan Camper Mieten Anfordernrichtig Wheels Wide Möchten |world Offerte Vermietung
108 Private Geld Kreditgeber hier Darlehen ch
Postfinanzierung ist eine amerikanische Privatkreditgesellschaft, die seit 1996 in den USA gegründet wurde und Finanzierungslösungen für alle Einzelpersonen, Firmen und...
privát pénz hitelező itt elérhető (nincs előtörlesztés)
109 SWiCAL swiss calibration - Kalibrierung ch
Unser akkreditiertes Kalibrierlabor führt Kalibrierungen für die Messgrössen Druck, Temperatur und relative Feuchte nach der schweizerischen und internationalen Norm ISO/IEC...
swical.ch Messtechnik Ihr Kalibrierung Messgerät Scs Messgeräte Neues Partner Beratenkaufenkalibrierlabor Zertifizierter Swical
110 SWiCAL swiss calibration - Industrie ch
Unser akkreditiertes Kalibrierlabor führt Kalibrierungen für die Messgrössen Druck, Temperatur und relative Feuchte nach der schweizerischen und internationalen Norm ISO/IEC...
swical.ch Messtechnik Kalibrierung Ihr Messgerät Scs Kalibrieren Zertifizierter Swical Neues Beraten Messgerätez Kaufen Gerne
111 PC Doktor für Chur Computerreparatur ch
Schnelle PC Hilfe für Chur, Graubünden und die Deutsche Schweiz. Service vor Ort bei ihnen zu Hause, in der Firma...
foppait.ch Pc Computer Reparatur Problem + Doktor | Support Hilfe Beratung Heim Smartphone Fernservice Churanalyse
112 Caroline Hufnagel Airbrush Expertin Airbrush Design at
carolinehufnagel.com/ Airbrush Herz Bodypainting Caroline Hufnagel Spritzwerkstore Illustrationen Fotoshooting Shoperöffnung Special Effects Workshop Making Graz News Einsteiger Monster Osterhasen Custompainting
113 PromoMasters Online Marketing Wien Suchmaschinenoptimierung at
PromoMasters Wien ist Spezialist für Suchmaschinenmarketing, Suchmaschinenoptimierung SEO, Suchmaschinenwerbung SEA und AdWords sowie Analytics. Die Agentur mit Sitz in Wien...
promomasters.at/ Suchmaschinenoptimierung Promomasters Blog Tipps Media Seo Google Adwords Marketing Social Internet Salzburg Unternehmen Suchmaschinen Schulung Vorträge Tag Besprechungsort Tablets
114 ihr gastromacher Gastronomieberatung ch
Erfolg in der Gastronomie ist nicht auf einen oder zwei entscheidende Faktoren zurück zu führen, sondern ist sehr komplex und...
ihrgastromacher.ch Gastronomieberatung Gastronomie Tun Preise Faktoren Entscheidende Qualitätssicherung Erfolgreich Optimierung Bar Komplex Machen Konzept Cafe Gastronomiedienstleistung Gegenüber Verhindert
115 Nebenjob Heimarbeit ch
Stellen Sie sich vor wie das wäre wenn Sie von zu Hause aus arbeiten könnten? Sie haben freie Zeiteinteilung. Leistungsgerechte...
gesundheitsplattform.ch Therapeuten Firmen Leute Arbeit Aging Qualifikation Schweiz Nahrungsergänzung Gesundheitsplattformch Vfg Gesundheitsplattform Spurenelement Tragen Fit Wellaging Antiaging Y
116 HTK-Vent - Spezialist für Industrieventilatoren at
HTK-Vent ist der Spezialist für Industrieventilatoren der Marke VENTUR in Österreich. Im Sortiment von HTK-Vent finden sich klassische Axial- und...
117 Alpaka Trekking am Berg Trekking ch
Alpaka, Lama und Esel Trekking auf dem Solothurner Jura oder wo immer Sie möchten oder zusammen mit den Alpakas in...
alpaka-am-berg.ch Alpaka Trekking Spass Tieren Herrmann Berg Lama Macht Jura Eseli Balmberg Erlebnis Esel Seit Alpaca Tiere
118 Hubmer³ - Visualisierungen 3D Visualisierung at
Hochwertige 3D Visualisierung, Rendering Graz, Wien, Österreich Architektur und Werbung, High Quality Produktvisualisierung...
119 Hubmer³ - Visualisierungen 3D Visualisierung at
Hochwertige 3D Visualisierung, Rendering Graz, Wien, Österreich Architektur und Werbung, High Quality Produktvisualisierung...
120 Klang-Energetik-Yoga Energetik at
Harmonisierung und feinstoffliche Balance für Körper, Geist und Seele, Aura und Chakren. Chakren sind wichtige Energiezentren im Körper, die...
leben-mit-freude.at Yoga Klang Leben Energetik Mich Freude Veränderung Erleben Ruft Mutseele Freudes Webseite Stressabbau
121 Menschen erfolgreich machen Vortrag und at
Ein selbstbewusster Auftritt minimiert die Angriffsfläche. Unsere Gedanken steuern uns. Wenn wir unsere Gedanken mit Praxisfachwissen kombinieren, dann können wir...
erfolgsakademie-wien.at Menschen Vorträgen Vortrag Machen Seminar Kraft Erfolgreich Zeit Einfach Eindruck Schlüssel Geben Gesammelt Wirkung Datenschutzerklärung
122 Erwin Leimlehner Fotografie Fotografie Hochzeitspanorama at
Hochzeitsfotografie mit 360° Hochzeitspanoramen, die als Bildschirmschoner oder in Web-Seiten eingebunden werden können. Auch virtuelle Touren durch interaktive 360° Panoramen....
leimi01.wixsite.com/leimlehner-foto Bildschirmschoner Hochzeitspanorama Hochzeitspanoramenhochzeitsfotografie Traumhochzeit Erlebnisfotografie Degpanorama Interaktive Deg Panoramenbilder Leimlehner Erwin
123 FAIR&CLEAN Reinigungsservice GmbH Gebäudereinigung at
FAIR & CLEAN Philosophie FAIR & CLEAN ist ein Meisterbetrieb im Bereich Gebäudereinigung. Was aber viel mehr zählt als ein Meistersiegel:...
124 FAIR&CLEAN Reinigungsservice GmbH Gebäudereinigung at
FAIR & CLEAN Philosophie FAIR & CLEAN ist ein Meisterbetrieb im Bereich Gebäudereinigung. Was aber viel mehr zählt als ein Meistersiegel:...
125 Gottstein Alpine Fashion Store Trachten- Freizeit- at
Fachgeschäft für Trachtenbekleidung und alpine Lifestyle Mode angesagter Marken für die ganze Familie....
gottstein.at Gottstein Vergleichsliste Versandkosten Stegmann Hüttenschuhe Species Pichler Mein Tirol Kitz Magicfelt Warenkorb Protection Zzgl Mwst Reine Kürzlich Bundesstrae
126 Gottstein GmbH & Co.KG Textilindustrie at
Fertigung und Vertrieb von hochwertigen Freizeit- und Hüttenschuhen der Marken Magicfelt, Stegmann und Kitz-pichler sowie Erzeugung von Stoffkollektionen (innovative Produkte)...
gottstein.at Gottstein Versandkosten Vergleichsliste Stegmann Species Hüttenschuhe Mwst Tirol Zzgl Kitz Pichler Protection Mein Warenkorb Magicfelt Widerrufsrecht Cookies Gottsteinat Sprache
127 Bestattung Hanser Bestattungsunternehmen at
Wir kümmern uns um alle Belange bezüglich Bestattung, Kremation, Überführung usw....
128 TCM Praxis ROTGOLD-Akupunktur Naturmedizin ch
Wikon / LU
Traditionelle chinesische Medizin / Naturmedizin Akupunktur Phytotherapie Moxibustion Schröpfen Massagen Ernährungstherapie Rejuvenation/Wirkungsvolle Verjüngungs-Akupunktur NOVALENICs Innovative naturmedizinische Galenik KOMPETENT & INDIVIDUELL SEIT 1998...
rotgold.info Akupunktur Gong Schröpfen Qi Tcm Moxibustion Kommunikation Rejuvenation Novalenic Philosophie Portrait Materia Naturmedizin Medica Kooperation Arzneien Verkauf
129 Christina Stürmer und Christoph Musikbranche Privat at

christinaonline.at Christina Stürmer Ticket Kaufen Open Airticket Album Airticketkaufen Menschen Stuermer Tour Deutschland Booking Sängerin Fotos
130 LILALU GmbH - Einzigartige Online-shop ch
Als Familienunternehmen mit Sitz in Aachen hat sich die LILALU GmbH der Gestaltung und Produktion von Quietscheenten und Kuscheltieren verschrieben....
lilalu-shop.com Z Messen Aachen Unternehmen Agb Geschäftskunden Folgen Shop Displays Inhalte Werbeartikel Lilalu
131 Hochzeitsmusik Hochzeitsmusiker Hochzeitsbands Hochzeitsmusiker Künstlerverzeichnis Musiker at
Sie planen eine Hochzeit, eine Party, ein Zeltfest, einen Ball oder eine andere Veranstaltung? Auf EinTollesFest.at finden Sie die passende Bands...
132 Reisen nach Madagaskar Reisen ch

Wir organisieren Ihre Reise nach und in Madagaskar. Wir von der Reiseorganisation PRIORI sind seit 1994 vor Ort in Antananarivo...
madagaskarhaus.ch Madagaskar Reisen – Priori Land Madagaskarhaus Guinea Bissau Myanmar Reiseinformationen Réunion Komoren Basel Strassen
133 Detektivbüro Graz | Richard Detektei at
Wir laden Sie gerne zu einer kostenlosen Erstberatung ein, wo wir alle wichtigen Fakten mit Ihnen abklären und einen möglichen...
detektei-wallner.at | Detektiv Wien Baden Graz Salzburg Geschäftskunden Richard Kontrolle Privatkunden Wallner English Patentrecht Streng Fragen Salzburd Arbeitnehmern Unternehmen
134 Detektivbüro Salzburg | Richard Detektei at
Detektiv Wallner ermittelt diskret, zuverlässig und professionell in jedem österreichischen Bundesland. Wir sind rund um die Uhr für Sie erreichbar...
detektei-wallner.at/ | Detektiv Wien Graz Baden Wallner Privatkunden Salzburg Kontrolle Geschäftskunden Richard Magiur Verbinden Jurist Patentrecht Außendienstes Häufige Apache
135 Detektivbüro Baden bei Wien Detektei at
Was kostet ein Privatdetektiv? Das Erstgespräch in unserer Detektei ist in jedem Fall kostenlos und völlig unverbindlich. Jede Dienstleistung eines...
detektei-wallner.at | Detektiv Wien Baden Graz Wallner Geschäftskunden Privatkunden Richard Kontrolle Salzburg Moved Port Juristische Ehebruch Wettbewerb Verbinden
136 FUMAR.CH Zigarrengeschäft Tabakwaren ch
FUMAR.CH ist ein schweizer Fachgeschäft mit einem grossen Zigarrensortiment. Wir führen in unserem Online-Shop über 1000 verschiedene Zigarren und bieten...
fumar.ch Zigarren Entdecken Cutter Davidoff Pfeifen Aschenbecher Zigarre Zigarillos Partagas Julieta Tabak Feuerzeuge De Humidore Montecristo Herkunft Mexiko Aufbewahren Romeo
137 HÖLZL & HUBNER Gewerbeimmobilien Immobilien at
HÖLZL & HUBNER Immobilien bietet Anlageobjekte, Renditeobjekte sowie Gewerbeimmobilien in Salzburg. Als Gutachter erstellt HÖLZL & HUBNER Immobilienbewertung und Gutachten...
hh-immo.at/ Immobilien Hubner Hölzl Büros Gutachten Gewerbeimmobilien Wohnimmobilien Renditeobjekte Anlageobjekte Salzburg Gewerbe Wohnbaugrundstücke Unternehmen Hotels Geschäftslokale Miete Grundstück Büroräume Gastronomiehotels Objektsuche
138 Helvareinigung Reinigungsfirma ch
Unsere Leistungen in den Bereichen Transport, Reinigung, Entsorgung und Umzügen ist nach hohen Qualitätszielen und Leistungsstandards ausgerichtet. Unsere kundenorientierten Methoden...
helvareinigung.ch Reinigung Transport Entsorgung Umzüge Dienstleistungen Helva Verfahrenermglichen Herzenswunsch Leistungsstandardsausgerichtet Methoden Reinigungsmittelund Qualittszielen Bereichen Einsatz Leistungen Y
139 ch
140 Hypnosetherapie Hypnose Coaching ch
createyourself.ch Coaching Praxis Hypnosetherapie Hypnose Energie Beratung Alten Prozesse Angst Erfolg Wahrnehmung Hypnosetherapie Während Preis Thetafloating” Weiseverändern Beratung Wingwave
141 Psychosoziale Spitex Spitex Ambulante ch
Psychosoziale Spitex -Mehr als nur eine Begleitung Haben Sie gerade einen Klinikaufenthalt hinter sich und möchten nun eine professionelle und kompetente...
psychosoziale-spitex.ch Spitex Betreuung Professionelle Psychosoziale Unterstützung Zuhause Umgang Hause Einzelwohnen Angelina | Nachbetreuung Klinikaufenthalt Begleitetes Ort Alltag Leistungen Toggle Seifert
142 Kaufen Bestellen Schweiz Gesundheit Medizin ch
Günstig versand Apotheke in der Schweiz . Schnell Lieferung und günstig versandkosten . Wir Sind die beste Online Apotheke in...
143 Kaufen Bestellen Schweiz Gesundheit Medizin ch
Günstig versand Apotheke in der Schweiz . Schnell Lieferung und günstig versandkosten . Wir Sind die beste Online Apotheke in...
144 Kaufen Bestellen Schweiz Gesundheit Medizin ch
Günstig versand Apotheke in der Schweiz . Schnell Lieferung und günstig versandkosten . Wir Sind die beste Online Apotheke in...
145 Dampferland E Zigaretten Shop Online Shop ch
Herzlich willkommen bei Dampferland. Wir sind Spezialisten bei E Zigaretten und alles was damit zu tun hat. Unser Angebot umfasst...
dampferland.ch Liquid Akkuträger Aromen Sets Power Zubehör Batterien Verdampfer Selbstwickler Zigaretten Verdampferköpfe Low Fortgeschrittene Vampire Einsteiger Insmoke Vape Hybride
146 mediaformers Webdesign Text Webdesign Text ch
Professionelles Webdesign, Text und Corporate Design - qualitativ hochwertige Lösungen zu transparenten, zahlbaren Preisen. Wir beraten, konzipieren, kreieren und...
mediaformers.ch Text Navigation Webdesign Update Abos Design Corporate Basel News Angebot Webseite Konditionen überspringen Pakete Projekte Mobile Optimiert
147 Wir schützen Ihre Werte Objektsicherheit Datacenter ch
Objektsicherheit plant, baut und betreibt Sicherheitsobjekte für Kunden in der ganzen Schweiz. Wir stehen als Spezialisten für alle Belange...
148 Elektrische Motorkarre Schiebetruhe Schubkarren. Garten at
Motorkarre mit Motor, verschiedene Ausführungen und Zubehör möglich- Schneeschild, Gabel, Schubkarre, Elektrofahrräder, Gartengeräte, Häcksler, Mini Dumper mit Elektroantrieb und mit...
bravoschubkarre.eu Motorkarre Mini Dumper Motorkarren Elektro € Elektrische Zubehör Benzinmotor Elektrofahrräder Komplettpreis Häcksler Ladeschalen Beschreibungen Katalog Download
149 Kinesiologe Bachblütenberater Persönlichkeitsanalyse Gesichter Kinesiologe Gesundheit at
Kinesiologie, Bachblütenberatung, Persönlichkeitsanalyse. Dient zum Stressabbau, Depression, völlige Erschöpfung, Managerkrankheiten, Allergien lösen....
lolawerkstatt.eu Z Meinewebsite Y
150 SV-Weber Sachverständiger Gutachter für Finanzierung Kredit at
SV-Weber Sachverständiger/Gutachter für Finanzierung, Kredit, Darlehen und Investition. Ausführliche Informationen unter, www.weber-gutachter.com...
151 SV-Weber Sachverständiger Gutachter für Finanzierung Kredit at
SV-Weber Sachverständiger/Gutachter für Finanzierung, Kredit, Darlehen und Investition. Ausführliche Informationen unter, www.weber-gutachter.com...
152 SV-Weber Sachverständiger Gutachter für Finanzierung Kredit at
SV-Weber Sachverständiger/Gutachter für Finanzierung, Kredit, Darlehen und Investition. Ausführliche Informationen unter, www.weber-gutachter.com...
153 Reinigung - Umzug - Reinigung ch
Unsere Erfahrung und ein ständig angepasstes Dienstleistungsangebot machen uns stark dafür, wenn es um bedarfsgerechte Lösungen, flexibles Zeitmanagement und kundenorientierte...
silver-reinigung.ch Reinigung Umzug Entsorgung Silver Reinigungsarbeiten Qualität Unternehmen Mengen Schnell Umzüge Kenntnisse Partner Zufriedenheit Galerie Spezialgeräten
154 Minnei Fotografie ch
Hobbyfotografin für Ihre Anlässe oder Tieraufnahmen...
155 Online Kredit Vergleich Schweiz Online Kredite ch
Schachen bei Reute
Mit kompetenter Beratung zum Online Kredit, Informationen und rechtliche Hinweise zum Schweizer Kredit finden sie auf dem Kreditportal. Sicher, Diskret...
kreditvergleich.ch/ Kredit Schweiz Kreditrechner Kreditvergleichch Besten Schnell Finden Kreditvergleich Rechtliche Menu Kosten Bobmoney Kreditrechnermit Migros Berechnet
156 Telefonanlagen und Telefonanschluss Shop Telekommunikation at
Im Shop von Telefonanlagen Lieferant finden sich ISDN & VoIP Telefonanlagen zum Kaufen sowie diverse Telefonanschlüsse, die dort beantragt werden...
telefonanlagen-lieferant.at/ Telefonanlagen Isdn Internet Telefonanschluss Panasonic Voip Telefon Cloud Telefonie Sms Provider Sip Ip Shop Beratung Businesskunden Voice Technologie Beratungs Check__
157 Ahornblick Apartments Apartments Beherbergung at
Lassen Sie sich, verwöhnt vom Sonnenschein und herrlichem Bergpanorama verwöhnt, in unseren 2 neuen Apartments im Zillertal nieder. Unser Haus...
ahornblick.com ✓ Apart Infraroteinzigartiger Quotbergzeitquot Frühlingserwachen Zillertal Bergsommer Wlan Gleich Verleih Superschnelles Lage Herbstrot
158 Neubau und Umbau Ihrer Bauen at
MEDI-CUBE unterstützt die bauliche Realisierung von Arztpraxen und Ordinationen. Egal, ob es sich um kleinere Adaptierungsmaßnahmen, einen umfangreichen Umbau oder...
159 Goldvorsorge Soos Edelmetall Handel at
Das etablierte Handelshaus mit Hauptsitz in Wien versorgt Händler sowie private Investoren und Vermittler aller Kaufstärken. Als offizieller Distributor der...
goldvorsorge.at Silber Gold Kaufen + Barren Münzen Wien Österreich Safelagerung Versand Tafelbarren Großhandel Beratung München Münze Fxcm
160 Studio Wimperntraum Wimpernverlängerungen Kosmetik at
Sie wollen einfach schöne Wimpern , dann ist Ihr Salon Wimpern-Traum in Berlin - Mariendorf Ihr kompetenter Experte...
wimpernverlaengerungen-berlin.de/ Wimpern Berlin Wimpernverlängerung Studio Wimpernwelle Schöne Lash Eyelash Einfach Wimpernverdichtung Technik Tempelhof Extensions Natur Auswahl Geschlossen
161 be active tours - Tourismus at
be active tours ist eine Reiseagentur für Aktivreisen, Abenteuerurlaub und Sportaktivitäten. Das Angebot richtet sich an alle, bei denen aktives...
162 Boilerkings Boiler ch
Warmwasser? Ja gerne!...
boilerkings.ch Boiler Warmwasser Kings Warmwasseranlagen Tobelacher Baden Rütihof Internetauftritt Steffen Rtihof Neuenja Demnchst
163 Bauerndörfl Rindereben - Ferien Tourismus at
Wer seinen Urlaub inmitten der traumhaften Naturkulisse des Nationalpark Hohe Tauern verbringen möchte, liegt mit dem Bauerndörfl Rindereben genau richtig....
rindereben.at/ Bauerndörfl Open Rindereben Hüttschlag Grossarltal Gallery Personen Feriendorf Bauernhof Berg Bauernhaus Angebote Großarltal Lage Ferienwohnung Gesund Advent Bio Blockhaus
164 Nature Adventure - Canyoning Outdoorsport at
Wir bieten geführte Outdoorsporttouren an und haben uns auf Canyoning, Rafting und Mountainbike spezialisiert. Zu Hause im Tiroler Lechtal, einer...
nature-adventure.at Canyoning Rafting Nature Adventure Lechtal Lech Programm Neuigkeiten Specials Tirol Galerie Bike Video Touren Mountain
165 LED Werkstatt GmbH LED Werkstatt GmbH Leuchtreklamen und ch
Schweizer Hersteller von LED Leuchtreklamen und Recyclingstationen für den Innen und Aussenraum. Als KMU leben wir den Fokus auf nachhaltige Produkte...
ledwerkstatt.ch Led Wertstoffbehälter Zubehör Recyclingstation Recyclingstationen Leuchtreklamen Shop Abfalltrennung Leuchtreklame Recycling Ag Ersatzteile Esocket Küchenrückwand Leuchtkasten Steckdosensäulen Tuben Platzhirsch
166 LED Werkstatt GmbH LED Werkstatt GmbH Leuchtreklamen und ch
Schweizer Hersteller von LED Leuchtreklamen und Recyclingstationen für den Innen und Aussenraum. Als KMU leben wir den Fokus auf nachhaltige Produkte...
167 Eimer Kanister und IML Kunststofferzeugung at

Das Unternehmen Wolf Plastics wurde im Jahr 1973 gegründet. Das Spezialgebiet von Wolf Plastics ist die Erstellung von Eimern und...
wolfplastics.eu/de/ Eimer Kanister Wolf Produkte Plastics Qualität Zertifizierungen Iml Ungarn Liefermöglichkeiten Verpackungskanister Ovaleimer Dekoration Magyar Deckel Verschlüsse Kunden Höhe Successfully
168 DESIGN & FOTO cornelefant Grafikdesignerin & at
Fotografin für Business- und Eventfotografie und entwickle als Grafikdesignerin Corporate Designs (Logo-, Drucksorten-, Website- und Werbematerialgestaltung), sowie Illustrationen und Mockups...
cornelefant.at Design Center Fotografie Photo Booth Galerie Grafikdesign Mich Tox[ %] Speed {delaywait Easepowereaseinout} Paddingtop=[ Maskxpxypxsinheriteinherit Too Designzrxdegryrzsxsyskxsky Retusche Corporate
169 Restaurant Nektar Restaurant ch
St Gallen
Persönlich-Gemütlich-Klein Ein paar Worte, die uns beschreiben sollen....
170 Steirerland Alpakas Online Handel at
Steirerland Alpakas - Der Onlineshop für Alpaka Mode und Alpaka Wolle. Alpaka Wolle und Baby Alpaka Wolle ist purer Luxus für...
171 Steirerland Alpakas Online Handel at
Steirerland Alpakas - Der Onlineshop für Alpaka Mode und Alpaka Wolle. Alpaka Wolle und Baby Alpaka Wolle ist purer Luxus für...
172 SineWave GmbH Software Engineering ch
SineWave GmbH - Ihr Experte in Matlab und Simulink Die SineWave GmbH hat sich auf Software Engineering und Consulting für technische...
sinewave.ch Simulink Sinewave Engineering Software Control Matlabsimulink Matlab Programmierung Code Plattform Erfahrung Modells Erstellen Consulting Experte Modellen Schnittstellen
173 Sandra Wolkerstorfer - Psychotherapeutin Psychotherapie Linz at
Psychotherapeutin in Linz, Kinder- und Jugendpsychotherapie...
therapie-beratung.at Webseite … Archiv Wolkerstorfer Psychotherapeutische Praxis Psychotherapeutin Sandra Linz Ba Leistungen Beratung überspringen Erziehungsberatungpsychotherapie
174 Familien- und Vitalhotel Auenhof Hotel at
Herrlich ruhig und grün gelegen, bietet Ihnen unser Hotel Auenhof alle Möglichkeiten für einen traumhaften Familienurlaub im Stubaital in Tirol....
auenhof.at + Anreise Familien Vitalhotel Auenhof En Hotel@auenhofat Tiroler Geniessen Apache Auenhof****hotel Relax Wertvollsten
175 Jurist und Detektiv | Detektei at
Alle unsere Detektive in Wien und anderen Städten sind die besten Spezialisten in den Bereichen der Informationsgewinnung, der Ermittlung über...
detektei-wallner.at/ | Detektiv Wien Graz Baden Privatkunden Wallner Richard Salzburg Kontrolle Geschäftskunden Fragen Patentrecht Sicherheit Juristische
176 Ratgeber Finanzierung Finanzberatung at

Schlau finanziert – Das sind die österreichischen Experten der Immobilienfinanzierung. Kunden können Ihr individuelles Angebot von über 30 Banken und Bausparkassen...
schlau-finanziert.at/ Miete Beratung [] Vereinbaren Immobilienfinanzierung Finanzierungsanfrage Kreditrate Schlau Budgetrechner Kreditumschuldung Berechnen Kreditrechner Eigentum Vergleichen Absichern Heute Finanzierungsgespräch
177 Salzburg Convention Bureau Eventveranstalter at
Venues und Locations für Events und Incentives in Salzburg. Das Salzburg Convention Bureau unterstützt bei Veranstaltungen wie Kongresse und Tagungen...
178 Salzburg Convention Bureau Eventveranstalter at
Venues und Locations für Events und Incentives in Salzburg. Das Salzburg Convention Bureau unterstützt bei Veranstaltungen wie Kongresse und Tagungen...
179 Salzburg Convention Bureau Eventveranstalter at
Venues und Locations für Events und Incentives in Salzburg. Das Salzburg Convention Bureau unterstützt bei Veranstaltungen wie Kongresse und Tagungen...
180 M & T Boutique Motorrad&Töffbekleidung ch
Motorradbekleidung, Toeffbekleidung, Motorrad-lederkombi , Motorradhelme, Motorradstiefel, Motorrad-jacken , Lederjacken, Lederhosen, Motorradhosen, Motorrad, Lederreparaturen, Lederreparieren, Leder, Lederwesten, Ledergilet, Lederweston, Motorrad-Helmen, Motorradhandschuhe...
motorrad-toeffbekleidung.ch Motorrad Töffbekleidung Saisonstart Motorradhelme Formen Gore Shop Vorbei Rabatt Grössen Jimdo Herren Grosse Youtube Linkedin
181 M & T Boutique Motorrad&Töffbekleidung ch
Motorradbekleidung, Toeffbekleidung, Motorrad-lederkombi , Motorradhelme, Motorradstiefel, Motorrad-jacken , Lederjacken, Lederhosen, Motorradhosen, Motorrad, Lederreparaturen, Lederreparieren, Leder, Lederwesten, Ledergilet, Lederweston, Motorrad-Helmen, Motorradhandschuhe...
motorrad-toeffbekleidung.ch Motorrad Töffbekleidung Saisonstart Motorradhelme Leder Shop Zürich Plus Kommen Templates Youtube Formen Materialien Rabatt Linkedin
182 Dipl. Hypnosetherapeutin OMNI NGH Hypnosetherapie ch
Hypnosetherapie bei Stress, Gewichtsreduktion, Allergien, Ängsten, Chronischen Schmerzen, Sportlichen oder Beruflichen Zielsetzungen uvm. Ein starkes und glückliches Leben durch: MENTALE / EMOTIONALE...
hypnosetherapie-ld.ch Hypnose Stress Abnehmen Allergien Hypnosesitzung Schmerzen Diriwchter Hypnosetherapie Luzia Hypnosetherapeutin Bulimie Unterbewusstsein Praxis Themen Unruhe Patienten Essen Termin Finden Hilfe
183 Unbeschwert die Ferien oder Tierbetreuung ch
Gerne werden wir uns bei Ihnen zu Hause um Ihr Haustier kümmern, damit Sie beruhigt Ihre freien Tage geniessen können. sorglosferien.ch...
sorglosferien.ch Rss Email Ferien Team Etwas Info@sorglosferiench Kontaktieren Unverbindlich Angebotefür Jeden Sorglosdabei Aadorf Hegland
184 Willkommen auf der Tigereye-mine.com Mineralien & at
Das Tigerauge gehört zu einem begehrten Schmuckstein, hat sich im Laufe der Jahre zu einem bei Esoterikern und Mineralienfans gleichermaßen...
tigereye-mine.com Tigers Mine Grades Order Mining Eye Also Avenue Florida Wholesale Order@tigereye Inc Minecomstates
185 Die fasziniernde Welt des Mineralien & at
In Osteuropa, im südlichen Kaukasus befindet sich die bisher einzigen, bedeutenden Vorkommen dieser Obsidian-Varietät. Auch andere Obsidian-Arten sind dort gefunden...
lamellenobsidian.com Lamellenobsidian Obsidian Heilstein Lamellen Form Obsidians Lace Midnight Gutachten Kristalle Gestein Anteile Besonderheit Bildergalerie Stck Hinsicht Bann
186 Massagen Lomi und Klassisch Massage ch
Krankenkassenanerkannt med. Massagen. Weitere Angebote: Lomi Lomi Hawaiian, Lymphdrainage, Hot stone, Wellnessmassagen, warme Oelmassagen, Fussreflexzonen. Coaching & Ernährungsberatung bei Stress, chronischer...
kahuna-lumi.ch Foundfound Not Error Meditation Xid Guru Z
187 IP Engineering GmbH Ingenieurbüro ch
Die IP Engineering GmbH ist Ihr zuverlässiger Partner in der Bauherrenberatung, bei Lüftungsgutachten und Studien zu Machbarkeit von Varianten, der...
tunnelventilation.pro Tunnel Ventilation Tests Safety Acceptance Expertise Switzerland Services Projects Testing Design Wind Fire Brazil During Republic
188 Handyzubehör und Handyersatzteile günstig Handyzubehör Mobiltelefonie ch
Reparatursets und die dazugehörigen Ersatzteile für Handys und Tablets gibt es nur im Schweizer Onlineshop andbox.ch. Zusätzlich bietet der Shop...
andbox.ch/ Apple Iphone Oem Galaxy Schwarz Xperia Samsung Plus Zubehör Sony Nexus Smartphone Hüllen Htc Reparatursets Usb Sticks Handyersatzteile Hörmuschel Kopfhörer
189 Günstiger Lagerraum GmbH Umzug Transport ch
Günstig Lagerraum mieten in Zürich Günstig, schnell ab CHF 12* (inkl.) einlagern, ab 1m³ Sie möchten einen Lagerraum in Zürich mieten? Einen Platz...
guenstigerlagerraum.ch/ Zürich Lagerraum Regensdorf Adlikerstrasse Einlagern Birmensdorferstrasse Seefeldstrasse Konradstrasse Althardstrasse Bern Self Schwyz Info@guenstigerumzugch Mieten Genf Luzern Inklusive Standorte Agb
190 Bücheler Werbegeschenke AG Werbeartikel ch
Bücheler AG - Der Werbeartikel-Spezialist mit Werbeartikeln aller Art Streuartikel, edle Werbepräsente, Kundengeschenke, Give aways, Werbeartikel für Messen und Ausstellungen Ihre...
buecheler.ch Werbeartikel Bücheler Profi Werbegeschenke Etui Streuartikel Give Farben Kunststoff Sonnenbrille Flop Trinkflasche Tasse Wwwpromotrendsch Werbeartikelprofi Kundengeschenk Ipad Hülle Werbe
191 EfG Existenzmakler Schweiz und ch
efg-immo.com Efg Hotel Zeitrente Verkauf Energieanlagen Farm Firmenkauf Immobilien Grundstück Eur International Auslandsimmobilien Kauf Windpark Existenzmakler Angebote
192 Babycenter Schweiz Baby-Produkte ch
Das Babycenter Schweiz hat sich zum Ziel gesetzt, trendige und qualitativ hochwertige Baby-Produkte von den bekanntesten Herstellern zu fairen Preisen...
193 Babycenter Schweiz Baby-Produkte ch
Das Babycenter Schweiz hat sich zum Ziel gesetzt, trendige und qualitativ hochwertige Baby-Produkte von den bekanntesten Herstellern zu fairen Preisen...
194 Laufbahnberatung Wider Potential Development Laufbahnberatung und ch
Ihr Partner für Laufbahnberatung, Karriereberatung, Coaching und Berufsberatung in der Region Bern. Finden Sie heraus, in welchen Bereichen Sie besondere Fähigkeiten...
wider-potential.ch/ Coaching Laufbahnberatung Karriereberatung Training Bern Kostenloses Vorgespräch Development Laufbahn Führungscoaching Karriereplanung Bewerbungscoaching Partner Führungs Portrait Individuelles Angebote Senden
195 Ahornblick Apartments Apartments Beherbergung at
Tanken Sie bei uns, vom Sonnenschein und herrlichen Bergpanorama verwöhnt, wieder neue Kraft für den Alltag. Unsere 2 Apartments sind...
196 Ahornblick Apartments Apartments Beherbergung at
Tanken Sie bei uns, vom Sonnenschein und herrlichen Bergpanorama verwöhnt, wieder neue Kraft für den Alltag. Unsere 2 Apartments sind...
197 Ahornblick Apartments Apartments Beherbergung at
Tanken Sie bei uns, vom Sonnenschein und herrlichen Bergpanorama verwöhnt, wieder neue Kraft für den Alltag. Unsere 2 Apartments sind...
198 Sesselflechterei Stöglehner Sesselflechter Tischler at
Was ich Ihnen anbiete: Einflechtungen von Hand Neben dem Wiener Geflecht, beherrsche ich auch eine Vielzahl anderer Geflechtarten. Unter anderem die Reparatur...
sesselflechterei.at Geflecht Restaurierung Stöglehner Wiener Navigation Hand Philosophie Sessels Schnurgeflecht Zusätzlich Sesselflechterei Tischlerarbeiten Tischlermeister Peddigrohr Angebot Persönliche
199 Sesselflechterei Stöglehner Sesselflechter Tischler at
Was ich Ihnen anbiete: Einflechtungen von Hand Neben dem Wiener Geflecht, beherrsche ich auch eine Vielzahl anderer Geflechtarten. Unter anderem die Reparatur...
200 Sesselflechterei Stöglehner Sesselflechter Tischler at
Was ich Ihnen anbiete: Einflechtungen von Hand Neben dem Wiener Geflecht, beherrsche ich auch eine Vielzahl anderer Geflechtarten. Unter anderem die Reparatur...
201 Umzugskosten niedrig halten - UMZUG UMZÜGE ch

Vergleichen Sie Qualität & Leistung verschiedener Firmen. Sparen Sie bis zu 70% Gratis und unverbindlich · 1 Anfrage = 5 Angebote...
umzugsofferten-vergleichen.ch Umzug Umzugsofferten Vergleichench Jobs – Vergleichen Einfache Umzugsanfragen Nützliche Ihr News Fragenkatalog Server Möglich |
202 UMZUG + Zügeln Wangen Umzug transport ch
UMZUGSOFFERTEN-VERGLEICHEN.CH - Umzüge Umzug Zügeln Transport Umziehen. Informationen und Tipps, Umzugsfirmen, Beratung Umzug und Transport, Checklisten, Zügeln Büro, Umziehen Wohnung...
umzugsofferten-vergleichen.ch Umzug Umzugsofferten – Vergleichench Vergleichen Jobs Preise Erhalten Dienstleistungen Found The Found Zügeln Ihr Grossen Uns Blog
203 Schubiger Möbel Möbel ch
Als Möbelfachhändler mit langjähriger Tradition bietet das Möbelkaufhaus Schubiger in der Schweiz Wohnideen für klassische und moderne Wohnstile für Haus...
schubiger.ch Wohnidee Outlet Zürich Möbel Anzeigen Ansehen Kommode Hauptgeschäft Schrank Lampe Sideboard Möbelhaus Aktionen Stuhl Shop Alten Anfahrt Lederpflegeservice Lounge Arbeiten
204 Tomatis Tomatis Audio-Psycho-Phonologie at
Zu Beginn findet in unserem TOMATIS® Institut in Wien ein Erstgespräch statt. Ziel dabei ist es durch eine genaue Statusabfrage...
205 Tomatis Tomatis Audio-Psycho-Phonologie at
Zu Beginn findet in unserem TOMATIS® Institut in Wien ein Erstgespräch statt. Ziel dabei ist es durch eine genaue Statusabfrage...
206 Holzbau Haselsteiner Holzbau und at
Waidhofen an der Ybbs
Holzbau und Zimmerei in Waidhofen an der Ybbs Josef Haselsteiner, Holzhaus, Holzriegelhaus, Niedrigenergiehaus, Passivhaus, Zubau, Renovierung, Umbau, Dachstuhl, Carport, Holz im...
holzbau-haselsteiner.at Holzbau Ybbs Zimmerei Haselsteiner Team Dachstuhl Uhr Carport Waidhofen Neubau Startseite * Seiten Leistungen Dämmstoffen Glaser Dacheindeckungen
207 Holzbau Haselsteiner Holzbau und at
Waidhofen an der Ybbs
Holzbau und Zimmerei in Waidhofen an der Ybbs Josef Haselsteiner, Holzhaus, Holzriegelhaus, Niedrigenergiehaus, Passivhaus, Zubau, Renovierung, Umbau, Dachstuhl, Carport, Holz im...
208 fashionlover.club Bekleidung ch
fashionlover.club bietet trendige Young fashion für Frauen zum absoluten Tiefstpreis - alles nur solange Vorrat!...
fashionlover.club Warenkorb Kleid Kleider Tops Jeans Shirts Konto Leggings Material Petrol Shorts Weiss Pullover Grau Cuts Grösse Login Registrieren Spandex
209 Staranwaltskanzlei - ANISTON & Rechtsanwälte at
Verteidiger in Strafsachen...
210 Mode Blogger Mode at
Mode und Life Style Blogger, Reviews von Produkten und Hotels...
szoeky.com Fashion Blog Week Jess Just Lifestyle Outfits Prague Shopping Hotel Style Praha Sales Spring Life Trend Say Outfit Share
211 Wir sind Ihr zuverlässiger Reinigung Umzug ch
Sie beziehen Ihr neues Zuhause und wir kümmern uns um den Rest. Vom Keller über den Estrich bis zur Garage...
212 Wir sind Ihr zuverlässiger Reinigung Umzug ch
Sie beziehen Ihr neues Zuhause und wir kümmern uns um den Rest. Vom Keller über den Estrich bis zur Garage...
213 Institut für Logotherapie & Logotherapie at
Das Institut bietet bei der Ausbildung in Logotherapie und Existenzanalyse Lehrgänge für Lebensberatung und Sozialberatung und Imagination in Verbindung mit...
214 DDr. Gerlinde Tscharre Fachärztin Für at
215 DDr. Gerlinde Tscharre Fachärztin Für at
216 imove.ch - Kostenlose Umzugsofferten Umzüge ch
Auf imove.ch erhalten Sie kostenlose Umzugsofferten und können so Geld sparen....
imove.ch Agbs Checkliste Umzug Lagerraum Klaviertransport Entrümpelung Bieten Mieten Firmenumzug Tresortransport Imovech Umzugsservicesübernehmen Umzugsfirmen
217 Dr. med. Natalie Reytan Hautarztpraxis at
Die private Praxis für Dermatologie Dr. Reytan in Berlin Mitte bietet eine umfassende Bandbreite der generellen, operativen und ästhetischen Dermatologie...
hautarztpraxisberlin.de – Kosmetik Reytan Hautarztpraxis Dr Private Mitte Berlin Therapie Medizinische Akne Allgemein Kindern Hautarzt Hydrafacial™ Haare Fruchtsäure Teenie
218 König Heinrich Bauunternehmen Bauunternehmen at
König Heinrich ist ein österreichisches traditionelles Bauunternehmen mit Sitz in Wien. Vielzählige Wiener Werke zeugen von unserem Wirken. Hauptgeschäftsbereich sind...
koenig-heinrich.at Erfahren Rsaquo Leistungen Angebote König Heinrich Sanierungen Einzelgewerke Wien Sanierung Unternehmen Karriere Preis Verantwortung Leistung
219 Taxi Flughafen Linz Personenbeförderung Mit at
Wir sind ein Taxiunternehmen mit Sitz am Flughafen Linz Hörsching Österreich. Bestellen Sie telefonisch oder per E-Mail ein Taxi im...
taxi70100.at Linz Taxi Flughafen Fahrpreis Bestellung Unter + Office@taxiat Mail Taxifahrt Jakober Zögern Flughafenstraße Routenplaner Faires Rufen
220 Räumungsdienst für Wien und Räumungen und at

Unser Unternehmen übernimmt jegliche Art von Räumungs- und Entrümpelungsarbeiten im Raum Wien und Niederösterreich und führt diese kostengünstig, zuverlässig und...
raeumungen.at/ + Altwaren Räumung Entsorgung Umzug Entrümpelung übersiedlung Räumung|entrümpelung|entsorgung Bücherbasar Menü übersiedlung|umzug Wien Dienst NÖ Bücher
221 empower-coaching Coaching ch
empower-coaching: loslassen, entspannen, Kraft schöpfen, einen Weg finden, sich vorbereiten Empower-coaching soll Ihnen helfen, mit einem akut erlebten oder bevorstehenden Ereignis...
empower-coaching.ch Kraft Praxis Schöpfen Kale Beratung Empower Coaching Fischer Loslassen Psychologische Energiesys­tem Kine­si­olo­gie Entspannen Psy­cholo­gie Etwas All­t­agein­set­zen Belastendes Mit­tels Peternbspfischer
222 TierTherapeuten LIGA Organisation ch
Die TierTherapeuten LIGA ist ein Zusammenschluss praktizierender TierTherapeuten sowie Anbieter tiergestützter Therapie (das Tier als Therapeut) ...
tt-liga.com Therapie Liga   Fachkreise Tiertherapeuten Tierhalterpublikum Therapeut Tierhalter Login Ausbildung Anbieter Mission Buchung Akupunktur Ligaisten Mäzenförderer
223 TierTherapeuten LIGA Organisation at
Die TierTherapeuten LIGA ist ein Zusammenschluss praktizierender TierTherapeuten sowie Anbieter tiergestützter Therapie (das Tier als Therapeut) ...
tt-liga.com Therapie Liga   Tiertherapeuten Fachkreise Tierhalterpublikum Login Therapeut Tierhalter Ausbildung Buchung Tiergestützte Anmeldung Mission Anbieter Anette Vision
224 Dampferland E-Zigaretten Online ch
E-Zigaretten Online Shop mit günstigen Preisen. Gute Geräte und Schweizer Liquids. Beste Qualität. Heute Bestellen schnelle Lieferung. Einsteiger Sets und...
dampferland.ch/ Liquids Verdampfer Aromen Akkuträger Power Sets Selbstwickler Zubehör Zigaretten Sennenquöll Shop Einsteiger Basisliquid Insmoke Capella Schweizer
225 Vickydress Abendkleider Online Shop Mode ch
Abendkleider sind sehr beliebt bei schweiz. In der Regel in einem Meeting oder einer Partei, wird Abendkleider gewählt werden. Hier...
vickydress.ch Price Linie Kleider Vicky Market Linieprincess Ausschnitt ärmellos Bodenlang Abendkleider Kleid Perlen Chiffon Brautkleider Spitze Etui Duchesse
226 24 Stunden Betreuung in 24 Stunden at
Wir vom Verein 24h-Assistenz-Pflege-Betreuung - APB möchten Ihnen einen unkomplizierten, zuverlässigen und kompetenten Service für Ihre 24-Stunden-Betreuung und Pflege bieten....
227 Foyer de Beaute Kosmetikstudio Kosmetik ch
Gesichtsbehandlungen Akne-Behandlung Anti-Aging-Behandlungen Pigmentflecken-Behandlungen Mikrodermabrasion Microneedling Mesotherapie Hyaluron / Filler Faltenunterspritzung Haarentfernung Laser Permanent Haarentfernung Wachs Maniküre Pediküre Massageanwendungen Tanning Selbstbräunung...
foyerdebeaute.ch Z Y
228 Informatik-Support& Beratung PC-Support & ch
Preiswert, ausgewiesen, kompetent und effizienter In formatiksupport. Ueber 20 Jahre Erfahrung. Daten sicherung, Datenrettung, Datenmigration, bei Neukauf, Computerhilfe und Computerschulung...
computer-arzt.ch Support Pc Mac Hilfe Informatiksupport Informatik Reparaturen Computer Windows Reparatur Schulung Apple Kompetener Erstellung Qualifizierter
229 Möbeltransport und Umzugsservic Wien Transport Umzug at
Möbeltransport und Umzugsservice in Wien sowie Transporte aller Art. Preisgünstig....
230 die-vier Wirtshausmusikanten Volksmusik ch
Die Vier Wirtshausmusikanten pflegen eine fröhliche Musik, die für jede Art von Veranstaltung passt. Die Vier– das sind vier...
231 die-vier wirtshausmusikanten at
Die Vier Wirtshausmusikanten pflegen eine fröhliche Musik, die für jede Art von Veranstaltung passt. Die Vier– das sind vier...
232 Dr. David Kaufmann - Psychotherapie Akupunktur at
- Psychotherapie und Psychosomatik - TCM - westliche Kräutertherapie - Akupunktur - Schmerztherapie - Medizinische Diagnostik und Therapie - Supervision und Coaching - Vorsorgeuntersuchung - Mutter-Kind-Pass-Untersuchungen...
david-kaufmann.at Graz Psychotherapie Arzt Krebs Akupunktur Depression David Medizin Chinesischer Kräutertherapie Westliche Burnoutakupunktur Kombinationdr
233 Zahnarztpraxis Krebs Zahnarztpraxis ch
Der Zahnarzt Ulrich Krebs in Solingen steht seit Jahrzehnten und inzwischen in der 3. Generation, für einen qualifizierten und freudlichen...
zahnsolingen.de Ohligs Zahnarzt Solingen Zahnmedizin Implantologie Uns Leistungen Parodontologie Zahnarztpraxis Krebs Praxis Minimalinvasive Msc Ulrich Neuigkeiten Steht
234 RECUS GmbH Beschichtungen und at
Die RECUS GmbH mit Sitz in Graz ist ein international tätiges Unternehmen mit jahrzehntelanger Erfahrung auf dem Sektor der Beschichtungs-...
recus.at Z Y
235 Möbeltransport Wien und Umzugsservice Umzug Transport at
Möbeltransport und Umzugsservice In Wien, sowie Ttansporte Aller Art....
cargotransport.at Wien Möbeltransport Umzug Zugriff Art Scrollen Ursachen Aller Fehlermeldung Stunde Wkdesign Transporte Möbellieferung Cargotransportat Sowie Y
236 Gutscheine Gewinnspiele sowie Online-Shops aller Art Gutscheine Gewinnspiele sowie Online-Shops Werbeagentur lu
Weißkirchen in Steiermark
Discount Portal bietet seriöse, geprüfte Gutscheine und Gewinnspiele an, die täglich aktualisiert und ergänzt werden. Nebenbei werden Online-Shopping sehr leicht gemacht...
discountportal.at Gutscheine Gewinnspiele Discount Portal Urlaubsportale Reise Bestengratis Produte Testen Z
237 Gutscheine Gewinnspiele sowie Online-Shops aller Art Gutscheine Gewinnspiele sowie Online-Shops Werbeagentur ch
Weißkirchen in Steiermark
Discount Portal bietet seriöse, geprüfte Gutscheine und Gewinnspiele an, die täglich aktualisiert und ergänzt werden. Nebenbei werden Online-Shopping sehr leicht gemacht...
discountportal.at Gewinnspiele Gutscheine Portal Reise Discount Urlaubsportale Besten Testen Gratisprodute Z
238 Gutscheine Gewinnspiele sowie Online-Shops aller Art Gutscheine Gewinnspiele sowie Online-Shops Werbeagentur at
Weißkirchen in Steiermark
Discount Portal bietet seriöse, geprüfte Gutscheine und Gewinnspiele an, die täglich aktualisiert und ergänzt werden. Nebenbei werden Online-Shopping sehr leicht gemacht...
discountportal.at Gewinnspiele Gutscheine Discount Besten Urlaubsportale Portal Reise Gratis Testenz Produte
239 Daniel Fuchs - Hotel Unternehmensberatung ch
Dr. Daniel G. Fuchs hat 35 Jahre Erfahrung in der Hotel und Ausbildungsbranche, Luxus und Gruppenhotellerie. Lehraufträge an diversen Universitäten...
danielgfuchs.ch/ Daniel Fuchs Services Pictures Michabout Unternehmensberatung Fotos Experte Hoteltourismus Dienstleistungen Contact Professorconsultant Lernveranstaltungen Business
240 Pfefferspray Store Sicherheit Selbstverteidigung ch
Schweizer Pfefferspray-Versand...
pfefferspray-store.ch Pfefferspray Pfefferpistolen Sabre Store Red Versandkosten Uns Agb Mk Mein Konto Jet Pfeffer Trainingswaffen Kartuschen Angel
241 Limousinen-mieten Limousinenservice ch
Wohlen AG
Stretch-Limousinen und Oldtimer finden Sie bei Kiwis Limousinen ltd. von über 25 Fahrzeugen mit 8 Standorten in der Deutsch-Schweiz vertreten....
stretch.ch Limo Limousinen Gästebuch Mieten Oldtimer Stretch Stretchlimo Limos Royce Rolls Zürich Limousine Basel Ab Luzern Rapperswil Jona Zug
242 Medientraining | Kommunikation Kommunikation ch
Training und Coaching Medientraining, Kommunikationstraining, Coaching Auftritt und Präsentation, Moderation von Workshops und Grossgruppen visuelle Kommunikation Ob Flyer, Infografik, Broschüre, Webseite, Jahresbericht...
243 Raum für Bewusstein und Hypnosetherapie -coaching ch
Systemische Hypnosetherapie /-Coaching. Hypnosystemisches LLC ® Hypnosetherapie - Schweizer Modell © ...Mental und Autogenes Training, lösungsorientiertem Kurzzeitcoaching uvm. zu einem wirksamen und...
zeitgerecht.ch Found Meditation Xidfound Not Guru Error Z
244 Beratung & Interim Management Unternehmensberatung at
Altenmark an der Triesting
Unternehmensberatung die den Ansprüchen von Lean Management gerecht wird. Durch unser Netzwerk an Spezialisten können wir mehrere Themenkomplexe abdecken und...
eccomp.biz Z Zeitpunkt Aufbaubitte Spteren Wwweccompbizdiese Webprsenz Under Currently Versuchen Einmalthis Constructionpleasebefindet Europe Host
245 Möbeltransport und Umzug Wien Umzug at
Möbeltransport und Umzugsservice Wien...
246 Zahnarztpraxis Krebs Zahnarztpraxis at
Bereits seit Jahrzehnten bietet die Zahnarztpraxis Ulrich Krebs in Solingen versierte Zahnmedizin und eine richtiggehend vertraute Verbindung zu den Praxisbesuchern....
zahnsolingen.de Zahnarzt Ohligs Solingen Zahnmedizin Implantologie Uns Msc Minimalinvasive Parodontologie Ulrich Krebs Leistungen Praxis Zahnarztpraxis Patient
247 City Zahnarzt Hannover Zahnarzt ch
City Zahnarzt Hannover verfügt über eine mehrjährige Arbeitserfahrung und ermöglicht seinen Zahnpatienten einen bemerkenswerten Behandlungsstandard in einem angenehmen Umfeld. Gleichgültig...
city-zahnarzt-hannover.de Zahnarzt Hannover Implantologie Uns City Info@city Hannoverde Leistungen öffnungszeiten Praxis Philosophie Zertifiziert Minimalinvasive Parodontologie Zahnfleischprobleme
248 Zopf-Photography KG Fotograf Bei at
Fotoshooting bei Vöcklabruck: Damit Ihre Erinnerungen perfekt bewahrt werden, steht Ihnen das Team von ZOPF PHOTOGRAPHY immer zur Verfügung. Wir sind...
zopf-photography.com Unternehmen Privat Fotografen Hochzeit Reserved Zopfphotography Rights Z
249 Loogo Umzüge Österreich Umzüge at
Mit LOOGO sparen Sie Zeit und Nerven. Überlassen Sie Ihren Umzug den Profis von LOOGO! Profitieren Sie von unserer Organisation und...
loogo.at Umzug Möbel Kartons Möbelküche * + Umzugsunternehmen Privatumzug Angebot Firmenumzug Verpackungsmaterial * Umzüge Loogo Kartons * Lkw * Internationaler Neumöbel Abholung Karton Rechner Demokratischevolksrepublikkorearepublikkroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmauretanienmauritiusmazedonienmexikomikronesienmoldawienmonacomongoleimontenegromosambikmyanmarnamibianaurunepalneuseelandnicaraguaniederlandenigernigerianiuenorwegenösterreichomanosttimorpakistanpalästinensischeautonomiegebie
250 RZA Business Software IT at
Die RZA Software & Business Solutions entwickelt intelligente Business Software für Rechnungswesen, Lohn- und Gehaltsverrechnung, Fakturierung, sowie eine einfache Registrierkassenlösung....
251 RZA Business Software Software at
Die RZA Software & Business Solutions entwickelt intelligente Business Software für Rechnungswesen, Lohn- und Gehaltsverrechnung, Fakturierung, sowie eine einfache Registrierkassenlösung...
252 RZA Business Software Software at
Die RZA Software & Business Solutions entwickelt intelligente Business Software für Rechnungswesen, Lohn- und Gehaltsverrechnung, Fakturierung, sowie eine einfache Registrierkassenlösung...
253 Chiptuning Softwaretuning Kfz at
CHIPTUNINNG-LEISTUNGSSTEIGERUNG CHIPTUNING-SOFTWARETUNING-OBD-TUNING Chiptuning vom Spezialist von Kärnten für ganz Österreich für alle Fahrzeuge Diesel, Benziner, mit oder ohne Turbo Partikelfilter...
254 Chiptuning Softwaretuning Kfz Technik at
CHIPTUNINNG-LEISTUNGSSTEIGERUNG CHIPTUNING-SOFTWARETUNING-OBD-TUNING Chiptuning vom Spezialist von Kärnten für ganz Österreich für alle Fahrzeuge Diesel, Benziner, mit oder ohne Turbo Partikelfilter...
255 Chiptuning Softwaretuning Kfz Technik at
CHIPTUNINNG-LEISTUNGSSTEIGERUNG CHIPTUNING-SOFTWARETUNING-OBD-TUNING Chiptuning vom Spezialist von Kärnten für ganz Österreich für alle Fahrzeuge Diesel, Benziner, mit oder ohne Turbo Partikelfilter...
256 Chiptuning Softwaretuning Kfz at
CHIPTUNINNG-LEISTUNGSSTEIGERUNG CHIPTUNING-SOFTWARETUNING-OBD-TUNING Chiptuning vom Spezialist von Kärnten für ganz Österreich für alle Fahrzeuge Diesel, Benziner, mit oder ohne Turbo Partikelfilter...
257 Chiptuning Softwaretuning Kfz at
CHIPTUNINNG-LEISTUNGSSTEIGERUNG CHIPTUNING-SOFTWARETUNING-OBD-TUNING Chiptuning vom Spezialist von Kärnten für ganz Österreich für alle Fahrzeuge Diesel, Benziner, mit oder ohne Turbo Partikelfilter...
258 Craniosacrale Körperarbeit silent touch Energetiker at
Praxis für Cranio-Sacrale Körperarbeit, silent touch, Aromalogie, Aromapflege, Arbeit mit dem morphogenetischen Feld Spezielle Angebote für Mutter und Kind, Säuglinge und...
gleichgewicht.jetzt Körperarbeit Grundsätze Gabriele Seitenanfang Craniosacrale Schelling System Finden Inhaltsverzeichnis Tiere Anwendungsgebiete Login Webtemplatedesign Mich Nächste Torsten Körper
259 Biotop Schuhe und Möbel Handel Textil at
Die Wollwerkstatt in Texing vertreibt wertvolle und hochwertige Produkte aus Schafwolle. Es handelt sich um Produkte wie Wolldecken, Gymnastikmatten, diverse...
wollwerkstatt.at Filzwolle Merino Meditationskissen Bettdecken Maß Hochwertige Hautpflege Unterbetten Filzpatschen Handschuhe Natur Produkte Kinderbettdecke Faltmatte Plaids Wollmütze
260 City Zahnarzt Hannover Zahnarzt at
City Zahnarzt Hannover hat eine mehrjährige Arbeitserfahrung und ermöglicht Ihnen einen besonderen Qualitätsstandard in anprechenden Räumen. Egal ob kostenwirksame Standardlösung...
city-zahnarzt-hannover.de Zahnarzt Hannover Implantologie Uns City Praxis Info@city Hannoverde Leistungen Philosophie öffnungszeiten Scrollen Unsere Rufen Prophylaxe
261 Adreventura Ticino Outdoor Sport ch
Adreventura im Tessin, Schweiz, bietet sowohl für Abenteurer, Adrenalin-Suchende oder Anfänger genau das Richtige. Entdecken Sie unser Angebot an...
adreventura.ch Adreventura Ticino Day Canyoning Abseiling Outdoor Canoe Full Contact Building Independent River Events Photo Caving Center Safety Sales
262 Gebrauchte Stahlrohre von Ø219mm Handel Gebrauchte lu
Wrocław (Breslau)
Sehr geehrten Damen und Herren, wir bieten Ihnen die gebrauchten geschweißte Stahlrohre. Unser...
shimex.pl Z Y
263 Möbeltransport und Umzug Wien Umzug at
Möbeltransport Wien, Umzug, Möbellieferung sowie Transporte aller Art Für ganz Österreich sowie Europaweit von A nach B. Möbeltransport & Umzugsservice Wien. Wenn Sie...
cargotransport.at Wien Möbeltransport Zugriff Umzug Oben Aller Ab Möbeltaxi Wkdesign Leistungen € Transporte Preise Cargotransportat Y
264 Psychologische Beratung Lebens- und at
Lebensberatung ist die Beratung und Begleitung von Menschen in Konflikt-, Entscheidungs- und Krisensituationen. Lebensberatung ist Hilfe zur Selbsthilfe und eine Unterstützung...
praxis-laaerberg.at Beratung Lebens Coaching Psychologische Sozialberatung Trauer Lebensberatung Praxis Umgang Mobbing Trennung Burnout Emotionen Erziehungsberatung Paarberatung Entscheidungs Arbeitsplatzverlust  umorientierung
265 Airmed-Praxis für Naturheilkunde TEN Naturheilverfahren ch
ls angehende Naturheilpraktikerin TEN biete ich jeweils Sonntags Naturheilverfahren (zb. Schröpfen, Baunscheidtieren, Check-Up) zu günstigen Preisen an. Weiter können Sie...
airmed-praxis.ch Massage Wickel Zürich Kompressen Kurse Therapie Workshops Buchen Naturheilkunde Dorn Lage Preise Mich Therapien Schröpfen Blog
266 Naturheilkunde klassische Massage Dorn-Therapie Naturheilverfahren ch
Als angehende Naturheilpraktikerin TEN biete ich jeweils Sonntags Naturheilverfahren (zb. Schröpfen, Baunscheidtieren, Check-Up) zu günstigen Preisen an. Weiter können Sie...
airmed-praxis für naturheilkunde ten
267 VESPIX Wespen Notdienst KÄRNTEN Schädlingsbekämpfung at
VESPIX Wespen und Hornissen Notdienst in Kärnten!...
vespix.at Vespix Valid Wespen Klagenfurt Umsiedelungen Steinacher Wölfnitz Hornissen Preise Inhaber Kärnten Insektenbefall Wespenbekämpfung Stefan Xhtml Föhrengasse
268 Diplomarbeit und Bachelorarbeit drucken Druckerei ch
Wir drucken und binden deine Diplomarbeit, Bachelorarbeit oder oder Masterarbeit im Eiltempo. Bis 12:00 Uhr bestell noch am gleichen Tag versendet. Abholung...
studyprint.ch Diplomarbeit Drucken Abschlussarbeit Deine Bachelorarbeit Binden Bindung Plastikspirale Thermobindung Thermomappe Metallspirale Winterthur Budget Tag Hardcover Matura
269 Kinesiologie Therapie Kienesiologie ch
Kienesiologie findet in vielen bereichen imLeben anwendung in der Paartheraie, Familienstellen oder zur positionierung, neuaurichtung des Lebens...
familienstellen-paartherapie.ch/ Paartherapie Familienstellen Therapie Zürich Bern Familienaufstellen Aarau Form Praxis Lokalen Baden Baselanerkannte Luzern
270 Fotograf Bay studios Hochzeitsfotograf Fotograf ch
Fotografin im Raum Aarau Zürich die Ideale Partnerin für Schwangerschaftsfots Babyfotos so wie Hochzeitsfotografie, mit viel erfahrung und das Auge...
baystudios.ch/ Zürich Fotograf Aarau Babyfoto Hochzeitsfotograf Babyfotograf Neugeborene Fotos Portraits Bewerbung Fotoshooting Babyfotografin Fotostudiobusiness
271 Zehrer Bäckereibedarf at
Auf Zehrer finden Sie alles zum Backen: Backformen, Rollfondant, Massa Ticino, Ausstechformen, Hohlkörper, Hohlkugeln sowie Kuvertüre. Aber auch zur Tortendekoration...
272 Hundehaftpflichtversicherungen im Test Versicherung at

Dieser Ratgeber stellt Informationen und Fakten für die Hundehaftpflichtversicherung in Deutschland, Österreich und der Schweiz bereit....
hundehaftpflichttest.de Test Hundehaftpflicht Testberichtede Vergleichen News Angebot Hundehaftpflichtversicherung Tarif Vergleich Hund Darmstadt Schließen Weg Ab Provinzial Httpswwwlebensversicherung Informationen
273 Anwaltskanzlei-in-Zuerich.ch Brandon-Kaufmann - lic. Rechsanwälte Zürich ch
Anwaltskanzlei in der Stadt Zürich mit Tätigkeit in sämtlichen Rechtsgebieten. Allgemeinpraktikerin mit Schwergewicht im Verwaltungs- und Sozialversicherungsrecht. THEMEN: Versicherungsrecht, Straf-...
anwaltskanzlei-in-zuerich.ch Zürich Kaufmann Brandon Anwaltskanzlei Sara Llm Bezirksgericht Rechtsanwältin Zuerichch Kantons Anwaltsverband Mitgliedschaft Association Zrich Lic
274 Kundalini Yoga - Gong Yoga - ch
Der Amrit Yoga Verein fördert die Verbreitung von Kundalini Yoga, Karam Kriya (angewandte Numerologie), Yoga Coacing und Gong. Er organisiert...
275 Silvio Schoisswohl Photography Fotograf at
Fotoshootings-Business Services-Picture Loop- erlebe ein einzigartiges Glamour Fotoshooting oder schenke jemandem dieses Erlebnis! Homeshooting: Wir setzen dich in deiner Wohlfühlatmospäre in...
photoplace.cc Portrait Landschaft Familie Landschaftsfotograf Akt Erotik Hunde Photography Food Haustieremarchtrenk Beautybaby
276 Come together Grilltisch Grillen Barbecue ch
Möchten Sie Ihre Freunde und die Familie zusammenbringen? Hier ist das Werkzeug dazu! Der Grilltisch! Ich möchte Ihnen meine neue Idee präsentieren....
277 Secrets Online Coaching at

Secrets ist eine Plattform für Online Coaching, wie man sein eigenes Online Business aufbaut. Anfänger und Fortgeschrittene lernen hier, das eigene...
278 Lampen und Kronleuchter Beleuchtung ch
Unser stetig wachsendes Angebot an schönen und hochwertigen Lampen aller Art garantiert Ihnen, dass Sie die für Sie passende Lampe...
traumlampen.ch Versand Kronleuchter Lampen Schweiz Lampe Swarovski Uns Agb Bleikristall Leuchtmittel Shabby Chic Finden Leuchter Kristall Stehlampen Deckenlampen Uhr
279 Gastrogeräte Küchengeräte Gastronomiezubehör ch
Günstige, qualitativ hochwertige Gastronomiegeräte, Küchenmaschinen, Pizzaöfen, Dönergrill, Küchengeräte, Kühltechnik sowie Outdoormöbel für Ihren Imbissbetrieb, Restaurant, Pizzeria, Partyservice, Catering oder Hotel....
gastrogeraete24.ch/ Versand Geht Unseren Pizzaöfen Finden Weinkühlschränke Uns Pizzaofen Teigknetmaschinen Beheizten Agb Gastronomiegeräte – Weinklimaschränke Vieles Hähnchengrill Zitruspressen
280 Knipsbox GmbH Fotobox Mieten ch
Das Knipsbox Package besteht aus einer modularen Box, in der sich Kamera, Bildschirm und Computer befinden. Ausgelöst wird die Kamera...
knipsbox.ch Mieten Knipsbox Login Fotobox Schreibe Uns Fotoshooter Agb Wwwknipsboxgaleriech Automatisches Apache Photoshop Filiale Preise Luzern Faq Angebot
281 Schwendermarkt Markt at
Bauernmarkt, fixe Marktstände, Marktbeisl...
schwendermarkt.at Initiativeserver Found The Apache Found Erhaltung Belebung Schwendermarktschwendermarktes Wwwfacebookcomschwendermarkt Port
282 Gesamtprogramm für die Ophthalmologie Medizinaltechnik ch
Roggwil TG
Schweizer Gesamtanbieter ophthalmologischer, chirurgischer und diagnostischer Produkte für Augenärzte (Ophthalmologie), Optometristen und Augenoptiker....
mediconsult.ch/de Mediconsult Retina Glaukom Oct Erfahren Katarakt Diagnose Refraktion Ophthalmologie Hospital Anfahrt Vivinex Cornea Chirurgie Adresse Iol Kalkulation Ss Gesamtanbieter Refraktiv Plus Vitrektomie Scan
283 Nakte Tantramassage Tantra at
Hubsche Heilmasseurin anbietet wunderschone erotik Tantramassage Nur Sonntag und Montag im Wien Tel 0650 4203 264 Emily...
284 Toilette Komposttoiletten Trockentoiletten swiss Toilette Umweltfreundlich at

Umweltfreundlich, Wasserspahren, dank regort Komposttoiletten, Einfache und schnelle Montage, funktionier auch bei Hochwasser und wenn gar keins mehr kommt und...
regort.com Gt Regort Solartechnik Reiniger Komposttoiletten Wechselrichter Solarstrom Volt Serie Heat Pipe Aj Prod übrige Sinus Warmwasser Pumpen
285 Toilette Komposttoiletten Trockentoiletten swiss Toilette Umweltfreundlich ch
Umweltfreundlich, Wasserspahren, dank regort Komposttoiletten, Einfache und schnelle Montage, funktionier auch bei Hochwasser und wenn gar keins mehr kommt und...
regort.com Gt Regort Solartechnik Reiniger Komposttoiletten Serie Wechselrichter Volt Solarstrom übrige Haushalt Warmwasser Handreiniger Sinus Pumpen Prod
286 Toilette Komposttoiletten Trockentoiletten swiss Toilette Trockentoilette lu

Umweltfreundlich, Wasserspahren, dank regort Komposttoiletten, Einfache und schnelle Montage, funktionier auch bei Hochwasser und wenn gar keins mehr kommt und...
regort.com Gt Regort Solartechnik Komposttoiletten Reiniger Volt Solarstrom Wechselrichter Serie Sinus Aj Haushalt Pipe Heat Warmwasser Prod Industrie
287 Yoga Aarau und Lenzburg Yoga Aarau und Lenzburg Yoga ch
Aarau / Lenzburg
Chantal Yoga bietet Yoga Kurse in Aarau und Lenzburg sowie SUP (Stand Up Paddling) Yoga auf dem Hallwilersee und anderweitigen...
chantalyoga.ch Yoga Aarau Lenzburg Flow Chantal Hallwilersee Vinyasa Erfahren Sup Mama Zeit Baby Teacher Training Schwangerschaftsyoga
288 NutriGreen GmbH Nahrungsergänzung ch
Im unseren Online-Shop finden Sie die grösste Superfood Auswahl, gesunde vegane Proteine, wie auch verschiedene Produkte aus der Natur. Aus unserem...
289 Österreichweite Anhängervermietung Anhängervermietung - at

Anhängersystemvermietung mit österreichweiten Mietstationen. Anhängervermietung speziell für Tankstellenunternehmen. Eigene Anhänger Produktion. Eigenes Franchisesystem. Eigenes OneWay Mietsystem....
eurotrail24.at Anhänger Mieten Eurotrail Vermietung Miet Trailer Verleih Ulm Deutschland Rental Partner Stationen Lage Lemgo Bielefeld
290 Immobilien Florida Immobilienmakler Florida at
Haus kaufen Florida – Immobilien Naples, Bonita Springs, Marco, Ft Myers Beach, Sanibel, Cape Coral Suchmaschine für Immobilien Florida, aktuelle Angebote...
immobilienmakler-in-florida.com Florida Naples Immobilien Cape Coral Estero Sanibel Bonita Springs Marco Beach Myers Kirsten Island Fort
291 Praxis Coelho Physiotherapie ch
Die Physiotherapie und Ergotherapie Praxis Silvia Coelho bietet ein nettes Team in einer wohltuenden Stimmung und eine rollstuhlgängige Einrichtung. Lassen...
ergo-physiotherapie-hannover.de Physiotherapie Coelho Praxis Hannover Ergotherapie Sprechzeiten Bothfeld Scroll Freuen Händen Manuelle Bewegen Hannoverde Info@ergo Eistherapie Atemtherapie
292 Pocketmania Online Marketing at
Ein Vergleichsportal für Pocket Bikes; Monetarisierung durch Affiliate Links...
pocketmania.de/ Pocket Bike Bikes Cross Dirtbike Renn Einzelheiten Amazon Preis Sieger Ebay Elektro ★ Prüfen Versandkosten Takt Max
293 ActivePeople - Training & Fitness ch
ActivePeople bietet Ihnen professionelles Personaltraining und eine individuelle Trainingsberatung von hervorragend ausgebildeten Personal- und Fitnesstrainern, die umfangreiche Erfahrungen im...
294 Yacht Zubehör und Trend Dienstleistungen ch
Wägezellen finden in Industrie und Logistik weite Verwendung. Sie werden benutzt, um Gewichte zwischen 3 Kilogramm bis zu 280 Tonnen...
zelo.biz/produkte/waegezellen/ Wägezellen Druck Scherstäbe | Klemmenkästen Sensoren Messverstärker Fahrzeugwaagen Systems Weighing Bauformen Aircraft Indikatoren Info@zelobiz Zubehör Zug Plattform Digitale
295 Softwater Schweiz GmbH Wasserenthärtung ch
Die Firma Softwater Schweiz ist ein führender Anbieter von Wasserentkalkungsanlagen, die auf der Basis des Ionentauschs funktionieren. Informieren Sie sich...
softwater-schweiz.ch Wasser Softwater Schweiz Wasserenthärtungsanlage Blog Entkalkungsanlage Zerstörungen Kontaktformular Electrolux Northstar Weiches Gedanken Software Händleranfragen Marketing Sportzentren Reinigungsintervalleerrechnet Produkte
296 Topofen.ch Kaminzubehör ch
Bei der Webseite www.topofen.ch handelt es sich um einen spezialisierten Webshop für Öfen und Ofenzubehör....
topofen.ch Cheminée Zubehör News Anzündhilfen Sonderangebote Schwedenöfen Schweiz Kochherde Turbo Spray Garnituren Aschesauger Versandkosten Cheminéeglas Bodenschutzplatten Funkenschutz
297 Wagner Umzüge AG Umzugsfirmen ch
Wagner ist ein bekanntes Umzugsunternehmen im Raum Basel. Seit über 80 Jahren bietet das Unternehmen seine Dienste bereits an und...
wagner-movers.ch Gt Wagner Basel übersee Privatkunden Info@wagner Moversch Geschäftskunden Umzugsfirma Uns International Umzug Umzüge Geschichte Versicherung
298 Angela Hiltbrand Partnervermittlung ch
Angela Hiltbrand ist eine Partnervermittlungsagentur mit Büros in Basel, Luzern, Bern und Zürich. Mit Fingerspitzengefühl und gesundem Menschenverstand werden Menschen...
angela-hiltbrand.ch Error Errordocumentpermanently Theadditionally Moved Server Internal
299 M.A.N.D.U. Bad Ischl Fitness at
Bad Ischl
M.A.N.D.U. bietet individuelles Personal-Coaching, Kleiner Aufwand, großer Nutzen: Gestärkt und vital in den Alltag mit M.A.N.D.U. Your Lifestyleworkout! Kleiner Aufwand, großer...
mandu.at/standorte/bad-ischl Mandu Bad Ischl Standorte Upgradeeffizientes Browser Team Chrome Tauchen Ansprechpartnerin Petra Activate Ort
300 Fust Blog & News Trends und ch
Die Fust News Seite wurde 2016 ins Leben gerufen und geht auf angesagte Themen rund um die Fust Welt ein....
blog.fust.ch/ Webseiteaufgrund Support Ihrem Control Panel Konfigurationsfehlers Please Verfügbarfragen Konfigurationsfehler

Kleinanzeigen, Kommentare und Mitfahrgelegenheit

+ Kommentar oder Kleinanzeige für eintragen!

301 Amuvin eU

Dieser Text wird in der Ergebnisliste von Suchmaschinen angezeigt.
302 VIKING iMow

Schnell intelligent effizient. Die neuen iMow Robotermäher MI 632 und MI 632 P
303 Echtes Fotobuch auf Fotopapier Fotobuch

Mit unserem Fotobuch auf echten Fotopapier lassen Sie Erinnerungen weder verblassen noch verschwinden. Die Ausbelichtung
echtesfotobuch.at Fotobuch Fotopapier Echtes Fotobuch Fotobuch Auf
304 ElfKW Elektroleichtfahrzeuge elfkw

Elektroleichtfahrzeuge elfKW KG
elfkw.at Elfkw Elektrofahrrad Pedelec Elektroleichtfahrzeug
305 Startseite Frizbee DE frizbee.at

FRIZBEE.AT der erste Disc Golf Park im Allgäu
frizbee.at Frizbee.at Disc Golf Park Ofterschwang
306 Webdesign OnlineMarketing Webdesign

Webdesign OnlineMarketing (SEO Social Media etc.) und Texte aus professioneller Hand.
diwosch.at Webdesign Innsbruck SEO Innsbruck Texter Innsbruck
308 Startseite Digitalmarketing Box Digitalherz

Die Basis der Digitalmarketing Box stellen eine professionelle Website und eine attraktive mobile Website dar
digitalmarketingbox.at Digitalherz Websites Homepage Website Österreich
309 Www.goodybox.at | home

310 Der Uninformat – Wald

der Uninformat – Wald und WiesenWeblog 4.0. ... power« Der Â
311 Alternative und natürliche Begleitung Psychoneuroimmuno
Alternative und natürliche Begleitung psychischer und körperlicher Zustände wie Autoimmunkrankheiten Allergien Entzündungen in
tools-of-life.at Psychoneuroimmunologie Energetiker Wien Körperarbeit
312 Www.danieladesantosshop.at Königin der Daniela

Daniela dé Santos Königin der Panflöte Was ihr Name verspricht dürfen Sie auch
danieladesantos-shop.at Daniela De Santos Panflöte Königin Der
313 Betterlive.at Anti Aging anti

Kaufen Sie AntiAgingHautpflege KosmetikProdukte Gesichtscremes (Box Botox Gel NanoPlatinum Wimpern Wachstum
betterlive.at Anti Aging Kosmetik Online Kaufen Gesichtscreme
314 7WEBHOST Das moderne Hosting

Verschiedene Typen von Webhostings einschl. kostenloses Webhosting für Domains der 2. Ebene
7webhost.at Hosting Web Webhosting Freehosting
315 Batimat Isoliertechnik Batimat GmbH

316 Beautylogics Kosmetikstudio Verena Wien

Kosmetikstudio in 1130 Wien für Gesicht und Körper sowie medizinische Hand und Fußpflege mit Produkten
beautylogics.at Wien Kosmetikstudio Fußpflege Maniküre
317 Der BabyKlapperstorch zum Aufstellen FSR Solution KG Baby
In den letzten Jahren hat sich in vielen Regionen der Brauch durchgesetzt die Geburt
baby-klapperstorch.at Baby Klapperstorch Babystorch Baby
318 Public.ipax.at webhosting

summerer.at Webhosting Gameserver Rootserver Browsergames
319 Dr. med. René Summesberger
... rene.summesbergeraon
320 Summerofsun.at summerofsun
SummerOfSun White Edition 2011
summerofsun.at Summerofsun Clubbing Richracers
321 Summhammer: Bewegung zum Erfolg Kompetenzzentrum

Kompetenzzentrum für Kooperationen und Führungskräfteentwicklung
summhammer.at Kompetenzzentrum Für Kooperationen Und Führungskräfteentwicklung

323 BYTING.COM Domains

... bietet Ihnen perfekte Lösungen für Ihre Internetpräsenz. Wunschdomain inklusive (.at .co
324 Indientrip 2007

... ausnahmezustand herrschen da shoot at sight order seitens polizei/militaer gegeben wurde. laut den leuten
325 Sunday.at

326 ::gesco::

327 Sumverimmobilien.at

328 SUMO Das junge SUMO

SUMO Das junge OnlineMagazin
sumomag.at SUMO Magazin Sumo Magazine
329 Look by BIPA

330 Styler wrap styler

331 Www.styleroom.at:80 Domain parked domain

Europe Registry is your European wide domain name registrar providing complete coveragage of European ccTLD
styleroom.at Domain Names Domain Registration Europe
332 Unbenanntes Dokument

333 Style and Fashion

Style and Fashion. at ist ein Blog der sich mit Mode Accessoires
334 Stylinglounge A K

336 Willkommen im Styling House Friseur

Friseur Styling House Klagenfurt
stylinghouse.at Friseur München Friseur München Friseursalon München Coiffeur München
337 Start

338 Styriaintegra.at

339 Unbenanntes Dokument

341 Willkommen
Klagenfurt am Wörthersee
342 Www.allesstein.info Edelsteinhandel und Edelstein

Alles Stein Alexander Daniel Edelsteinhandel Edelsteinschleiferei
suits.at Edelstein Handel Schleifen Schleiferei
344 SuldaBahia Home

345 SullaCollina Serfaus SullaCollina

SullaCollina Serfaus Komfort Ferienwohnungen zum Wohlfühlen in Tirols neuer Skidimension auf dem Sonnenplateau
sullacollina.at SullaCollina Serfaus Ferienwohnungen Wohlfühlen
346 SULMTALBLECH sulmtal

Sulmtal Blech
sulmtalblech.at Sulmtal Blech
347 Sulmtalcup: ESV St. Martin



350 Styriaplant

351 Eine Regionalwährung der Steirischen

... mastaliertele.at
352 Su2.at url shortener

... welcome to su.at Welcome to www.su.at - the another short url too service which is only available
353 .:: Willkommen auf STUNT.AT Show
STUNT.AT der Veranstaltungs und Actionprofi in Österreich
stunt.at Show Stuntshow Shows Stunts Stunthows Stuntman Stuntmen Events
354 Www.sturmmuehle.at

355 Sturzgrabler Home Sturzgrabler

sturzgrabler.at Sturzgrabler Ennstal Blechblasmusik Sturzgram
356 Hoststar*

357 SoWi InfoLounge ÖH

Studierende helfen Studierenden
stv-soziologie.at ÖH Studieren Graz SOWI Soziologie Studierendenvertretung StV Soziologisch
358 Anzüge für Herren ::

Bei STURM erhalten Sie günstige Anzüge von hoher Qualität mit professionellem Service Marken oder
359 Praxis für Kinesiologie Buteyko

studiobauernfeld.at Buteyko Atemtraining Asthma Ventolin
360 ST.Veiter Füchse Startseite Fussball

Wir sind der Fanclub des FC ST.Veit
stveiterfuechse.at Fussball
361 EMobilität | Stadtwerke Klagenfurt Stadtwerke Klagenfurt AG Stadtwerke
Klagenfurt am Wörthersee
Stadtwerke Klagenfurt: Ihr Dienstleister in den Bereichen Strandbad Hallenbad Busse Energie
stw-emobil.at Stadtwerke Klagenfurt AG Energie Klagenfurt GmbH
362 Studierendenvertretung der FH Wiener
Wiener Neustadt

363 Telekom | Stadtwerke Klagenfurt Stadtwerke Klagenfurt AG Stadtwerke
Klagenfurt am Wörthersee
Stadtwerke Klagenfurt: Ihr Dienstleister in den Bereichen Strandbad Hallenbad Busse Energie
stw-net.at Stadtwerke Klagenfurt AG Energie Klagenfurt GmbH
364 STWP

365 Stvfhs.at

366 Willkommen auf der Startseite ÖVP

Webpräsenz der ÖVP Raaba
stvp-raaba.at ÖVP OEVP STVP Raaba
367 L.Subosics.KEG

368 Domain geparkt

369 Subplan Mathias Falkner.

... office subplan Arbeitsproben siehe links und rechts
370 Metallortung.at | Auftragssuche ?

Metallortung.at setzt sich aus professionellen Sondengängern aus den verschiedenen Bundesländern Österreichs zusammen. Seit mehreren Jahren
371 Hier entsteht eine neue

372 Werbeagentur Gleisdorf webdesign

Die Firma SG bietet Webdesign Onlinshop Design / Druck Mystery Shopping und
sundg.at Webdesign Onlineshop Design Druck Beratung Werbeagentur Gleisdorf Internetagentu
373 SuiCidE ? Death /

374 Struber Schützen Werfen

375 Zimmerei Spenglerei Zimmerei

Die Zimmerei Spenglerei Dachdeckerei Strohmeier ist Ihr Spezialist rund ums Dach. Unsere Haupteinsatzgebiete
strohmeier-dach.at Zimmerei Spenglerei Dachdeckerei Steiermark Graz
376 Frank Stronach Institut |

377 Shorturl doesn't exist!

378 Home Ski
Berg im Drautal
SV Berg im Drautal Der Skiverein im Oberen Drautal Oberkärnten
sv-berg.at Ski Berg Im Drautal SV
379 SV Opbacher Fügen SV
SV Fügen Tiroler Fußballverein
sv-fuegen.at SV Fügen Opbacher Landesliga Ost
380 Svkauns.at

381 Home SVMitterndorf

382 Willkommen auf der Startseite Sportverein

Sportverein Rinn
sv-rinn.at Sportverein Rinn Tirol Klumper Tennis Fussball Rodeln Kunstbahnrodeln
383 SV SOS Kickers

384 World4You Kundenwebsite Hosting

Webspace und Webhosting sowie Domain Rootserver und Domainregistrierungen. Ihr Provider aus Österreich / Austria mit
sv-staw.at Hosting Provider Webspace Webhosting
385 Offizielle Homepage des Sportverein Steuerberg

Offizielle Homepage des Sportverein STEUERBERG
sv-steuerberg.at Steuerberg Fußball Tabellen Spielberichte
386 InsolvenzverwertungenVerwertungenInsolvenzverwertungKonkursverwertungInsolvenz VerwertungenenIndustrieverwertung insolvenzverwertu
Insolvenzverwertungen Verwertungen Konkursverwertung Insolvenz Verwertungen führen wir für Insolvenzverwalter Zwangsverwalter Gerichte Kreditinstitute und Industrie
sv-verwertungen.at Insolvenzverwertungen Verwertungen Konkursverwertung Insolvenz Verwertung Vermar
387 Page Redirection

388 Webspace Domain Webspace

Webspace und Domain zu sonnigen Preisen = Webhosting powered by beachwebspace.de und toptip.net
swat-graz.at Webspace Domain Domain Webspace Webhosting
389 Swatch Onlineshop at Swatch
Große Auswahl von Swatch Uhren Swatch Uhrbänder bis Swatch Bijoux Schmuck im Swatch Onlineshop
swatch-store-linz.at Swatch Uhren Swatch Uhrbänder Swatch Bijoux
390 SWEET ART ...Reinlinde

391 Wellness mit Swelltess Wellness

Sie finden bei Swelltess traumhafte Wellness Angebote Pauschalen und Lastminute der schösten Wellnesshotels
swelltess.at Wellness Vitalhotels Wellnessangebote Lastminute
392 World4You Kundenwebsite Hosting

Webspace und Webhosting sowie Domain Rootserver und Domainregistrierungen. Ihr Provider aus Österreich / Austria mit
svetplus.at Hosting Provider Webspace Webhosting
393 1.SVg Guntramsdorf weiterleitung


395 SV Pöttinger Grieskirchen Grieskirchen
Dies ist die offizielle Site des SV Pöttinger Grieskirchen. Hier finden Sie alle Informationen rund
svgrieskirchen.at Grieskirchen Oberösterreich Regionalliga Mitte Training
396 SV Gutenberg sportverein

Der SV Gutenberg stellt sich vor.
svgutenberg.at Sportverein  gutenberg  sv  sv gutenberg
397 SV Neuhofen im Innkreis Neuhofen

SV WigoHaus Neuhofen....
svneuhofen.at Neuhofen Fußball Tennis Fair Players
398 JescheReisenauer GesmbH Sachverständige

Im SVNetzwerk haben sich Sachverständige aus allen Teilen der Baubranche und „Alles rund ums Haus“
svnetz.at Sachverständige SV Graz Steiermark
400 Homepage SVLAUSSA
Homepage des Sportvereins Laussa
svlaussa.at SVLAUSSA SVLAUSSA Laussa Sportverein Laussa
401 Pool pool

Pool Schwimmbecken Schwimmbad Pools und Swimmingpool sowie Pool Zubehoer Abdeckplane Poolleiter Solarplane Skimmer Sandfilter Poolsauger
swimming-pool-roboter.at Pool Swimmingpool Schwimmbecken Pools
402 SWIMPEX Pfandleihhaus DAS geld

Swimpex Pfandleihhaus
swimpex.at Geld Probleme Bar Pfand
403 Keine Weiterleitung definiert!

404 SWISSVAX Österreich
... Sie Swissvax AT
405 [SWL] Strasser War Lords Österreich

eSports Clan Page [SWL] Strasser War Lords
swl-clan.at Österreich ESports Gaming Call Of Duty Modern Warfare
406 SWM Supper Wellness SWM

SWM Supper Wellness Massage Graz
swm-graz.at SWM Supper Elisabeth Supper Wellness
407 Automobile Swoboda AlpenstraÃ?e

408 Sportverein Olympisches Dorf /

409 Willkommen bei den Juniors Jugend

Jugend sportverein Neumarkt im Hausruckkreis
svn-juniors.at Jugend Fußball Neumarkt U16
410 Willkommen auf der Seite joomla

TTC SVOMV Gänserndorf
svomv-tischtennis.at Joomla Joomla
411 Willkommen beim SVS BSC Bogenschießen

SVS BSC Schwechat
svs-bsc-schwechat.at Bogenschießen Archery SVS Schwechat
412 Startseite SV Tillmitsch

414 SVSchwechat Home

415 SV Modehaus Hofbaur Windischgarsten

416 SW Foto SWFotos
SWFoto Stefan Wolf der Fotograf aus scharnitz
sw-foto.at SWFotos SW Foto Schwarz Weiss Fotos
417 SVBüro Dr. Strigl Technische Gutachten

Sachverständigenbüro Dr. Strigl; Technische Gutachten und Schadenanalysen im Auftrag von Gerichten Versicherungen
sv-strigl.at Gutachten Versicherung Versicherungsgutachten Gerichtsgutachten
418 SV Völs | Home svvoels.at
sv-voels.at Svvoels.at
419 Svwattental your

Your description goes here...
sv-wattental.at Your Keywords Goes Here
420 Portal Sportverein Umhausen Fußball

Fussball in Tirol Offizielle Homepage des Sportvereins Umhausen im Ötztal
sv-umhausen.at Fußball In Umhausen Tiroler Fussball Veranstalltungen
421 Svteam.at

422 Ing. Kurt Zuber Sachverständiger

Ing. Kurt Zuber Sachverständiger für Gebäude Liegenschaftsbewertung
sv-zuber.at Sachverständiger Gebäde Liegenschaftsbewertung Versicherung
423 World4You Kundenwebsite Hosting

Webspace und Webhosting sowie Domain Rootserver und Domainregistrierungen. Ihr Provider aus Österreich / Austria
svdk.at Hosting Provider Webspace Webhosting
424 SVEN fine handcrafted

425 Domain geparkt

426 Mikrobiologische Analysatoren und programmgesteuerte Mikrobiologische
Mikrobiologische Analysatoren und programmgesteuerte Gefriergeräte bei SYLAB Geräte GmbH
sylab.at Mikrobiologische Analysatoren Mikrobiologie Pathogene
427 T + A Home T+A

taelektroakustik.at T+A
428 Taekwondo Uttendorf Startseite Taekwondo
Taekwondo Verein Uttendorf im Innviertel
taekwondo-uttendorf.at Taekwondo Uttendorf Innviertel Poomse Selbstverteidigung Wettkampf Olymische Dis
429 Tagesschule Krieglach Tagesschule

tagesschulekrieglach.at Tagesschule Krieglach Tagesschule Krieglach Marktgemeinde
430 Takemetobed.at

432 Untitled Document

433 Kinderpsychologie Innsbruck Kinder Kinderpsychologie

Taktik steht für Kinderpsychologie in Innsbruck. Wir ermöglichen es Kindern sich konstruktiv mit seinen
taktik-nosko.at Kinderpsychologie Innsbruck
434 Diese Domain wurde für

435 Aikido Takeda Budokan Aikido

Aikido Iaido Jodo uvm. mit Takeda Budokan Wien erlernen. Sie erreichen uns unter
takedabudo.at Aikido Wien
436 Thomas Mussger Moderator Talk Thomas

Thomas Mussger Talk Media Ihr Moderator Sprecher und Trainer
talk-media.at Thomas Mussger Moderator Talk Media
437 Fehlermeldung talkbase

438 Home Talking Drum

439 Talmuseum Hüttschlag

Talmuseum Hüttschlag Das Museum im Großarltal; Auch die Alte Wacht im Großarltal gehört zum

Ein Befestigungssystem mit Lösungen für alles was Sie an Ihrem Boot Fahrzeug hinzufügen möchten.
441 Ferienwohnungen Zillertal Talhammerhof Ferienwohnungen

Ferienwohnungen Talhammerhof wunderschöne traditionell eingerichtete Appartements in Uderns mitten im Herzen vom
talhammerhof.at Ferienwohnungen Zillertal
442 TAMYKO Fashion by Tanja Fashion

tamyko.at Fashion
443 Gleitschirm Tandemflüge Paragliding Tandemfliegen www.tandemkurt.at

Gleitschirm Tandemflüge Paragliding Montafon mit Tandem Kurt Kurt Burger in Gaschurn Schruns und
tandemkurt.at Www.tandemkurt.at Tandemfliegen Montafon Schruns Gaschurn

445 Tanjas Mobile Fußpflege Tanjas

tanjasfusspflege.at Tanjas Mobile Fußpflege Kosmetik Mobile Fußpflege
446 Tangram 3DS Architektur

... UAE The Towers at Longfellow Description Details Wohnung in Dubai Description Details
447 Aktuelles Hier
Hier gibt es aktuelle Infos: NLP Practitioner Graz Büchershop NLP Ausbildung Graz
tanjakaufmann.at Hier Gibt Es Aktuelle Infos: NLP Practitioner Graz
448 Tankstelle | Ried im Tankstelle

Ihre BP Tankstelle in Ried im Innkreis Familie Streissenberger heißt Sie in Geiersberg herzlich
tankstelle-ried.at Tankstelle Ried Im Innkreis Tankstelle Ried
449 Tantra Institut TANTRA Tantra

TANTRA Institut Kurse Seminare Workshops mit Bewegung Berührung Begegnung
tantra-institut.at Tantra Yoga Kundalini Shakti
451 Tanzbar Stöhr Tanzmusik Tanzbar

Tanzbar Stöhr Ihr Tanzlokal für besondere Stunden. Kennenlernen flirten tanzen verlieben
tanzbar-stoehr.at Tanzbar Stöhr Tanzmusik Disco
452 Home joomla

Joomla! dynamische PortalEngine und ContentManagementSystem
tanzband-firstclass.at Joomla Joomla
453 Tanzcafe Schindler

454 Diakoniewerk evangelisches
Diakoniewerk Aktiv für Menschen im Alter Menschen mit Behinderung Ausbildung Gesundheit
tagesklinik-linz.at Evangelisches Diakoniewerk Gallneukirchen Diakoniewerk Gallneukirchen
456 Lebensraum | Individuelle Betreuung


458 Taigner.at

459 OMAi | Tagtool for

Paint and animate live go big with a projector work as a team. ... painting and animating at any time. Simply swipe inwards from the screen border to change mode. Animate

461 Takeme.at

462 Actors Tanja Siefert

463 Tankreinigung Tankreinigung 24 Forgom GmbH Tankreinigung
Mit Tankreinigung 24 finden Sie den günstigsten Tankreinigungsanbieter in Ihrer Nähe! Schnell günstig ... Tankinnenbeschichtungen Leckschutzauskleidung PLZ Tankreinigung.at - Das Tankreinigungsportal
tankreinigung24.at Tankreinigung Tankschutz Öltankreinigung Tankinspektion
464 Home

466 Home Tennis

Tennisverein Haslau/Maria Ellend
tc-haslau-mariaellend.at Tennis Haslau Maria Ellend Tennis
467 Domainname nicht verfügbar /

468 Tckoessen.at AKTUELL

469 Untitled

470 Startseite TC Seebenstein TC
TC Seebenstein Alle Informationen zum Tennisclub SeebensteinSchiltern Sportliches Meisterschaft Mitgliedschaften
tc-seebenstein.at TC Seebenstein Seebenstein Tennis Tennisclub
471 Taxi Schwendinger Taxi Schwendinger GmbH

472 Taxi City Süd Mödling

473 Taxi 3430 Tulln | Taxi

Taxi Berger 3430 Tulln Anrufsammeltaxi Krankentransporte wir stehen Ihnen rund um
taxi-berger.at Taxi Tulln Taxi 3430 Tulln

475 Taxi Imst taxi

Taxiunternehmen Westtirol Leys Ihr TopTaxi Team in Imst
taxi-imst.at Taxi Funktaxi Imst Soelden
477 Taxi Enns LinzLand Taxi

Schnell vor Ort Taxi in Claudia in Enns Bezirk LinzLand 365 Tage
taxi-claudia.at Taxi Enns Taxi LinzLand
478 Taxi Telfs Gebhart Taxi

Taxi Gebhart für Sie rund um die Uhr unterwegs im Raum Telfs und Innsbruck
taxi-gebhart.at Taxi Telfs
479 Domain Does Not Exist

480 Taxi Edt | Lambach Taxi

Taxi EdtLambachGunskirchenWels Krankentransport Elite Personenbeförderung KG
taxi-elite.at Taxi Edt Taxi Lambach Taxi Gunskrichen
481 Taxi Vorarlberg | Taxi Taxi

Taxi Greber – Ihr treuer und zuverlässiger Taxiservice in Vorarlberg. Wir freuen uns Sie
taxi-greber.at Taxi Vorarlberg Taxi
482 Taxi Mathis

483 Unbenannt3

484 Welcome to the Frontpage Taxi

Taxi Vondrak ist Ihr Taxiunternehmen in Leonding Traun Pasching und Hörsching.
taxi-vondrak.at Taxi Vondrak Vondrak Taxi Taxiunternehmen
485 Taxi 6969

486 Taxi Stockinger | Haid Taxi

TaxiStockinger ist Ihr Taxi in Haid Ansfelden und Traun. Fahren Sie sicher und bequem
taxi-stockinger.at Taxi Stockinger Taxi Haid Taxi Ansfelden
487 Flughafentransfer Krankentransporte Zell Kitz

Flughafentransfer Krankentransporte Zell am See / Kaprun | Airport Transfer nach Kaprun oder Zell
taxikaprun.at Kitz Kitzsteinhorn Gletscher Airport Taxi
488 ::: tomorrow systems ::: klettersteig
Nassereith - Austria
tomorrow systems austria we specialize in softwaredevelopment for the woodindustry. In contrast we sponsor
taxidermist.at Klettersteig Tomorrow Software Consulting
489 Taxiandrieu.at

490 Taxi | Bezirk Mödling taxi

Taxi Mühlauer Ihr TaxiUnternehmen im Bezirk Mödling. Wir bringen Sie schnell und sicher an
taxi1-md.at Taxi Mödling
491 Taxi Villach City Taxi

Alles bei City Taxi aus Villach: Buchen Sie eine unvergessliche Fahrt in einem LondonTaxi
taxi-villach.at Taxi Villach Eventtaxi Villach Ausflugsfahrt Villach
492 Taxi Velden | Mietwagen Taxi

Taxi Mietwagen Velden? Kein Problem Taxi Schulnig ist für Sie Tag und Nacht
taxi-schulnig.at Taxi Velden Mietwagen Velden Taxi Kärnten
493 Www.111.com DNSNET GmbH Hosting

DNSNET GmbH offeriert Speicherplatz f?r Ihre Homepage Domain Name Registrationen .COM .NET .ORG .INFO
taxsaving.at Hosting Homepage Domain Registration Domain

495 Index of /

... Index of Name Last modified Size Description Apache Server at www.taylors Port
496 ::: tomorrow systems ::: klettersteig
Nassereith - Austria
tomorrow systems austria we specialize in softwaredevelopment for the woodindustry. In contrast we sponsor
tauferberg.at Klettersteig Tomorrow Software Consulting
497 Taxservices Steuerberatung Steuerberatung

Als moderne dynamische Steuerberatungskanzlei mit Schwerpunkt auf der Dienstleistungs und Kreativbranche ist es uns wichtig
taxservices.at Steuerberatung Währing Buchhaltung Lexikon
498 TBBreuer Technisches

MEIN ZIEL Professionelle Planung kostengünstige und wirtschaftliche Umsetzung MEIN MOTTO Qualität muss nicht teuer sein
tb-breuer.at Technisches Büro Buero Erich Breuer Neusiedl Pernitz Wildbaschstrasse
499 Technisches Büro Breg GmbH: Technisches

Die Technisches Büro Breg GmbH aus Braunau am Inn ist Ihr zuverlässiges Planungsbüro für Elektrotechnik
tb-breg.at Technisches Büro Breg GmbH Planungsbüro
500 Technisches Planungsbüro Heinrich Drochter

Technisches Planungsbüro Ing. Heinrich Drochter: Beratung und Planung im Bereich haustechnischer Anlagen Leistungen der
501 TB Ing. Heiling Ges.m.b.H.

502 Technisches Buero Schrottner

503 UPC: Domain Information

504 LIWEST Kabelmedien GmbH

505 Technisches Büro Buchauer Markus Markus

TBBM Technisches Buuml;ro fuuml;r Meteorologie Buchauer Markus Verarbeitung und Auswertung Naturwissenschaftlicher Daten für Meteorologie
tbbm.at Markus Buchauer Temperatur Wasserstand Pegel Durchfluss Niederschlag Messungen
506 Thomas Berghuber

507 Thomas Birn Mobile Thomas

Webpräsenz von Thomas Birn. Präsentation von ausgewählten laufenden Projekten
tbirn.at Thomas Birn Mobile Development Android
508 Tbbf.at

510 Willkommen bei TBH TBHajek

Hajek Engineering. Die TBH ist ein innovatives Engineering Unternehmen mit Sitz in Perchtoldsdorf Nahe
tbhajek.at TBHajek Hajek Hajek Engineering Engineering Erdölanlagenbau Chemieanlagenbau Gas
511 Ingenieurbüro Steiermark Vermessungsbüro Vermessungsbüro

Vermessungsbüro Simenko Ihr Spezialist für Vermessungen in der Steiermark. Profitieren Sie von jahrelanger Erfahrung
tb-vermessung.at Vermessungsbüro Steiermark Ingenieurbüro Steiermark
512 PAYR Engineering PAYR engineering

Abwicklung von EngineeringProjekten für unsere Kunden im Bereich der Konzeption Konstruktion Detaillierung und
tbm-payr.at Engineering Production Payr Automobilindustrie Schienenfahrzeugbau Luftfahrtindu
513 TBV Linz

514 Startseite joomla

Joomla! dynamische PortalEngine und ContentManagementSystem
tbitec.at Joomla Joomla
515 Tcamade.at

516 Home Tennis

Willkommen beim TCFischamend
tc-fischamend.at Tennis Fischamend TCFischamend Fischamend
517 Urlaub in Skiamade Radstadt Hotel
Das Bauernhofhotel bietet Urlaub am Bauernhof im feinen Hotel Taxerhof. Streicheltiere und das Bauernhoferlebnis sind
taxerhof.at Hotel Zimmer Appartement Ferienwohnung
518 Bilanz Linz | Buchhaltung

519 Confixx

520 TechnoKontakte SeminarVeranstaltungs GmbH. BestPractice

Best Practice ManagementSeminare Magazin und Club Österreich Deutschland und Südtirol
technokontakte.at BestPractice Seminare Manager Seminare Wien
521 Techwerk IT Solutions edv

Techwerk IT Solutions. Expert EDV Dienstleistungen aus Klagenfurt. IT Administration IT Optimierung
techwerk.at Edv Beratung Edv Dienstleistungen Edv Dienstleistungen
522 Index of /

... Index of Name Last modified Size Description Apache/.. Server at www.tecma Port
523 TECOM Engineering Consulting Tecom
Planen und berechnen können viele. Wir wollen mehr für sie tun. Optimale Lösungen für Ihre
tecom.at Tecom Engineering Consulting Planung Beratung Berechnung Ausführungsunterlagen I
524 Index of /

526 TEderStartseite EDV
Treffen am Ossiachersee

teder.at EDV IT Eder TEDERIT
527 TEEKANNE Österreich

528 Telekom Presse Aktuell
Aktuelle News über Telekommunikation und Internet. Die Telekom Presse testet laufend Geräte die Ihren ... -News www.boerse-express/boerse Der größte Wirtschaftsblog www.be.at/
telekompresse.at Aktuell Anwendungen Applikationen Betriebssysteme Breitband Bilanzen Blog Browse
529 AbZ TeleHoME GmbH

530 Teldust A/S

531 Telekommunikation in der Steiermark telekommunikation

Telekommunikation in der Steiermark. Telekom Valentek ist Ihr professioneller Ansprechpartner! Tel. +43(0)316/721366.
telekomvalentek.at Telekommunikation Steiermark
532 Telepower 1230 Wien Telepower

Telepower Ihr Telemarketing Team in 1230 Wien! Kontaktieren Sie uns unser Team steht
telepower.at Telepower Telepower 1230 Telepower Wien
533 Teleskop und Sternwarte Zentrum

534 Teleteam.at Professional Solutions xlink

xLINK Multikom Austria telekom ist ein innovativer Internet Telefon und Fernsehbetreiber mit eigenen Netzen.
teleteam.at Xlink Multikom Austria Telekom
536 Kioskterminal Digital Signage Systeme Kioskterminal

Wir bieten Ihnen eine umfangreiche Produktauswahl an Kioskterminals Digital Signage Terminalsystemen Public Displays
telkon.at Kioskterminal Infoterminal Internetterminal Kiosksystem Infokiosk Outdoor Digita
537 TellUs. Leader in online Tellus

TellUs is a leader in online (sales) lead generation. Grow your business with TellUs. Hot ... leads for companies like yours. At TellUs we service any country and a wide variety of businesses. Our
tell-us.at Tellus Quotes Compare Request
538 PhlyMail Lite

539 TellUs. Leader in online Tellus

TellUs is a leader in online (sales) lead generation. Grow your business with TellUs. Hot ... leads for companies like yours. At TellUs we service any country and a wide variety of businesses. Our
tellus.at Tellus Quotes Compare Request
540 Startseite Temperaturen der Netzmühle GmbH Wassertemperature
Aktuelle Wassertemperaturen rund um Salzburg
temperatur-fuschlsee.at Wassertemperaturen Salzburg Seen Temperatur Wasser
541 Turnanzüge Neue Kollektion
DG Utrecht
Ihr Online Shop für Turnanzüge und Turnkleidung. Online Turnanzüge bestellen zur verlockenden Preisen. Schnelle Lieferung!
542 Startseite Temperaturen der Netzmühle GmbH Wassertemperature
Aktuelle Wassertemperaturen rund um Salzburg
temperatur-wolfgangsee.at Wassertemperaturen Salzburg Seen Temperatur Wasser
544 Österreichische Tempest Vereinigung | tempest

Willkommen bei der österreichischen Tempest Vereinigung! Wir informieren Sie über aktuelle Regatten der TempestKlasse und
tempest.at Tempest Segelboot Kielboot Tempest Wm
545 Temptu.at Mariana
Temptu Pro Airbrush MakeUp OnlineShop Mariana Hiebl Wien
temptu.at Mariana Hiebl Temptu Fashion Style
546 Tanzschule Heidenreich Wien Tanzkurs

Die Tanzschule Heidenreich 10dance ist eine innovative und besonders jugendfreundliche Tanzschule in 1100
heidenreich.at Tanzkurs Kinderkurs Dance Dancing
547 TELDomainForum Informationen zur Movetec GmbH

548 TELECOACHING MCW Medical TeleCoaching

Information zu TeleCoaching Gesundheitsakte
tele-coaching.at TeleCoaching Befundkarte MCW Medical Computer
549 Teilereinigungsanlagen MAP PAMMINGER Teilereinigungsan

Teilereinigungsanlagen MAP Pamminger ist Ihr Spezialist für Anlagen zur Teilereinigung. Tel.: +43 (0)7612 /
teilereinigungsanlagen.at Teilereinigungsanlagen
550 Startseite TEKA
TEKA Austria GmbH Webshop
teka-swiag.at TEKA Austria GmbH
552 Tridor Webshop Geschenke Kaffeerösterei Reinhard Trixl KG Reinhard
Zell am See
Tridor Tee Kaffee aus Zell am See Pinzgau Salzburg Austria ... Trixl KG Kaffeerösterei Teegroßhandel · Areitstraße · A- Zell am See · AT-BIO- +
kaffee-selber-mischen.at Reinhard Trixl Tridor Kaffeerösterei
553 Teichfolie (TeichFolie.at) teichfolie

Wie berechne ich meine Teichfolie? Welche Teichfolie ist die beste: PVC Teichfolie EPDM Teichfolie ... Lieferung frei Haus D ab ? darunter ?. Lieferung frei Haus AT ab ? darunter ?. Versandkosten
teich-folie.at Teichfolie
554 Teichschenke in SitzenbergReidling ?
Die Sitzenberger Teichschenke freut sich über Ihren Besuch. Erholen Sie sich in unserem Restaurant und
555 Teichzaun Steckzaun Zaunbau

Alt Wiener Gusswaren Online Shop Garten und Stadtmobiliar aus Gusseisen Parkbänke
teichzaun.at Zaunbau Steckzaun Teichzaun Biotop Zaun
556 Teichbau | Schwimmteiche | Teichbau

Willkommen bei der Teichbau GmbH! Wir sind spezialisiert auf die Planung und Ausführung von Schwimmteichen
teichbau.at Teichbau Steyr Teichbau OÖ Teichbau Linz
557 Teiflstoana Teiflstoana

teiflstoana.at Teiflstoana Krieglach Krampus Percht
558 Cabanova

559 Index.html

560 Contenido Contenido

Dies ist ein DemoFrontend von Contenido.
teigwaren.at Contenido CMS Four For Business AG
561 Konrath Teichkönig Konrath Konrath

Konrath Teichkönig Ihr Fachmann rund um's Thema Teichbau. Kontaktieren Sie uns Wir
teichkoenig.at Konrath Teichkönig
562 Autoteile Direkt: Autoersazteile und

Teiledirekt.at: Erstklassig? Autoersatzteile für Opel VW Audi BMW und viele andere Automarken
563 Cabanova

564 Startseite Teklits.at Teklits
Teklits.at Moderne und semantisch richtige Gestaltung von Websites
teklits.at Teklits Teklits Stefan Stefan
565 Share a CocaCola

566 Home

567 Babysitter Tagesmutter Babysitten und Besser Betreut GmbH Babysitter
Babysitter Suchen Sie KOSTENLOS nach Kinderbetreuung und Babysitter Betreut de ist Ihr Anlaufpunkt mit Qualität
betreut.at Babysitter Tagesmutter Babysitten Betreuung
568 Telofax Shop

569 TEMPUS  Home  Tempus Tempus GmbH Tempus
Tempus Zeit schaffen
tempus.at Tempus Zeit
571 Tenne 11 ? der
Tenne 11 ist euer Club mit garantiertem Partyalarm in 1110 WienSimmering. Erfrischende Drinks und eine
572 Tennengauer Krampusse

573 LuckySoft Programmierung

574 .: Wohnungen NÖ HAUSWIRTH & PARTNER wohnung
Gruenbach a. Schneeberg
Wohnung im Grünen mit Fernblick in den Wiener Alpen. Im südlichen Niederösterreich werden Sie sich
tenement.at Wohnung Biete Suche M²
575 SV Schwarzach | Sektion Tennis

Vereinshomepage SV Schwarzach Sektion Tennis. Sportplatzstraße 14 | 5600 Schwarzach | Tel.: 06415 / 7074
tennis-schwarzach.at Tennis Schwarzach Aufschlag Tiebreak Wilson Babolat Head Tennisball
576 Tennistraining.at Das Tennisportal tennistraining.at

tennistraining.at Mit Tipps wie Sie ihr Tennisspiel um 2 Klassen verbessern können!
tennis-training.at Tennistraining.at Das Tennisportal Tipps Taktiken
577 Bali Surf School

surace.at SURACE I News
579 Bali Surf School

580 Autoteile Q11 Kfz

581 SupportedBy Musik

Der Proberaum stinkt dir? Deine Band du sind bereit für die Bühne? SupportedBy ist
supportedby.at Musik Music Tracks Lieder Songs Hochladen Upload Mp3

584 Susanna Andreini FigurenKunst

585 Kickstart surfnwosgeht.at Österreich
Die Homepage aus Österreich mit dem Windbericht für alle Windsüchtigen und die die
surfnwosgeht.at Österreich Oberösterreich Linz Windsurfen Kitesurfen Surfen Windbericht Surfspot
586 Welcome to nginx!

587 Anleitung zum Supergau Anleitung
Anleitung zum Supergau Wie man ein Seminar garantiert in den Sand setzt. Ein kleiner
supergau-seminar.at Anleitung Ratgeber Supergau Seminar
588 Superhund.at

589 Superknarre.at Westfalia Werkzeugco. GmbH & Co KG Superknarre
Die Superknarre ist ein spezielles Werkzeug um Schrauben und Muttern anzuziehen. Sie hat einen
superknarre.at Superknarre SuperKnarre Super Knarre
590 World4You Kundenwebsite Hosting

Webspace und Webhosting sowie Domain Rootserver und Domainregistrierungen. Ihr Provider aus Österreich / Austria mit
superlooper.at Hosting Provider Webspace Webhosting
591 Superled.at

592 Skischule Sölden Vacancia Total Outdoor
Willkommen bei Vacancia Outdoor. Wir bieten unglaublich viele Sommer und Winteraktivitäten im wunderschönen Ötztal /
supermaex.at Outdoor Ötztal Skischule Sölden
593 SUPER RTL Schön

594 Elektronische Zigarette Österreich ERauchen

EZigaretten kaufen die elektronische Zigarette Supersmoke jetzt auch in Österreich Deutschland Schweiz.
supersmoker-elektronische-zigarette.at ERauchen EZigarette Online Shop Elektro
595 Default Parallels Plesk Panel

... the leading hosting automation software. You see this page because there is no Web site at this
596 Psychotherapie Wien 1030  Psychotherapeut Psychotherapie

Psychotherapie Paartherapie Kindertherapie Supervision Coaching Gruppentherapie ... =. .spn=. .hnear =Juchgasse+ +Landstra%C%Fe++Wiengl=att=mz=vpsrc=
supervision-psychotherapie.at Psychotherapie Paartherapie Kindertherapie Supervision
597 Suntools Pools suntools

Steinbach frische Ideen für Sommer und Sonne. Freizeit im Garten schöner gestalten mit Swimmingpools aus
suntools.at Suntools Pool Boot Poolreinigung
598 Sunwash Waschanlage
Sunwash ist Ihr Spezialist für umweltfreundliche SBWaschanlagentechnik. Modernste Technik aus erneuerbaren Energieträgern.
sunwash.at Waschanlage Sonne Solar Sunwash
599 Sunshineranch.at

601 Sonnenschutz Beschattung Linz Oberösterreich Sonnenschutz

Unsere Sonnenschutz und BeschattungsSysteme passen wir genau Ihrem persönlichen Geschmack und den Gegebenheiten an –
suntex.at Sonnenschutz Linz Sonnenschutz Oberösterreich Beschattung Linz
602 Sunset Garden

603 Superknarre.at Westfalia Werkzeugco. GmbH & Co KG SuperKnarre
Die Superknarre ist ein spezielles Werkzeug um Schrauben und Muttern anzuziehen. Sie hat einen
super-knarre.at SuperKnarre Superknarre Super Knarre
605 World4You Kundenwebsite Hosting

Webspace und Webhosting sowie Domain Rootserver und Domainregistrierungen. Ihr Provider aus Österreich / Austria mit
supercrew.at Hosting Provider Webspace Webhosting
606 Innenarchitektur Linz | Planung Innenarchitekt

Ihr Partner für Innenarchitektur Planung und innovative Einrichtungskonzepte Gastronomieeinrichtungen. Firmensitz Nähe Linz
supastudio.at Innenarchitekt Innenarchitektur Linz Planung Linz
607 Superfeucht Offizielle

superfeucht.at Offizielle Homepage Von Superfeucht
608 Metalltechnik und Schmied im

Sie suchen einen kompetenten Schmied im Bezirk Horn der Ihnen Arbeite rund um Stahl
610 Startseite SUCSESS

611 Kundenseite Coming Soon

612 Aktuelles Film
Verein zur Förderung von Filmen anspruchsvolle filmische Unterhaltung kulturelle Vorurteile und gesellschaftliche Schranken
suedfilmfest.at Film Kino Kino Zum Guckuck
613 OXID Surfund KiteShop | kite

Alles zum Thema Wassersport Sportbekleidung und Mode. Umfangreiches Produktsortiment mit den neusten Trendprodukten. Blitzschneller
suedtirol-holz.at Kite Kites Kiteboarding Kiteboards
614 Wohnen mit Luxusmöbel von Luxusleben

Sueno Design Ihr Spezialist für luxuriöses Wohnen mit Liebe zum Detail. Unsere Unikate werden
suenodesign.at Luxusleben Luxusartikel Luxusmöbel Luxusgüter
616 SunFX Germany

617 Sunnseit Team Ellmau


619 World4You Kundenwebsite Hosting

Webspace und Webhosting sowie Domain Rootserver und Domainregistrierungen. Ihr Provider aus Österreich / Austria
sunnyb.at Hosting Provider Webspace Webhosting
620 SunriseMusic

621 >> Sunrise Studios

Sunrise Studios Sunrise Konservatorium Musical Musical School Musical Ausbildung
622 Startseite

623 Sunrise Paradise| Spirulina

Nahrungsergänzung ökologisch natürlich fünfElementeErnährung Biologisch Fusswohl Fussschweiss Sonnenschutz
sunrise-paradise.at Spirulina Chlorella AmlaC Guarana Stevia


626 Sunrise.at

627 SunshineParadise Ihr KrillölVersand Omega
Ihr KrillOilVersand
sunshine-paradise.at Omega 3 Antioxidantien Phospholipide Neptune
628 Sunshine Installationstechnik (Gas gas

Willkommen bei Sunshine Installationstechnik. Ihrem Partner bezüglich Gas Wasser Heizung Lüftung Klima
sunshine-technik.at Gas Wasser Heizung Lüftung
629 Appartments Salzburg Haus golling

Wohlfühl und Aktivurlaub im Süden der Mozartstadt Salzburg inmitten der schönsten Skigebiete des Salzburger
suns.at Golling Appartments Salzkammergut Salzburg Land Salzburgerland Urlaub Sommer
631 1. Salzburger Tauchcenter tauchen tauchen

Salzburger Tauchcenter die Nummer 1 für unterwasser tauchen sport tauchen und tauchkurse in salzburg.
suunto-tauchen.at Tauchen Tauchen Salzburg Sport Tauchen Tauchshop Tauchshop Salzburg
632 Suxxess consult Unternehmensberatung GmbH Unternehmensberat

Homepage der suxxess consult Unternehmensberatung GmbH in 7423 Pinkafeld Burgenland Österreich
suxxess.at Unternehmensberatung Webmarketing WebDesign Webdesign
633 BeWerben statt StErben | Bewerbungsschreib

Wie schreibe ich eine Bewerbung? Bewerbungsschreiben Vorlagen Lebenslauf Anschreiben Ratgeber und ... bewerbung stipendium vorlage bewerbung muster SuXperia atErfolgreicherLeben bewerbung wie schreibe
suxperia.at Bewerbungsschreiben Bewerben Statt Sterben Lebenslauf
634 Simon Kurz GmbH AVA

Planung Bauleitung und Beratung für Wohnbau und Sanierung bauphysikalische ind baubiologische Berechnungen
sv-bmst.at AVA Abrechnung Ausschreibung Bau
635 SV Grünbach

636 SVHaiming

637 SV Erlauf :: Herzlich Erlauf

Sportverein Raika Erlauf hier wird FUSSBALL gro?geschrieben! Sie erfahren alles ?ber die Spieler
sv-erlauf.at Erlauf SV Erlauf Sportverein Erlauf
638 Surfschule Segelschule Ossiacher surfschule

Surfschule Segelschule Ossiacher See Kärnten Annenheim mit eigener Marina Kinderkursen und Bootsverleih.
surf-segelschule.at Surfschule Ossiacher See Segelschule Ossiacher See
639 Institut für ganzheitliche Kosmetologie Problemhaut

Kosmetik Susanne Fachinstitut für ganzheitliche Kosmetologie
susanne-kosmetik.at Problemhaut Ultraschall Lymphdrainage Bionom
640 Domainparkplatz

641 Seitentitel

643 Physiotherapie Wiener Neustadt physiotherapie

Physiotherapie in Wr. Neustadt Raugasse 15 2700 Wr. Neustadt. Schmerztherapie und Hausbesuche in
susannewehrl.at Physiotherapie Wiener Neustadt Physiotherapie Wr. Neustadt
644 Parallels Confixx

645 Starting Sustainability Manager...

646 Willkommen auf casiobestpreis.at casio

casiobestpreis.at und suuntobestpreis.at casio und suunto zum Schnäppchenpreis
suuntobestpreis.at Casio Suunto Billig Günstig
StadtBranche.at Orts-Portrait von in Österreich. Die Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in erhält 4 StadtBranche.at Punkte - Bewertet wird die Anzahl der Besucher dieser Themenseite. - Stand: + Kontakt